ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J392	Uncharacterized protein	0.996	324-362	KRVIVPKKVPSISKPKRPMAFKTPTPRKPKSKSSKKKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J392	Uncharacterized protein	0.918	189-233	KPALQKKKSFLKRTWSRREFKGKQPIPQAQKPAHKQENVPAPKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J392	Uncharacterized protein	0.61	261-263	KPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J607	Ribosomal_L16 domain-containing protein	0.766	44-55	KRTKYRKAHKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC29	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1	0.986	546-563	KPSLAAGKKKKSNKKAGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE21	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase	0.673	225-229	LKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEL2	Uncharacterized protein	0.642	723-728	RIKKTR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ51	Histone acetyltransferase	0.692	54-64	RQIKKKVVSKM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNZ4	MIT domain-containing protein	0.683	318-325	KSSQRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNZ4	MIT domain-containing protein	0.626	143-145	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPN6	Uncharacterized protein	0.995	121-185	KTTTKKHTTKKHSTTKKHTTKKHSSTKKHSTTKKTSKKTTAKSKKTTAKAKKTHTKKTTTKKGGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPN6	Uncharacterized protein	0.99	218-254	AKAQNNKKKTTSKKKHTTKKHSTKKHSTKKHSTTSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT49	U2 snRNP auxiliary factor large subunit	0.996	84-153	RHSRDRYHDRSRDNRDSRRRRSRDRRERSPRDRHHGRSNRDDRDYRSSRRRRSPSPRRSSRRRSPSSRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTE8	RRM domain-containing protein	0.784	129-142	GGGRYPPKSRPRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KD80	Uncharacterized protein	0.736	158-166	KKREKTKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFI6	Uncharacterized protein	0.735	184-191	RSRRRERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IV06	Uncharacterized protein	0.996	221-251	KTKKRRSTKKKSRSTRASSTRRTKSSKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXK0	SAM_MT_RSMB_NOP domain-containing protein	0.995	11-39	KKKGGQRGNKKNAGDKKKPALSKKKEKAL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0X5	Uncharacterized protein	0.877	41-63	RTSTKRKDSPALIKAKRNAKRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4M0	PHD-type domain-containing protein	0.81	138-149	RPVKKVKRGRPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7A6	Uncharacterized protein	0.789	693-706	RREKNMKKNTKKMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGP8	SAM_MT_RSMB_NOP domain-containing protein	0.994	459-474	KSPNKKKKKNNKKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ84	Zds_C domain-containing protein	0.803	340-347	NAKPKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKU1	Uncharacterized protein	0.777	416-426	RKKNKKQVLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMZ4	GATA-type domain-containing protein	0.722	564-575	AEKEEEKLKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMZ4	GATA-type domain-containing protein	0.719	673-682	KKAPRSRKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMZ4	GATA-type domain-containing protein	0.717	546-555	QKEKREKEKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQN3	Uncharacterized protein	0.879	3-18	KKGNKKKSNARKTQPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQN3	Uncharacterized protein	0.822	430-448	LKKKRSILGKENKSVTKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQN3	Uncharacterized protein	0.61	484-485	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRQ6	Mitochondrial ABC transporter ATM	0.999	914-927	KSRRNKKKKRKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSS7	CMGC/CDK protein kinase	0.94	24-42	RKKQHEKKHAKKTSKQKPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV54	Structure-specific recognition protein 1	0.915	18-33	AQKKKRTKKDPSAPKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBG6	Uncharacterized protein	0.896	171-208	KDARSKQTRRAGRYHDKTLRNKKPSDNGEIKKKSKSII
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KCM0	G_PROTEIN_RECEP_F3_4 domain-containing protein	0.8	867-877	RHRPRRRSKSQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J004	Lactamase_B domain-containing protein	0.713	60-67	RRKHLKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1S4	Fungal_trans domain-containing protein	0.807	10-32	KKTRRSKSRPGISAEAKAAARAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3A1	WD_REPEATS_REGION domain-containing protein	0.991	307-323	IRKKIQRRKKRAREKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3I3	HMG box domain-containing protein	0.997	151-189	KRKAEQPIAEPASEKKEKKKSKKASHESSDGKKKSHKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3I3	HMG box domain-containing protein	0.903	57-71	KPKKKKAEKDPNAPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4E9	Stress response protein NST1	0.963	295-309	LKKQQDKEKKRDKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J506	DUF262 domain-containing protein	0.831	395-417	PTKRRRDSRSGGGIAVAKRGGKM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J976	Uncharacterized protein	0.76	98-111	KKRRLGLSKIKHQE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD32	Uncharacterized protein	0.851	131-145	HKHHKGHKGGKHHHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JID8	CMGC/CK2 protein kinase	0.907	75-86	LKPVKKKKIRRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKN2	Ipi1_N domain-containing protein	0.963	5-25	RKKKAAKMEDFKKKKLKVGKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQL7	Uncharacterized protein	0.862	292-309	ERKKEGQRKARAKYTWVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW23	Uncharacterized protein	0.987	1773-1796	MRAARKRKQIAGARGSGGRKKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW23	Uncharacterized protein	0.897	1488-1525	RANSTRKRKLEEKVQKKESERQTRQRQKETRAAQRQRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW23	Uncharacterized protein	0.88	330-343	RPKRPTRNAAKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K314	Uncharacterized protein	0.999	88-113	KGIPSKKSSKPKKPKKKKPSAIAPPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K457	Uncharacterized protein	0.636	304-307	GKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGC7	G-patch domain-containing protein	0.99	311-375	SSSSRRDRDDEKRKRRRSRSRDSSSSSRSHHSSSSHSHRRRRRSYSRSRSPVSRSSGSGSSSRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KH38	Uncharacterized protein	0.652	314-320	GRGRGRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ81	Uncharacterized protein	0.697	138-143	QKRKRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KK67	Nop domain-containing protein	0.949	367-379	GPKKRRGGKRVRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUH2	Retrotrans_gag domain-containing protein (Fragment)	0.975	348-367	KKSKAKTNKRKRHHHHHSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWU9	Uncharacterized protein	0.882	132-141	KKKRRKNYKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J556	Uncharacterized protein	0.978	757-768	NKKKKKKKSNHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGD3	SWIB domain-containing protein	0.965	85-106	KTTSTPIKKPAQKKKKEVKEKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHV6	50S ribosomal protein L39e	0.795	55-88	KLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJV4	Uncharacterized protein	0.997	8-37	KKTRHSNNNNKKKKQRKQIKPKHKKKPSPS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN22	Histone acetyltransferase	0.644	448-453	RRARGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNX1	Uncharacterized protein	0.673	29-33	RKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ71	Uncharacterized protein	0.683	306-313	RRRQRRQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JX27	Clr2_transil domain-containing protein	0.637	172-175	RKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KCC6	Uncharacterized protein	0.964	5-39	KHKKERKSSKREHSSSSSSRDHKKHKKSSSSSRHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ91	Uncharacterized protein	0.896	493-505	LRRFGKKKTKKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ91	Uncharacterized protein	0.637	425-428	RKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWB8	Methyltransf_11 domain-containing protein	0.78	11-29	KSKERKERRINSSSKNNRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWM9	Phosphatidylserine decarboxylase proenzyme 2	0.916	149-161	RKRLTARRKKKHG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYD2	Uncharacterized protein	0.972	24-40	KEKKPKKSSSSKKKKAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF60	Uncharacterized protein	0.975	576-641	KRRDHSSRRSRSPKEERSSSRHGHSSSSSRRHHRSSRYSNRSHERERDKPREKSSSDRDRRRNDRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF60	Uncharacterized protein	0.829	476-492	KRHSSRSRSPRRDSRRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJB6	HMG box domain-containing protein	0.74	165-176	KRKYRRHAKPDR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJB6	HMG box domain-containing protein	0.654	274-277	ARKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJB6	HMG box domain-containing protein	0.636	501-510	RRSPRFNKSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK42	Dynamin GTPase	0.909	508-520	KKKKKVDSKRKNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM63	40S ribosomal protein S6	0.947	187-207	LQRKRHRQALKRRRAEASREA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM63	40S ribosomal protein S6	0.766	131-143	KRLGPKRASKIRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM63	40S ribosomal protein S6	0.719	164-180	PKAEGKKAYTKAPKIQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM63	40S ribosomal protein S6	0.709	215-230	LAKRVKESKQEKIERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM63	40S ribosomal protein S6	0.671	88-95	RTGERKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS66	Lipase_3 domain-containing protein	0.723	360-365	KRRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXR2	AP-3 complex subunit delta	0.963	723-734	KKPKKSKKAKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXR2	AP-3 complex subunit delta	0.939	660-671	KKKKKHSKRDNS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXR2	AP-3 complex subunit delta	0.874	675-689	DTKERRRAARREARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1Z8	Uncharacterized protein	0.998	243-298	EEKRLKREEEKKKREEKKQREEEKRLREEEKRKQREEEKRIRTEEKKKREEEKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2X0	Bromo domain-containing protein	0.993	978-1031	KKKRKRLLEESKAQKKKQRLELKAQKIAEKEQKKKLREENRERDRLAKQQKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3Y6	Uncharacterized protein	0.918	9-26	RKAKLAAAKKRLKKFQSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6P3	BAG domain-containing protein	0.99	574-586	NRRRRNKKKNHRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1F7	Mitochondrial import inner membrane translocase subunit TIM50	0.69	54-63	KGDKKPTKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3W4	BRCA1-A complex subunit BRE	0.836	135-145	PSVSPPKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J988	Uncharacterized protein	0.799	119-138	RRAERFNQRIRTARKANKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9L6	BZIP domain-containing protein	0.746	138-150	KKKQTAPKKAKFK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9L6	BZIP domain-containing protein	0.641	164-166	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG60	SMP-LTD domain-containing protein	0.776	276-283	KKAKKIKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH24	HDAC_interact domain-containing protein	0.86	914-935	KRGGGGANYARRSGRRSPRHKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH24	HDAC_interact domain-containing protein	0.836	447-464	KKTKKQRALPLPKQKKTK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIG7	HMG box domain-containing protein	0.72	90-104	KKKVTPKRVYIRRNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJM2	Uncharacterized protein	0.991	711-744	EKTKGKKRKDAKNERMPGMKKFEGKEKPTGPRKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJM2	Uncharacterized protein	0.954	774-783	KKKKKNSGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JND4	Uncharacterized protein	0.859	244-269	PKTRAGLRKKSAPDTPKSILKSKKSE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP50	Uncharacterized protein	0.86	367-385	EKRAKLGRSLGASPKKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP50	Uncharacterized protein	0.67	83-88	KSRKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K112	Uncharacterized protein	0.977	494-505	KRAKKKRKQSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6V8	C2H2-type domain-containing protein	0.806	83-89	KKRKPKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBR4	Uncharacterized protein	0.84	84-95	KKGEKRRTWKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGV2	Chromatin modification-related protein	0.947	301-319	RKRKSSGLPLSKKMKRKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGV2	Chromatin modification-related protein	0.778	236-242	KRKKKEA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIC9	40S ribosomal protein S1	0.946	5-19	KNKRLSKGKKGLKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ70	SET domain-containing protein	0.949	629-644	KKKPAAASKKNKKMKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKK5	tRNA-splicing endonuclease subunit Sen2	0.728	94-98	RRKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKP6	Uncharacterized protein	0.984	222-245	KKRKKDGNDTTFKSRKKKPLRKKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQT9	Chromatin modification-related protein	0.714	149-155	SRKKSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQT9	Chromatin modification-related protein	0.679	244-247	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQZ2	Uncharacterized protein	0.991	166-200	KKDAADKKKITKKRKSKKCRDFEKAVKDGKIKADP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQZ2	Uncharacterized protein	0.885	231-264	RKKDNGSRGGFRGRGGSRGSSRGGMMAGRGRGRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSH5	Uncharacterized protein	0.999	104-132	KSGKKQKKKDGKKQKKDKKKQGKKDKGFK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSH5	Uncharacterized protein	0.999	246-268	KEDKEKKKDKKKDKKKDKKQKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JY53	Uncharacterized protein	0.643	5-9	KKRHP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1X0	26S proteasome regulatory subunit RPN2	0.753	848-854	RKQKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1X0	26S proteasome regulatory subunit RPN2	0.691	809-815	KARAKKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2ITZ7	Uncharacterized protein	0.977	119-154	PKLTRKRSKPKKKTSAAPTATTSKPKPTVNHTKKRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2ITZ7	Uncharacterized protein	0.668	264-268	KKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX35	PINc domain-containing protein	0.725	175-181	EIKKKKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX35	PINc domain-containing protein	0.615	123-126	PEKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX35	PINc domain-containing protein	0.601	129-129	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXT1	Uncharacterized protein	0.879	54-70	NPKNKKEEKKEEKKEEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3A9	B-block_TFIIIC domain-containing protein (Fragment)	1	150-194	RLKMAKDRKRKSKAAVKNTASKKKKTRTAPKKKPKKKPVKKRKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHY8	Uncharacterized protein	0.788	162-176	AHLSKYKAQKKQKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI54	NUC153 domain-containing protein	0.994	581-596	KREKLEKKKKGKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI54	NUC153 domain-containing protein	0.989	534-557	KKKESKNAKKKRASKQEREEKARE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI54	NUC153 domain-containing protein	0.927	481-497	RKQKEKRQAKKAAKHKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI54	NUC153 domain-containing protein	0.77	699-708	KSSSGKRQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNZ6	Uncharacterized protein	0.992	593-625	KSKKKESSGKKKKSSTSSSSKKKSSSSKKKKPQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQI2	GATA-type domain-containing protein	0.632	36-41	RPKYRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQR9	1,3-beta-glucan synthase	0.828	1680-1688	TKERKRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR91	Signal recognition particle subunit SRP9	0.99	106-119	KQTPKGKKGGKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAA8	Uncharacterized protein	0.97	68-91	KPKRIRVDGSRKRKQPQPKKPASK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KCG5	Activating transcription factor, other eukaryote	0.696	38-44	TKKRNRT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVD3	Zn(2)-C6 fungal-type domain-containing protein	0.87	22-32	IHRKKRIRAKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IW36	Uncharacterized protein	0.935	370-384	KKFKRKKQRSPLGRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1D7	RING-type domain-containing protein	0.735	87-99	RQRRQQRREQRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4Q3	Uncharacterized protein	0.958	162-175	LKKKKNKGKKNNLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5Q0	18S rRNA factor 2	0.949	121-148	GKKKNKLSKKLKKLTPEELEKFEKARKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5Q0	18S rRNA factor 2	0.822	189-201	AARRKKYTKNKRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6G3	Uncharacterized protein	0.787	36-52	KKHPKQIKKENLAKRAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMZ0	Uncharacterized protein	0.999	47-79	KRKKHHKKSKHHKKSKHHKKSKKSTTKKKSSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ2	Peptidylprolyl isomerase	0.991	183-208	KKMAKILEKKKLEAEEAKKKKKGAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ2	Peptidylprolyl isomerase	0.908	350-365	REKYASKQKKSKKKAN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ2	Peptidylprolyl isomerase	0.807	473-514	RKRSTKSKIAPAFRNSERDRDRDRDRDRDRDRDRDRDDRKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ2	Peptidylprolyl isomerase	0.721	263-280	KKGEKKPSMQEKLKEKVR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ2	Peptidylprolyl isomerase	0.706	526-538	KRRHDDDRPSRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ13	Patatin-like phospholipase domain-containing protein	0.636	96-98	KRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUC7	Uncharacterized protein	0.755	132-150	KTSQKRKADGEKTSAKKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2V1	BZIP domain-containing protein	0.884	65-87	KKSGIKRPLKNKQKAPTSTRRKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2V1	BZIP domain-containing protein	0.768	147-163	KRRRNTAASARFRIKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3C8	Uncharacterized protein	0.724	20-27	KNKKSKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4F9	4F5 domain-containing protein	0.863	26-40	RAKNLKKKEKESKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K732	Uncharacterized protein	0.782	708-720	KRIKKEMKKQRAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFX3	G-patch domain-containing protein	0.996	265-294	KEERGRLKKQKKPKYKVTKIRAVKAKSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFX3	G-patch domain-containing protein	0.979	5-22	KGNNKAKKREKRPRGGGF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFX3	G-patch domain-containing protein	0.839	363-381	KKLRKRVKGVQTRRVEKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZF2	Uncharacterized protein	0.908	27-46	NKKRKHNNNKKEKFNAKTKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZU9	Uncharacterized protein	0.9	1633-1649	HHRRDKKPYDRNERRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZU9	Uncharacterized protein	0.786	1090-1107	KKRRRATSNGTNSRKKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZU9	Uncharacterized protein	0.768	214-225	PKKRTTRLKRRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZU9	Uncharacterized protein	0.633	1348-1358	KGPRFKQQQRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0R4	Uncharacterized protein	0.999	100-120	GKKKHFRRKKKHFKKKHHRKM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3C4	Uncharacterized protein	0.984	757-788	KAAARAAKKSSRPAPMTNMRPQKSNGKKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3C4	Uncharacterized protein	0.983	35-75	KEPIDKKTAKKLRKQANRDQKKGIKPAAVEEQKKKKAASKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3C4	Uncharacterized protein	0.983	125-151	KKRQEAKEMKKLAKKGIKEPAAEKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3C4	Uncharacterized protein	0.776	722-740	KPKEKRGKYDGMSRQKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J897	Uncharacterized protein	0.655	7-11	KSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH54	CMGC/SRPK protein kinase	0.984	243-256	KSQKKRLKKKKKMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB5	Uncharacterized protein	0.716	35-43	HKPAKKEKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK80	Uncharacterized protein	0.993	185-213	KGTRARNLSGGRGRGRGRGRGRGRGRAQN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK80	Uncharacterized protein	0.832	59-65	DRKKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP58	BHLH domain-containing protein	0.789	237-244	NKRNKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRW3	Uncharacterized protein	0.855	2969-2985	PKERRSRRGSNSNKKGP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRW3	Uncharacterized protein	0.771	417-423	RRKKKMA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV20	Uncharacterized protein	0.611	618-619	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K239	40S ribosomal protein S23	0.758	12-32	ARKLRIHRRDQRWADKAYKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4E9	BZIP domain-containing protein	0.824	266-285	RQRRLLRNRVAAKECRKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAS9	Uncharacterized protein	0.939	259-269	KVKKLKKKKKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAS9	Uncharacterized protein	0.678	851-859	AKKPPVGRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUW1	Uncharacterized protein	0.894	146-165	SKKGKKNSKKSLASVKSASK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0Y8	Uncharacterized protein	0.874	227-238	KRKKARKNLNRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0Y8	Uncharacterized protein	0.784	354-362	KSHRKRPKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3D5	Pre-mRNA-splicing factor CWC24	0.954	21-35	KKRSSKKNIRKRKAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3D5	Pre-mRNA-splicing factor CWC24	0.615	139-143	APAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J449	TBP-associated factor 4	0.953	776-790	RGRGRPRRRKSGSGP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J449	TBP-associated factor 4	0.923	628-637	RPSKKKKKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J740	40S ribosomal protein S6	0.947	195-215	LQRKRHRQALKRRRAEASREA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J740	40S ribosomal protein S6	0.766	139-151	KRLGPKRASKIRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J740	40S ribosomal protein S6	0.719	172-188	PKAEGKKAYTKAPKIQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J740	40S ribosomal protein S6	0.709	223-238	LAKRVKESKQEKIERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J740	40S ribosomal protein S6	0.671	96-103	RTGERKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCF9	Uncharacterized protein	0.693	28-37	KPRNKRFLKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFY2	Uncharacterized protein	0.898	69-79	KNRRRSRKGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMR5	Histone-lysine N-methyltransferase	0.617	129-130	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP98	Peptidyl-tRNA hydrolase	0.677	202-208	KVKNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPP2	Uncharacterized protein	0.855	10-22	KPKQKRSRKLPRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTQ2	HTH CENPB-type domain-containing protein	0.74	70-77	RRRSRKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU20	Uncharacterized protein	0.712	44-62	RSRAPKPSPSTQEIKRRKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K048	U three protein 25	0.614	34-35	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K277	MI domain-containing protein	0.981	311-398	EEEEERKAKEEAEKKAKEEAEQKAKEEAELKAKQEAEAKAKEEEERKAKEEAERKAKEEAAIKEKEEAEKKAKEEAEAKAAAEAKAAE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K277	MI domain-containing protein	0.839	653-668	GGRNRSGRGGKGRHPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB06	Uncharacterized protein	0.861	106-116	RILHRKKRKEH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5J7	Zds_C domain-containing protein	0.953	561-576	KKAPRKRLVKKQKPRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5M9	Uncharacterized protein	0.633	66-68	RKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7S3	Zn(2)-C6 fungal-type domain-containing protein	0.772	174-180	KRGKKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB97	RXT2_N domain-containing protein	0.919	64-76	GKKRTIVKRKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.991	525-550	KESKNNSKSKPKRERKARERGQRKDE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.987	215-306	NKNDKAAEKRGKKAKLDNKQTDNRKVDDKSEPSGSKKEQKKETSREKTIQKKDSAKEKSEQTKDVNSKAKKDDSKSNIDAKKDKRKKKSEKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.908	430-441	KPKEKSARKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.898	331-347	KAEKNERREKSRKKQEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.843	752-765	RGRGSRGRGRGGFK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.798	471-478	KKKKSRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.762	398-405	KSNRKKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB6	Uncharacterized protein	0.619	203-205	AKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMH3	Rab-GAP TBC domain-containing protein	0.975	575-627	RRELFKKRRDERRRNIPVQKGGKLLKRGTMRGAIIHRAKEARYFVERAKTVRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUW1	Nucleolar protein 12	0.995	291-352	GTREVKKKGKKNSAPNHKSSGKSGKLIPSPKRLEGTRASKNDGKKFKIVKTSKKATKKGGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUW1	Nucleolar protein 12	0.768	45-89	KIKNQGKKEANKAFLGFKKARELVAATNKRKAEELEAETKKKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZZ2	Nudix hydrolase domain-containing protein	0.854	136-147	KKFPEKKKRERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4A7	Uncharacterized protein	0.688	91-98	KRKIAKER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K560	CAMKK/CAMKK-META protein kinase	0.851	70-90	SRLRRKEQMAMMKRGRGRGRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J404	DUF4604 domain-containing protein	0.964	126-143	KKSDKPSLKSKKKKTKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4F2	Uncharacterized protein	0.699	1423-1433	KKNKENPKKNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7B6	Uncharacterized protein	0.715	407-418	KRRPRFGLTKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J807	rRNA-processing protein EFG1	0.921	91-106	FERKKAERKLKQAKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J807	rRNA-processing protein EFG1	0.764	31-39	AGKIKKKIR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQJ8	Uncharacterized protein	0.702	666-673	REKKRMRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSW4	Uncharacterized protein	0.988	91-102	DEKRKKKKKKQP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTR4	Phospholipid-transporting ATPase	0.741	5-11	KKRKERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ66	Uncharacterized protein	0.993	526-562	SRGPGRGRGRGRGRGRSRSTSVAARKRSASRTSKRNS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ66	Uncharacterized protein	0.709	53-66	KKSPSPRAPRSRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZA1	Uncharacterized protein	0.993	96-112	KEKPRKGKPKKKATGKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6U4	Sphingomyelin phosphodiesterase	0.804	161-169	PKKKPKHPH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7C4	PEK protein kinase	0.914	701-712	QRPKRPKPKRTR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7C4	PEK protein kinase	0.679	604-608	RRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBZ7	Uncharacterized protein	0.753	202-211	LGRILKKRGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBZ7	Uncharacterized protein	0.659	109-113	RKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2ITJ3	SH3 domain-containing protein (Fragment)	0.91	353-370	KKKRAPPPPPPSKKVANR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J085	Uncharacterized protein	0.856	162-181	KKKKDHLKSLKSKLVRFSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0Z4	Branchpoint-bridging protein	0.765	61-66	KRKRKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5W5	Non-specific serine/threonine protein kinase	0.882	422-482	KAHRDVKPKKNIKKSGTTASAAAKEEAVKSKVARALKSQTNKQNIKNTRGNNLKNKGKRRD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAN8	Uncharacterized protein	0.998	545-571	SQKRKRGNFKKGANKKRKDPLKVIKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAN8	Uncharacterized protein	0.775	342-351	KKAHKGKKVH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBZ2	Eukaryotic translation initiation factor 3 30 kDa subunit	0.798	209-221	KNSKKAKGKVQPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIH4	Ribosomal lysine N-methyltransferase 4	0.823	456-465	QGKSKKQKRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ16	DUF3020 domain-containing protein	0.929	254-290	KRAHKLFGKEDSEHKKKWIDEEFLKRQQKRKDKERRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ16	DUF3020 domain-containing protein	0.75	229-236	RERKKRWR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQY9	GTPase EF-hand protein of mitochondria 1	0.847	400-411	TKPKKVDRKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRQ0	Uncharacterized protein	0.993	206-238	AKKSTTKKKATKKTTKKSSSKKSSSKKETRKKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRX5	Rap-GAP domain-containing protein	0.752	63-71	PEKLKKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSF6	PPM-type phosphatase domain-containing protein	0.989	170-184	QRSRKKPRAKKPKHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1T9	Myosin I	0.947	5-37	GGGGKKSGIGGEKKAIKANRPARADWKEGMKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9P0	Uncharacterized protein	0.659	1480-1484	KKRKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9P0	Uncharacterized protein	0.611	1498-1499	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAA9	TMF_TATA_bd domain-containing protein	0.796	71-85	KPKKPKASVEKKPEP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBS7	MSP domain-containing protein	0.928	168-182	RKKRRHQRREEIRKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJA4	Uncharacterized protein	0.883	253-261	KKKKKRELR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6A0	Uncharacterized protein	0.885	330-345	PRRKMRKASRSTKSRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J983	CMGC/CK2 protein kinase	0.896	75-85	KPVKKKKIKRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9T0	Uncharacterized protein	0.826	85-103	RKPKKPVSNSNKVVKPRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBA9	DUF2183 domain-containing protein	0.703	391-399	KKHRRMKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCU3	Uncharacterized protein	0.983	27-38	KKKKKKSNKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGL7	Ribosomal protein	0.747	93-104	NKNKKLIKKLAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHQ2	BZIP domain-containing protein	0.948	132-141	PKKRRGRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHQ2	BZIP domain-containing protein	0.732	581-588	KREKRTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHQ2	BZIP domain-containing protein	0.702	259-264	SRKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK78	Uncharacterized protein	0.61	241-242	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPZ1	Uncharacterized protein	0.878	316-327	RTRNKRNKRQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS02	PX domain-containing protein	0.721	404-422	QKKKRQQQSQSKHHKDLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K210	PX domain-containing protein	0.814	700-711	RKRKERHLERKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5R6	NDT80 domain-containing protein	0.701	346-350	RKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAS4	Uncharacterized protein	0.914	97-120	KKSKPVSDRKKRNQETRKQKKMAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWZ8	DIS3-like exonuclease 2	0.963	184-199	RKERRRKRKEAHLQRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWZ8	DIS3-like exonuclease 2	0.844	9-17	RRRKPKAKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3V7	AGC protein kinase (Fragment)	0.964	1326-1357	NRKKNIFKKIKDWKSKGRRCSSKQSKRTSKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3V7	AGC protein kinase (Fragment)	0.618	464-466	RRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5P1	Ras family, other	0.955	185-199	LHAGPKGKPKKEKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD54	Transcription elongation factor Spt6	0.807	87-93	RRKKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD54	Transcription elongation factor Spt6	0.705	124-131	KLKRLKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKC8	Uncharacterized protein	0.977	777-868	GGPPPPPPPPPPPPPPGGSGPPPPPPPPPPPGGSGPPPPPPPPPPAPGGMAPPPPPPPPGAPGAPPPPPPPPGGPGGPPPPPPPPGGKGPNL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKC8	Uncharacterized protein	0.974	1289-1318	DEKRKRDEEERKERLRIKKEKAEAALKEKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKC8	Uncharacterized protein	0.638	1358-1362	RRSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPG4	Small acidic protein	1	5-67	EKKDKKTEKIVEKKEKKEKKEKKEKKEKLDKKSKKSKKERKDKEKEKKDKKEKKDKKDKKRKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD8	Mitochondrial import inner membrane translocase subunit TIM21	0.847	615-626	EPSRSKRRRNRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD8	Mitochondrial import inner membrane translocase subunit TIM21	0.653	281-289	KRTLKAPKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3P0	Uncharacterized protein	0.982	240-251	RKRRRRKPSKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KHU5	Uncharacterized protein	0.999	80-103	ARRKRRGKGAPKKGQGKRASNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJG6	Cation_ATPase_N domain-containing protein	0.71	68-76	KVKASKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKW8	Uncharacterized protein	0.997	63-74	EKKKKKKKKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWT2	cwf21 domain-containing protein	0.995	271-401	RSRSRNRSRSRSRSSSYSRSPSPRRRSRNRSYSRSISRSRSPIRRRRQSSVSRSRSPMRRRGGRSLSRSSRSSMSRSRSPIRRRGRSYSRSYSRSRSPPSRGRRDNRDFTSKSRSRSRSRSRSVSSRSRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWT2	cwf21 domain-containing protein	0.99	155-209	EKKARREAELEAKFARQEKLDKRKRQQREAEEKRQKDAAKRKAEKAKSSASIDRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWT2	cwf21 domain-containing protein	0.937	218-250	KGLKRARDLSTSPPPRKSRKRSPSYSISRSRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J352	Uncharacterized protein	0.694	98-104	KSKKPKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J787	Uncharacterized protein	0.73	118-124	KRKKKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9E5	Uncharacterized protein	0.835	399-417	KPKLRSEKARLAAIEKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9E5	Uncharacterized protein	0.633	574-577	KKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBE3	Cysteinyl-tRNA synthetase	0.934	685-716	KKLAIAAEKEAKKAAAAAERERKRLEKLEKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF78	BHLH domain-containing protein	0.846	148-163	KKRRRRESHNAVERRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIV3	RING-type domain-containing protein	0.72	347-355	KLKRVKAKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM09	Serine/threonine-protein phosphatase	0.852	7-21	KKKNKQKEKRLSTSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNG7	Uncharacterized protein	0.973	258-271	ERRKKKKADAKRRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNJ7	SPX domain-containing protein	0.996	631-642	EKKKKKKKKNKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUL7	Elongation of fatty acids protein	0.889	284-308	KRAAARKQKQEKEDQQKSRPKSKKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JYW2	Uncharacterized protein	0.704	250-255	KKRKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0A2	Zn(2)-C6 fungal-type domain-containing protein	0.979	130-147	RKERKKGVKRGPYKKRNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6F2	Uncharacterized protein	0.786	550-563	SSRSRGNRNQKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWZ5	Uncharacterized protein	0.999	443-478	RRWYEKQQRKEDRKKKKEEAKAHKREKKKNGKGKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWZ5	Uncharacterized protein	0.993	4-38	RGKRGNGRGRGRGGAGARGRGRGRINIGGGGRGRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWZ5	Uncharacterized protein	0.942	579-601	GKNRSKGGPQKGKKKFVNSSKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9X1	Histone H2B	0.871	12-30	PAKTTKVKSADGKKRKISR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAJ9	Uncharacterized protein	0.91	148-164	KRFKRPKKRNSLSRQHE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAJ9	Uncharacterized protein	0.636	245-248	RKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEW3	Ribosomal_L2_C domain-containing protein	0.908	328-367	GGRGKSKGNKDPRSPWGVLAKGGKTRKTPNQFVVKPRPRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEW3	Ribosomal_L2_C domain-containing protein	0.887	83-139	KKPTTPGKRWLKRVPRDHLYKGKAVRNLTVAKRSSGGRNNTGRITIRHRGGGHKRRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIK0	Zn(2)-C6 fungal-type domain-containing protein	0.892	35-45	KKKRTGPKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNS9	Uncharacterized protein	0.886	187-196	SKRKRPKRDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVT0	Uncharacterized protein	0.724	1139-1153	KSRQLRVRQRLKRLR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2P0	Usp domain-containing protein	0.84	189-205	KVKKQQQKKAEKAAKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2P0	Usp domain-containing protein	0.674	258-272	RRSRSSSPARPSAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5R7	Velvet domain-containing protein	0.679	194-204	RKEHRLQSRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9P3	Uncharacterized protein	0.822	232-244	KVKKPSRTKGKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGW9	Alkaline phosphatase	0.818	183-190	KKPKKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIU4	Uncharacterized protein	0.973	135-158	RKKKNMMRKKMNTRRDRKLRWRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKX9	Uncharacterized protein	0.925	202-225	KPSTTTPARRGRGKGVKNKVANKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3T3	BHLH domain-containing protein	0.699	221-226	SNKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9J5	Uncharacterized protein	0.998	9-70	DRHRSSRHRSPERRHSRHRSSERHSRHRSRSRDRDRKRRHRDDSSDRHRSSKHKKEKKKYKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9J5	Uncharacterized protein	0.71	132-141	KRERDRKREA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9J5	Uncharacterized protein	0.662	146-152	AKLNKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9J5	Uncharacterized protein	0.641	115-120	KKQRDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB63	Uncharacterized protein	0.985	134-164	RGPSSKRKRAALKRSQNMKKRAAAKALKKAS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEF2	Protein SDA1	0.997	258-284	NKKSRSKDRKMDAARKKVKRKQKKGEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEF2	Protein SDA1	0.845	685-708	REKFGSNKGKKERGSTTNREKARN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEF2	Protein SDA1	0.712	732-747	QKSLRAAIEKQKRLKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEF2	Protein SDA1	0.642	564-570	ARRIGKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEY2	CCHC-type domain-containing protein	0.889	678-699	KSDNVKKPKAAEKKPAAVDKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEY2	CCHC-type domain-containing protein	0.864	765-781	VEKKKPVKAVGQKNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEY2	CCHC-type domain-containing protein	0.862	584-592	KKKTKSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEY2	CCHC-type domain-containing protein	0.773	715-728	PEKEPPIAKKKPSA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEY2	CCHC-type domain-containing protein	0.7	612-624	KAPVKEKAPSKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJG4	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.76	421-427	RRSKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJG4	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.719	148-152	RKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLU4	RING-type domain-containing protein	0.999	442-470	ENKAKERRKKAKRNRKNKARKDRKKHKAN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP39	Uncharacterized protein	0.856	4-23	KKQQTKKDKQKKEKAAEDKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP39	Uncharacterized protein	0.604	27-27	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP73	Uncharacterized protein	0.619	672-674	KKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQA8	HMG box domain-containing protein	0.678	94-101	ASSRKIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRF0	Transcription elongation factor 1 homolog	0.954	3-15	KRKTKRKPQKKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K356	Uncharacterized protein	0.974	1182-1199	SRKKKGKKKEVNQKQKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K356	Uncharacterized protein	0.651	1275-1278	RKRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAI3	Uncharacterized protein	0.949	447-459	SRKRKKEKANRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUR0	Uncharacterized protein	0.967	513-546	DSSKKKTKTTAAKSNKQKKPSCKQTPKKRPRAKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVY5	MHD domain-containing protein	0.65	303-307	KKDKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3Z3	Uncharacterized protein	0.631	551-554	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9V1	Uncharacterized protein	0.993	19-33	QFRKKKKLEKRRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9V1	Uncharacterized protein	0.776	85-96	KKKAREKEQRAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLB1	Ubiquitin	0.886	112-128	KKKCGRTNQLRPKKKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNK7	Phospholipase	0.667	124-128	QKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ75	Importin subunit alpha	0.827	13-41	KERSRFKPEEVRRRRENAQVEIRKQKKEE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR21	PARP-type domain-containing protein	0.971	162-199	KSKTKKPVASTEKAAKEQKNKKELKAKTDKKTKVTKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR21	PARP-type domain-containing protein	0.641	49-54	KSKKVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRE4	Uncharacterized protein	0.785	657-665	RRRKRRTNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTV4	Uncharacterized protein	0.999	133-174	KKAAKKASKKSKKAAKKSSEKAKKASKKAKKASKKSKKAAEA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW91	Uncharacterized protein	0.777	186-193	KLRKKKRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWU1	Uncharacterized protein	0.919	7-43	KKTKKTSTMKKPSNKKVQKVVEKLVEKKSKKDAQKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWU1	Uncharacterized protein	0.667	636-645	SIKGKDKLAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3Q2	Chitin synthase	0.955	967-982	ERKRVRANKRRERKER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K585	SH3 domain-containing protein	0.773	163-170	RKRKKSRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ53	Uncharacterized protein	0.843	137-145	KKNKKKIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ53	Uncharacterized protein	0.689	101-113	GLRKRNIHEPEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3N9	SPX domain-containing protein	0.839	647-659	KKPKNKNSKKSIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6A6	ERCC4 domain-containing protein	0.99	252-296	RKEKEKEEKKRQRELAAEEKKRKKAEALEEKQRQKEQKQLEKERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF63	J domain-containing protein	0.976	295-361	DKKRRNAKKDAKAAADKAAAEAAAKKAEEEKLAAEKAEAEAKAAAADSKKAKEMAKRVIKKEKKTIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFB9	RING-type domain-containing protein	0.601	403-403	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFG6	Uncharacterized protein	0.698	353-366	RMRRETRFKRQTRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLH8	Uncharacterized protein	0.622	740-742	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPM7	Uncharacterized protein	0.802	128-135	KKKKKHQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD9	Uncharacterized protein	0.945	51-61	AKKRKKNKPKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUZ7	40S ribosomal protein S8	0.954	8-56	RHKRSATGARRDQYRKKRKFELGRQSANTKLGGKRIHLVRVRGGNFKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K436	BHLH domain-containing protein	0.769	432-440	KLAERKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5Z2	Uncharacterized protein	0.669	177-189	KKKSGNQKSSKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J336	Uncharacterized protein	0.622	397-399	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7G1	Uncharacterized protein	0.921	276-286	LKKIRKKKSKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB70	Uncharacterized protein	0.983	29-59	KPATKRKRTAKNDTTPKPQKKKALKSVKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBS4	Uncharacterized protein	0.643	1280-1288	KFDKKDIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCC2	Uncharacterized protein	0.691	454-465	KARKALKESKER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDT3	Ribosome production factor 2 homolog	0.65	10-15	ARAKRF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDT3	Ribosome production factor 2 homolog	0.604	247-247	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGM9	Uncharacterized protein	0.927	180-200	IIKKKYKKGFSRLRKLHKAQL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGM9	Uncharacterized protein	0.845	31-46	PRRLKALLKKRHARQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGM9	Uncharacterized protein	0.797	375-384	GKKRKMQKGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGM9	Uncharacterized protein	0.625	245-249	KGKGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHE4	Uncharacterized protein	0.836	137-146	RVARRKRKLA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHE4	Uncharacterized protein	0.74	26-34	AKKRRSNGP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKL4	Uncharacterized protein	0.655	424-432	KKRNSRQPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSK6	Uncharacterized protein	0.679	1091-1099	KKKSISKHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSR0	Non-specific serine/threonine protein kinase	0.99	575-598	PRWKKLLKKRAKEKRTRARIAAAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSR0	Non-specific serine/threonine protein kinase	0.645	656-659	KKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUW2	DNA-directed RNA polymerase	0.904	1009-1018	KKDGRKKKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3E4	Uncharacterized protein	0.966	21-44	KKRKMKDTEESKNVPRKRGRPRKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBZ4	EF-hand domain-containing protein	0.93	416-425	APKKKKKKTE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBZ4	EF-hand domain-containing protein	0.823	289-297	LKRIRKPKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBZ4	EF-hand domain-containing protein	0.706	276-282	LKKVKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KDC4	Pre-mRNA-splicing factor 18	0.968	46-74	EEYRRKEKEREEKERQKKARLAEEEAKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1Z4	Non-specific serine/threonine protein kinase	0.609	199-200	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J318	Uncharacterized protein	0.699	6-11	RRRNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDM5	Homeobox domain-containing protein	0.815	180-188	RRRKAPKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDM5	Homeobox domain-containing protein	0.652	203-207	RKHKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH13	tRNA-binding domain-containing protein	0.999	182-240	KKGDKKGGDTKAAAKDNKKPEAAAAAPAAAAAAGKDNKKGPAEGGKPKKEKKKAEKKPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLS9	Sas10 domain-containing protein	0.964	526-558	KILKNKGLTPHRKKENRNARVKHRNKYAKQMKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLS9	Sas10 domain-containing protein	0.876	372-380	KKLAKKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNN0	Non-specific serine/threonine protein kinase	0.947	144-161	PRRIQRKDKQQKPKKKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVB6	RRM domain-containing protein	0.969	5-24	KKLSKREKKAEAFKKRAKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVB6	RRM domain-containing protein	0.865	84-93	HKKKNRRSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVB6	RRM domain-containing protein	0.792	187-206	ARKEKLKIKNERLAEERTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2F8	Ribosome biogenesis regulatory protein	0.994	297-313	KFGDKKKKFEKKKGGKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2F8	Ribosome biogenesis regulatory protein	0.804	172-188	REEKKGRVEKNTKRQRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2F8	Ribosome biogenesis regulatory protein	0.64	101-116	KDKPLTRWEKFAKVKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IU26	Myb-like domain-containing protein	1	150-194	RLKMAKDRKRKSKAAVKNTASKKKKTRTAPKKKPKKKPVKKRKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IU26	Myb-like domain-containing protein	0.877	799-815	APSKPEDAPAPKRRKRT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IU26	Myb-like domain-containing protein	0.853	1580-1599	TKEKRLERLLMGGKKRRTAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IU26	Myb-like domain-containing protein	0.851	916-927	PAPKAKRGRPRV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IU26	Myb-like domain-containing protein	0.668	1654-1658	KAKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVT7	60S ribosomal protein L27	0.91	55-69	KAMGKKKTAKRSKVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9I9	Ras-GEF domain-containing protein	0.764	32-57	SKSPPPPVPPKPTRIHQKPMIPPKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGH8	Uncharacterized protein	0.863	521-537	IRHRIKTMKQRIRKRNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKD5	SRP40_C domain-containing protein	0.882	482-494	DKFRAEKNKKKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMW6	50S ribosomal protein L4e	0.909	193-212	RKLRAGQGKLRNRRHRQRRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSV3	Plasma membrane ATPase	0.769	877-892	KKPTLSLKKLKQKNKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVS4	Uncharacterized protein	0.796	857-867	KKSRSPNKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVW8	Adenosinetriphosphatase	0.998	139-179	SKRRHESPSPERRHRRHRSRSRSRSRSPSRRRDRRPSPPGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVW8	Adenosinetriphosphatase	0.683	1115-1119	KRKKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVW8	Adenosinetriphosphatase	0.607	1140-1141	AK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JYM2	HTH APSES-type domain-containing protein	0.787	1097-1125	KKRRRSSIVEKDRDEPIPKATKSSHSRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K773	Uncharacterized protein	0.701	1055-1065	KRISNWKKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVI5	Aspartate--tRNA ligase	0.715	36-48	KLQKDKEKAERKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWR4	AGC/PKA protein kinase	0.805	241-256	TRAPNNNKQRRQKHRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3X7	Uncharacterized protein	0.879	150-159	KKKKKHWKHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6U5	CLASP_N domain-containing protein	0.714	628-637	KRSPRPKLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH41	Uncharacterized protein	0.997	257-287	RKRSRKLNASGGQRDPRGRKKKRHKHPFAPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIH9	Ubiquitin-like domain-containing protein	0.984	38-52	PKKAAKVKKSKKKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJL3	Uncharacterized protein	0.964	140-161	QARKQAERRKQRRTKATIPRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKI9	BZIP domain-containing protein	0.813	100-120	PKQKRKAQNRAAQRAFRDRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ66	Uncharacterized protein	0.938	119-133	RKRRVHRRKGGHGGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR64	ERF-3	0.982	66-107	KLPESKPAAPAAEAPKPAAEAPKPKPAAPKPKATPAPAPKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR64	ERF-3	0.651	496-501	GKKTRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTD9	Uncharacterized protein	0.987	104-139	KSKEKKSAKLKEKKTTTSKRKTTKATKQKPKTAPKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTD9	Uncharacterized protein	0.968	191-201	SNKRKRKRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTD9	Uncharacterized protein	0.626	408-411	KKAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBW1	Uncharacterized protein	0.935	460-476	KRFRPQKSKKRKSAGPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBW1	Uncharacterized protein	0.664	184-189	KKIKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2Q9	Uncharacterized protein	0.686	347-354	WKKKEIKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7U1	Uncharacterized protein	0.671	198-204	RRRNKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9E0	Uncharacterized protein	0.759	149-159	KRQLREVKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH72	RGS domain-containing protein	0.94	315-323	KKKKKQKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJC4	Serine/threonine protein kinase	0.982	504-524	KSKKSSKHRKRMKKAALIIRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNV1	TIMELESS domain-containing protein	0.996	559-580	GKKMMFVRKKKNQKKKKPAKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNV1	TIMELESS domain-containing protein	0.64	340-343	GKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ76	High mobility group protein B2	0.754	129-143	KKVKKDSVKKESIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ76	High mobility group protein B2	0.628	41-44	RKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR77	Chromo domain-containing protein	0.997	231-252	NKKKKSAKEPARNGKKRKGKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR77	Chromo domain-containing protein	0.657	452-455	KRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVS5	Uncharacterized protein	0.805	304-338	GPRGPGGPGGPGGPGGPGGPGGPGGPGGPGGPGGP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWE3	Uncharacterized protein	0.994	222-279	PPPPPPRPSGSMGSKARVPPPPPSRRHAPPPPPVGGRRPPPPPPPSRRAAPPPPSRSH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWE3	Uncharacterized protein	0.982	133-153	KASSSKSKKKKETSGKRPKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWE3	Uncharacterized protein	0.806	502-536	PPPPLPNRDRRGPPPPPMGQRPTARSNAPPPPPPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWE3	Uncharacterized protein	0.606	549-553	PPPPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4V1	Uncharacterized protein	0.61	109-110	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUV5	TRP domain-containing protein	0.786	576-583	RKRKRSNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4A9	Uncharacterized protein	0.971	224-270	MLKRKMKLESKMKGKKEKVNQNQKLSKLNPKKVTLRNPPNAPTRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB29	Uncharacterized protein	0.795	142-148	KKKRKRM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF50	Uncharacterized protein	0.958	251-262	RKGGRKGGKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI64	DDE_3 domain-containing protein	0.842	40-48	PKRIKKRKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLP8	Uncharacterized protein	0.96	332-354	KERKKMRRQRRAEALKDKRDKIR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLP8	Uncharacterized protein	0.753	56-70	PHSRHKSSRAPPPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMF3	Uncharacterized protein (Fragment)	0.737	581-594	KPLIKDIKPKKISK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRL6	DNA ligase 4	0.827	595-614	GKKRDAADKIVRGSGKKSRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS95	B-block_TFIIIC domain-containing protein	0.738	427-446	VRKRPHRINQATKETAKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS95	B-block_TFIIIC domain-containing protein	0.657	1525-1535	RKIQRGVRPKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSK7	Ubiquitin-conjugating enzyme E2 M	0.687	10-19	KEAEAEKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JYZ4	tRNA (guanine(9)-N1)-methyltransferase	0.996	66-101	ERTKGKREKFKRKRAERRQLERDGAVEPLPKRPKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGX7	Ribosome biogenesis protein SLX9	0.932	56-87	KKKARHEAWLEKLDRSYAVKKKMQKKENRKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGX7	Ribosome biogenesis protein SLX9	0.789	133-142	NKIKSKKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWN3	Zn(2)-C6 fungal-type domain-containing protein	0.898	27-37	KKKRTGPKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXD1	Uncharacterized protein	0.861	350-356	KKKRRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P9	Uncharacterized protein	0.933	364-374	SKKRSHKKRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P9	Uncharacterized protein	0.883	34-48	KASRSKKDRKRGAPT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P9	Uncharacterized protein	0.824	877-905	KKEKKGALRELRKDNQFIAREKAKERKHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P9	Uncharacterized protein	0.696	932-937	REKGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4Y4	Uncharacterized protein	0.696	247-252	KRPRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5A8	Very-long-chain 3-oxoacyl-CoA reductase	0.928	307-323	RKRALRKREREAAARKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7S9	Uncharacterized protein	0.994	10-38	KGSLKFKGGESASIKKKKKKSSKSSKEKM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J841	Uncharacterized protein	0.968	172-213	AKEAKENEQKAKEKREKEAKKAEEDLLKMEEKEKKSAASKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGV3	Uncharacterized protein	0.979	63-74	KKKKKKEKKEKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ80	Uncharacterized protein	0.973	1351-1381	NKPKKAKKSVETTAAVKRKRSKKSSFLKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ80	Uncharacterized protein	0.86	1479-1496	KHPVKPKRGSRLGLTKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKB0	BZIP domain-containing protein	0.987	26-61	KIRKKPGRKPNPASPALRKAQNRAAQRAFRERKERH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLC5	Uncharacterized protein	0.807	344-352	RDKWKRRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQH5	PHD domain-containing protein	0.998	197-229	PKPKPVKKSNARNKKKKRAAPAPAPPTRASRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQH5	PHD domain-containing protein	0.989	464-491	QKPKRKKVKLDKDGNPIPLKKRGRKPKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQH5	PHD domain-containing protein	0.937	434-449	SKKPKKASKKSATKTK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRJ6	NTF2 domain-containing protein	0.783	114-121	KKKKRFTP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRJ6	NTF2 domain-containing protein	0.765	472-480	KIRRKDKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRP7	Uncharacterized protein	0.667	218-226	RKSLTKKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTT3	Chromatin-remodeling ATPase INO80	0.886	1029-1043	EEQRKAARPAKKSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTT3	Chromatin-remodeling ATPase INO80	0.845	80-98	WKKNEKEERELRKKAEKEA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTT3	Chromatin-remodeling ATPase INO80	0.624	70-74	KRASK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZS5	BZIP domain-containing protein	0.823	78-96	RKRRKEQNRAAQRAFRERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3R8	HECT domain-containing protein	0.686	22-30	KREKERIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7P0	BZIP domain-containing protein	0.83	177-195	KRRRNAGASARFRDRRKQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAI4	Uncharacterized protein	0.836	178-187	LQDKRKGKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXF4	OTU domain-containing protein	0.996	339-372	KKPKKLSAAERKKEQKKRQKENKLMKDRAKAARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXF4	OTU domain-containing protein	0.969	3-20	KGKEKRAKREKLTRKQRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J283	60S ribosomal protein L36	0.757	66-86	RDKRARKLCKAKLGSFLRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4D6	Uncharacterized protein	0.968	91-102	KKNKKKNKKKNN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9B8	Uncharacterized protein	0.671	592-599	KKFKKFPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9B8	Uncharacterized protein	0.629	717-719	RKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEU5	HMG box domain-containing protein	0.92	44-66	RSRIDKSAGSKPQRKKKDPNAPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFI7	Uncharacterized protein	0.775	36-45	RRKRRSARHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFI7	Uncharacterized protein	0.684	558-564	RPRKPPS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNT6	Uncharacterized protein	0.692	126-131	KKRKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSZ8	IPPc domain-containing protein	0.866	604-613	KHKKSRAKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K683	Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	0.842	78-92	EAARKRHLSRKKMLP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KA03	Uncharacterized protein	0.804	368-391	VRVRGQHTKTTGRRGRTVGVSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KA03	Uncharacterized protein	0.649	355-364	KIRNHRGLRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAH9	Uncharacterized protein	0.711	259-264	SGKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGF9	BHLH domain-containing protein	0.869	233-249	KKRRRRESHNAVERRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1Q1	Uncharacterized protein	0.967	78-106	KKPGTRLFKVNDRRQRLKRKRIVKQLKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2G6	Uncharacterized protein	0.933	232-244	GGERKKRKIRRMN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2L9	Pre-mRNA-processing protein 45	0.706	580-586	AKKGKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J359	BHLH domain-containing protein	0.885	513-529	ELLPKPERRPYRRRNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J359	BHLH domain-containing protein	0.601	508-508	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9X3	Uncharacterized protein	0.998	6-37	KTKKPGKPKQKGGREKKGVMKKGARRIPPKQA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD50	Mediator of RNA polymerase II transcription subunit 13	0.655	830-835	KKNKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGC2	Uncharacterized protein	0.849	89-99	AKRARSRKKVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHL7	AMP deaminase	0.834	151-158	RRKKKEKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHS8	C2H2-type domain-containing protein	0.644	83-87	HKRRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK12	C2H2-type domain-containing protein	0.982	122-151	HGPKRHPAEFKEMRKLWRKQKKEREAQKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKR2	Ribosomal protein L15	0.98	156-202	HKRREARGLTAIGKKSRGHGKGHRFNNTKGSGRRATWKRRNTLSLRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKR2	Ribosomal protein L15	0.96	40-78	SRPSRPDKARRLGYKAKQGFVIYRIRVRRGGRKRPVPKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMN3	DIS3-like exonuclease 1	0.782	344-352	KVSSRKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNG8	VASt domain-containing protein	0.987	585-602	LANSGKKKGGKRRHRHRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ08	Uncharacterized protein	0.83	9-23	RGRRKGSTNKPKKVP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ09	Uncharacterized protein	0.839	29-42	KRSKNRSNKKRNSI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0W3	TPR_REGION domain-containing protein	0.999	445-503	RVKDRKGDGSKSPSRRSRRRRSPSPAKPSRRKRSISPKSRQDKRKRSNSPKKGDDKSRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0W3	TPR_REGION domain-containing protein	0.998	240-375	KSKKKRSSRRSRSRDDERRHRDDKASDRDRDRTRDRGRDKIRDKDRDRDRDSERNRGRDRNRDRSRERRRDRDRDRDRHRHRDRDRDDRKRHRSRDKSNTRENRQRSSSVSKSKRGDDDRQSRRRSRSPTTDRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4B1	Uncharacterized protein	0.741	219-238	RIRQKLKKDAVSREGRQKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K679	40S ribosomal protein S30	0.982	38-56	PKVAKQEKKKPKTGRAKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6B6	ATP-dependent RNA helicase DBP10	0.997	944-995	QIRKDRVALEKRREKSNRPSSSGRGGRGGGRGGGRGGGRGGSRGGRGGGRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6B6	ATP-dependent RNA helicase DBP10	0.988	4-65	KKPVSKKPVAKKPLLNKKSAGKFSKKPQSKVEEAPEKELSKSKLKKQEFQRKKYNKDKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6B6	ATP-dependent RNA helicase DBP10	0.879	418-429	KYKKRKADKKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6B6	ATP-dependent RNA helicase DBP10	0.767	905-912	KKMKKRKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8Q8	Uncharacterized protein	0.873	25-47	RTSTKRKDSPALIKAKRNAKRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB14	Uncharacterized protein	0.745	116-127	ARRRKNIERNRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWI2	Nucleolar GTP-binding protein 2	0.92	639-673	KNKNRNKVKPDEQKKKVLNSRLKGSAISGSKRKRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWI2	Nucleolar GTP-binding protein 2	0.713	514-521	RAKAKKAE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWI2	Nucleolar GTP-binding protein 2	0.686	534-540	EKPKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J576	Uncharacterized protein	0.916	357-388	SPPPKSPLPPTPRRLVKPPPRSVSTRKSKPRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8J2	Rieske domain-containing protein	1	106-135	PPEKNKKDKKDKEKKKQKKKEKKDKKKKMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJN8	Uncharacterized protein	0.844	145-167	RRKKTKTPKTQTKNAPDHAKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSS4	Uncharacterized protein	0.945	107-120	KKKDRSKKVKKVSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVH2	Uncharacterized protein	0.993	27-41	PRRRRRRPRNRRKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWG7	SET domain-containing protein 2	0.989	473-489	KKPAKRHHQRKRFKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXY3	Double-strand break repair protein	0.637	596-601	RGARGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZJ2	SH3 domain-containing protein	0.744	400-429	GKKEKSGIRKFFSRSSSGSSSSKESKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZJ2	SH3 domain-containing protein	0.701	176-181	LKKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1U5	CS domain-containing protein	0.999	477-497	DKKKKRKRRVKRANKAKQAGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7G5	CULLIN_2 domain-containing protein	0.712	654-661	KIKKSRKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB01	Uncharacterized protein	0.645	67-72	KHRDKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KH49	Uncharacterized protein	0.915	476-486	PRSKRGKGKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IW46	Midasin	0.704	668-675	LIKREKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J150	CDC7 protein kinase	0.743	193-201	PKRRGRAPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5D2	Uncharacterized protein	0.688	293-302	RKSSLKAKRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8U8	Uncharacterized protein	1	50-74	ARRKDKDKKKRRKKKSKDKKTPIRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8U8	Uncharacterized protein	0.867	323-333	PPKRNVRKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAX8	C2H2-type domain-containing protein	0.868	150-162	APKVRARPKNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD78	Uncharacterized protein	0.971	501-521	KKKNGFYKRQREKKKRIKEAE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD78	Uncharacterized protein	0.929	446-456	KKKKKSTKKKF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMR7	ORC_WH_C domain-containing protein	0.729	28-44	KRQNKGTQSTKTKKAKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQE2	Kinesin-like protein	0.979	469-495	KRKRKDEVEEERRRRKKELEEEKLRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXB8	Uncharacterized protein	0.949	120-138	SRPRKPRNTEPKRKKVIAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K084	Uncharacterized protein	0.707	1207-1211	KKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K084	Uncharacterized protein	0.65	764-767	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K298	Uncharacterized protein	0.779	53-59	RKKRMKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2R6	LysM domain-containing protein	0.998	86-256	RAAAVVHKKKASNAHKPKKPAHKGKKDVSPKKASPHKKASSHGKAAAYKKSVAHMKSATHKKDSTHKKDSAHKKEPAHHKKAPAHKKLPTHHKKSAAHKKAPTHKKEVHHGKKSSHHKKVAPHKKEPVKHGLGKRSPKAKHTASATVTKHHKKEKKHHKNSNHHNKKQESK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KC23	JmjC domain-containing histone demethylation protein 1	0.809	554-565	RRPVQRKPNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KC92	Uncharacterized protein	0.998	567-652	KRRGEEKSSREREKDRDRHRDESISSSRRERNHRRKSRSRSRSPVSKSHRSESKSRRSSPPPPSARRQTSSESSHRRRSPAARPER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYX8	CP-type G domain-containing protein	0.975	634-648	KSKKHKKGKKHVKVR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3E2	ULP_PROTEASE domain-containing protein	0.677	86-93	RITPSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J915	Uncharacterized protein	0.916	223-243	KNTKAPGGGKAKVKKSTRVKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLQ3	Uncharacterized protein	0.745	178-189	RKHESKRKNERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMC0	Uncharacterized protein	0.671	505-514	KPPKPLKGNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQT5	Uncharacterized protein	0.696	91-97	KPKSKRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRR9	USP domain-containing protein	0.969	544-558	KKRRWGLGSKKKDKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSJ4	DH domain-containing protein	0.669	668-671	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K616	Hist_deacetyl domain-containing protein	0.619	595-598	RDKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9V4	Vezatin domain-containing protein	0.808	538-558	GKEKAKKTRQERIEEMKLKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KDJ5	Chromatin modification-related protein EAF3	0.702	171-177	RFKKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ08	Uncharacterized protein	0.658	144-147	KKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUM3	Uncharacterized protein	0.629	403-406	LKKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUM3	Uncharacterized protein	0.612	398-401	KTKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1S5	Nucleotid_trans domain-containing protein	0.766	325-336	KKSEKKKAVNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5Q7	Uncharacterized protein	0.67	400-404	KKHRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBT8	Uncharacterized protein	0.852	4-14	KKRGRPKLREK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC18	Uncharacterized protein	0.685	421-428	KKRYRRHL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDB1	Uncharacterized protein	0.704	113-119	KLPKKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF76	Uncharacterized protein	0.747	177-185	KKKVKAKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF76	Uncharacterized protein	0.667	17-25	KRKHANKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGT7	Chromatin modification-related protein EAF6	0.987	171-190	RREKKRKLKAHEGMRKKKSS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIN6	BZIP domain-containing protein	0.985	70-106	KVRKKPGRKPNPASPALRKAQNRAAQRAFRERKERHM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMS7	G-patch domain-containing protein	0.999	854-943	DGYKKQRHSRSRSRSPSASPDRSRRDRKSSKKSRRSKSKRDRSRSRSRDDDRSSSKRHGDSKKRKSDKESHRSSRHRHHHQHKSSRHKHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRS2	RRM domain-containing protein	0.998	136-333	KHRERSPSPRRARYSPPPYRKINNRGPPPPLNRRGDRFGGGRDRGRRYSRSPSRSPIRRGRRYSYSRSRSLSRSFSRGRRRSYSRDRRSYSRGRSYSRSRSYSRSLSRSRSRSRSLSRSRSPIRRSRTPIRRSRSIRRSRSPIRRSRSPIRRSRSIRRSRSPIRRSRSIRRSRSPIRRSRSRSYSRSLSRHRSSSIRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRS2	RRM domain-containing protein	0.853	29-47	PSPRSPKSRSRSPIRRNRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRS3	Dual-specificity kinase	0.734	876-881	GKKRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6Z0	HAL protein kinase	0.645	70-73	KRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KH07	Uncharacterized protein	0.941	577-586	PKRRKQKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXZ7	Uncharacterized protein	0.986	445-464	EKDRMREARRKRRGTRARRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXZ7	Uncharacterized protein	0.833	202-218	RFPRDNKRRSRTAKRDR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J036	SH3 domain-containing protein	0.902	223-231	RRKQKKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8H2	Uncharacterized protein	0.934	84-102	PKRGSNAREHKKPRKTPPT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9I0	Uncharacterized protein	0.991	548-561	KIRRRRKKKAHAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB2	Poly [ADP-ribose] polymerase	0.921	213-230	DGKKKRAGGGTGRKTKAQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB2	Poly [ADP-ribose] polymerase	0.781	43-57	QSKNKDSKLKKSIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB2	Poly [ADP-ribose] polymerase	0.674	187-190	KKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIB2	Uncharacterized protein	0.913	167-180	KSIDKPIKKKAKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKP1	RRM domain-containing protein	0.838	17-39	KKRKSSGSDKSKFKKQNNNKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPI7	Dual-specificity kinase	0.751	814-820	SKGKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPW2	RNB domain-containing protein	0.964	40-55	KKSPNSRRRRRGSRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPW2	RNB domain-containing protein	0.885	100-118	HKHRRRSSHTGSKARPKHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQN1	Uncharacterized protein	0.976	438-458	RSKRSAKKKRKSIMEKTMSKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9L6	Uncharacterized protein	0.904	183-198	KLNKSKQKKRAIRSKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZG2	RING-type domain-containing protein	0.605	73-73	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZG2	RING-type domain-containing protein	0.605	75-75	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J507	Uncharacterized protein	0.685	135-143	HHKKPSRSN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J552	6PF2K domain-containing protein	0.813	401-417	RPKPKAGAAPSLKKKPS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5J5	RING-type domain-containing protein	0.954	564-582	RVKKRKDKERKEDQRRKQA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5J5	RING-type domain-containing protein	0.948	680-690	KSHRKRRGRKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5J5	RING-type domain-containing protein	0.859	34-46	KHHNGKKRSNKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J735	Uncharacterized protein	0.923	297-306	PRKKRGRKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7D0	Uncharacterized protein	0.864	88-97	KKKKSKRHQP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9J3	Uncharacterized protein	0.61	340-341	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCQ1	Uncharacterized protein	0.99	68-91	KRGLADKILKRKEKERSKHKKRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCQ1	Uncharacterized protein	0.867	162-169	RSPKRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMW3	Uncharacterized protein	0.997	212-236	AAARRKRNQKDKKRQNKKKKSAEKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMW3	Uncharacterized protein	0.796	114-127	KTRKSKSNARRRSS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNB6	ArAE_2 domain-containing protein	0.899	242-260	KRMKKGKRQPLSTLKRYKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNX4	Uncharacterized protein	0.612	100-101	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRJ3	Fork-head domain-containing protein	0.907	312-330	KRRKSTDPQRPPPKAGKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWX9	Sister chromatid cohesion protein	0.911	787-798	GWEIKRKKRIRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K054	Ribonuclease	0.953	282-312	KRAKKMLEEKIAQKERLRKRAAKYNHHRKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K249	Ubiquitin carboxyl-terminal hydrolase	0.669	105-108	KRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K945	Fungal_trans domain-containing protein	0.721	30-35	KKRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KF00	Uncharacterized protein	0.918	29-55	RRSNPEFRKQLRRERKQAAKASKEAEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KH99	Allantoicase	0.929	493-504	KPKHGPHKKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IY54	Uncharacterized protein	0.661	210-214	RKNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZU1	Uncharacterized protein	0.969	364-377	KDKKKKKDEKKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZU1	Uncharacterized protein	0.949	432-441	TSGKKRKNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J222	Ubiquitin carboxyl-terminal hydrolase	0.615	278-279	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J649	Uncharacterized protein	0.952	281-300	SPPSSPRKLRKSSRLRRSKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8B8	Velvet domain-containing protein	0.66	195-203	RKELRQRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAC4	Type 1 phosphatases regulator	0.746	133-138	RKKKRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG70	Peptidyl-prolyl cis-trans isomerase	0.97	612-683	KRHRSDEQGSRRRDDDRRRGDDRRRDDYRKRDDRRDDRRDYRRDDRRDYDRKRDDDRRDRRRDDDRRRSSKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGT9	HAL protein kinase	0.751	462-479	KREAGVLKARETIRKRAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB3	Actin cytoskeleton-regulatory complex protein SLA1	0.947	193-200	KKKKKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB3	Actin cytoskeleton-regulatory complex protein SLA1	0.946	433-512	VQRRKEQEEQDRKRREQEEARRREEEERRREEERQREEEERERRRQVQEAAKRAEAARQKQLEEDYRRKEAERKASLARS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKJ4	Nudix hydrolase domain-containing protein	0.843	171-184	KTKEKKSKRFFRKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKJ4	Nudix hydrolase domain-containing protein	0.799	115-124	KWPEKKRRER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ1	Uncharacterized protein	0.98	555-592	KPQPKKKANTAWSEKTDAKERKIVRKEKKQAKKEFLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPM3	Palmitoyltransferase	0.781	396-407	RRRKTPKEDKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQW6	Uncharacterized protein	0.996	30-57	KRRNDPNLKKKLKKEKKKAQKEMKKAEE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS88	Uncharacterized protein	0.996	451-465	KIKKPEKKKKHKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ95	40S ribosomal protein S25	0.988	34-62	KKDVAGKPSSSSGGKKAKKKWSAKKVKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3Z7	Uncharacterized protein	0.817	14-26	KKPRKRFVGRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFM0	Nudix hydrolase domain-containing protein	0.999	39-77	PKKEKKDKKSKDKKSKDKKSKDKKAKDKKKKKDAGAEKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR9	HAL protein kinase	0.98	184-206	KKLFKGDKHKKRSSKKDSDKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYY4	Uncharacterized protein	0.677	535-542	RKRNRERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J447	Uncharacterized protein	0.699	21-27	RPKNRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4M4	Uncharacterized protein	0.966	132-160	KKGKSRKTSTAANKKKPVANGKTSKKKAT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4M4	Uncharacterized protein	0.622	169-171	KRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6Q7	Uncharacterized protein	0.768	230-240	KHPRMSRRKRT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9D9	Fork-head domain-containing protein	0.815	65-72	KPPRKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9T1	Uncharacterized protein	0.956	380-399	KAKKKELQDKSKGKGKGKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9T1	Uncharacterized protein	0.81	422-439	NGRRRLFRNEQQRKKKHE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAU7	Uncharacterized protein	0.89	122-136	RKAEKSSKRAKVKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFU6	Spc7 domain-containing protein	0.709	58-63	RRKRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFU6	Spc7 domain-containing protein	0.661	73-79	TRSPKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGK3	CID domain-containing protein	0.989	358-471	SRSRSGSRSPSRGRARGHGRGRERSYSYSRSRSRSRSRSRSRSYSPGYRRHHSSNHSSRRSRRSYSRSHSRSPPPSRFRGGGRRASPPTYRGGSPPRGRSPSGRGRRPSPPPHP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJW7	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.915	857-887	EAALKDKAEKKASKGASATTAPRKKVNKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK09	Uncharacterized protein	0.713	4115-4121	KKNKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK09	Uncharacterized protein	0.67	4073-4077	KKKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKI4	PHD domain-containing protein	0.612	406-407	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNM2	Uncharacterized protein	0.671	1029-1034	KEKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRK3	Uncharacterized protein	0.838	69-82	NNRSKSKSRNRRRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTG4	Uncharacterized protein	0.938	186-198	KKKKSKKLAERRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBU0	Uncharacterized protein	0.991	28-54	HRKAKRADAKRRAEKALERAASKRRKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IU64	Uncharacterized protein	0.825	14-27	KKPPVSRPKAHRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2V1	Uncharacterized protein	0.788	69-79	KSKKLKDRKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCF5	Uncharacterized protein	0.925	800-815	KAAARKGRRAKSPGKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE30	60S ribosomal export protein NMD3	0.746	371-377	ARRKKTR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEE1	Histone acetyltransferase	0.907	20-29	AKRKRGRPKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEG1	Chitin synthase	0.976	775-790	RKKASYRRRLHKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFQ6	BHLH domain-containing protein	0.834	95-103	SKKKSKPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGF9	Bms1-type G domain-containing protein	0.99	7-33	KAHIKKKAGKKVERKKENKFSNAKKSS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGF9	Bms1-type G domain-containing protein	0.929	1088-1128	KDRKRKIKDTERRDMLEKKRAKIAETTEIKTKERRKAYFRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGF9	Bms1-type G domain-containing protein	0.768	688-700	REKIAKRKEELRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGF9	Bms1-type G domain-containing protein	0.728	670-677	KGKKRDKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJV8	PLD phosphodiesterase domain-containing protein	0.84	227-235	RRRQKKKKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPX4	Zn(2)-C6 fungal-type domain-containing protein	0.782	26-32	KRRRKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQX1	SUN domain-containing protein	0.92	556-583	KKKSSSKSGSKKTKNAANKGNPSSTKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS76	RRM domain-containing protein	0.932	610-633	KEILKKRQKNAIKNQKRRSTKNLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS76	RRM domain-containing protein	0.72	125-129	KKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT54	AAA domain-containing protein	0.942	1110-1134	RKEEEDRVKTAPMKSRKGKGKQRAE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV08	Uncharacterized protein	0.988	535-584	RKKQERAAARRKRREEKAAAAAAAAAAAAELKRKQEEEEAARKAEEERKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV08	Uncharacterized protein	0.968	1481-1493	KKKKKSEKKSHKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV08	Uncharacterized protein	0.943	1452-1459	GKKKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV08	Uncharacterized protein	0.762	707-733	ARKAEEARKAEEEKLKEEARKAEEARL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV08	Uncharacterized protein	0.613	649-651	ARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV08	Uncharacterized protein	0.604	645-645	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVV8	Uncharacterized protein	0.993	991-1009	NKPKKEKKEKREPKPPKKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVV8	Uncharacterized protein	0.696	965-972	KGGRRHRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWH5	Uncharacterized protein	0.733	563-572	HRKHHKHHKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWM1	ThrE domain-containing protein	0.988	260-279	TKKKRRKSKNTLHMKRKKNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K279	ATP-dependent rRNA helicase rrp3	0.868	451-467	GKRKYKGGNNNKSNKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K279	ATP-dependent rRNA helicase rrp3	0.675	423-429	KKSKRGG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0F5	Protein kinase domain-containing protein	0.718	362-373	KPKKVKPNTKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J235	Uncharacterized protein	0.999	99-134	RLGKPIPKGGLGGSKKKKSRKPKAGGAPPPAAAPRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGQ8	60S ribosomal protein L3-B	0.883	13-30	HLGFGPRKRTRSHRGRVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGQ8	60S ribosomal protein L3-B	0.657	237-244	KLPRKTHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPW0	Uncharacterized protein	0.776	195-209	AHTRVKPALRKPLKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPW0	Uncharacterized protein	0.641	111-114	KPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPW0	Uncharacterized protein	0.602	407-407	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTB6	Uncharacterized protein	0.689	176-190	KRSQKSSKSSKSARR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU68	Uncharacterized protein	0.938	101-117	AKFKRVKKQNRKSGKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU68	Uncharacterized protein	0.899	823-830	KKRKKSAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU68	Uncharacterized protein	0.817	12-32	VNKKPINKKAGNTKTAKAVKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU68	Uncharacterized protein	0.797	230-242	NKRERLAAKRKAE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU68	Uncharacterized protein	0.736	185-197	KTKAQKLLEKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU68	Uncharacterized protein	0.668	496-499	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU68	Uncharacterized protein	0.607	255-255	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZH3	Uncharacterized protein	0.945	67-127	GHKPSASNKENPKKKENTRPHNGEAPKKAQKDMTKAERRALQEKQRLEKQNRVAAGLPKSA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZH3	Uncharacterized protein	0.604	59-60	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2Z5	Uncharacterized protein	0.836	368-373	DKRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2Z5	Uncharacterized protein	0.738	193-200	KKKLSKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXL0	USP domain-containing protein	0.929	35-45	KKRKRRIRSKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1K1	Protein PBN1	0.985	207-222	KKRRKTEAKGKRRKSE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2P6	BZIP domain-containing protein	0.987	86-121	KIRKKPGRKPNPASPALRKAQNRAAQRAFRERKERH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J347	Uncharacterized protein	0.963	201-218	VQKKTSKPKSPASRKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J660	RRM domain-containing protein	0.628	170-174	GHNKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JA99	RF_PROK_I domain-containing protein	0.979	112-132	GQKAAKIAKQKARRARRAKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB65	CBF domain-containing protein	0.991	476-504	KNKKKADQEPEPEKKSEKRKNKEKAKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB65	CBF domain-containing protein	0.879	680-702	KKKKIAEEKAKRSHAKSEYDGRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB65	CBF domain-containing protein	0.819	963-971	GSKKKKQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCJ2	NET domain-containing protein	0.996	376-407	KKKPKGPRTRPALVDKKVQRRRKPNKPKTKSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCJ2	NET domain-containing protein	0.916	458-472	NSRRRPAAKKSKSRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCJ2	NET domain-containing protein	0.668	497-505	PKRRAAVHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEZ8	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp43	0.941	712-731	KNRKARNDDEKKSSSKKRRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFE4	HMG box domain-containing protein	0.874	212-224	RKIARLRKRAKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFE4	HMG box domain-containing protein	0.847	108-121	KRKYRRHPKPDKNA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGD9	Uncharacterized protein	0.951	41-57	KKSSRFSWRKKRKPKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGD9	Uncharacterized protein	0.714	715-722	KEEKKRIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJC8	Uncharacterized protein	0.716	347-361	SKKKQQQKQKDPKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMF6	HABP4_PAI-RBP1 domain-containing protein	0.89	38-65	KINKDAARAAKGGKPTKGARQQNGRPQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMF6	HABP4_PAI-RBP1 domain-containing protein	0.791	204-221	ARPEFRKNDRRGGRGGNN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8S5	Uncharacterized protein	0.75	384-392	KKDKEKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1X4	Transcription initiation factor TFIID subunit 2	0.811	1274-1285	PPPPPPKPKHKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1X4	Transcription initiation factor TFIID subunit 2	0.646	1678-1684	PKAPKPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1X4	Transcription initiation factor TFIID subunit 2	0.617	1188-1194	KQKPEEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J943	TPR_REGION domain-containing protein	0.975	929-939	KKAKKRGRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J943	TPR_REGION domain-containing protein	0.761	869-881	RKKREEERNKLKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIR7	Uncharacterized protein	0.97	17-42	KNRPKSKHEKKEEQKKHKQTKNEKVA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJH8	SWR1-complex protein 5	0.699	124-131	QIKKPKSP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJH8	SWR1-complex protein 5	0.684	58-63	SKGKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJH8	SWR1-complex protein 5	0.614	210-213	KEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN10	Uncharacterized protein	0.855	165-178	LKTKKTKKEKTKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPH2	60S ribosomal protein L13	0.882	30-48	GRKKSRRIARVQKAGRIAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPH2	60S ribosomal protein L13	0.854	193-211	GAREKRARDKAEEEANKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPH2	60S ribosomal protein L13	0.715	128-136	PRKAGKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV21	Uncharacterized protein	0.765	285-295	SRNKKPSPKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JY48	Uncharacterized protein	0.895	214-223	AEKKEKKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JY48	Uncharacterized protein	0.609	174-175	RR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P8	Uncharacterized protein	1	100-139	KGKVKKEKKGSDKKSDKKKKDKKDDKKKKDKKEDKKKSKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P8	Uncharacterized protein	0.927	230-245	LKKNKNKKKNHLKGSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P8	Uncharacterized protein	0.907	155-179	KKQRRSPFDGLERTKKRNMRKRLIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1P8	Uncharacterized protein	0.606	54-54	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2V5	Uncharacterized protein	0.985	60-90	PKDIEQKKKKAAARRSDDSNEKRRKKKEEKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9P5	Atypical/PI4K protein kinase	0.866	511-523	KIKKNKRKSQRLS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHZ0	Uncharacterized protein	0.854	36-48	KKRRHPKNSKTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMJ6	Mitochondrial distribution and morphology protein 34	0.976	514-526	SKTKHKKKPKRRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JML8	ANK_REP_REGION domain-containing protein	0.759	239-252	RERKRAERTKDGKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSE9	Uncharacterized protein	0.765	1841-1851	PKKKKEAEDKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUU7	FCP1 homology domain-containing protein	0.999	300-335	LRKKRKRTKREKLPRHLRKPRHKKQKKQAIKEKAAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUU7	FCP1 homology domain-containing protein	0.744	358-365	KQRKKMKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZX0	FoP_duplication domain-containing protein	0.987	84-139	NSGGIKKRKAGGPSPMEGIERQKGRVAKRVVGKKQSTKQGKKRSAQQQQKKKVTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K253	Chitin synthase	0.743	569-579	MRRSKSTKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K499	Uncharacterized protein (Fragment)	0.708	101-109	RRNHIRRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7I0	Peptidyl-prolyl isomerase D	0.999	238-264	GRKKRKHKKHHKSSSKKHRKHKKHHKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7I0	Peptidyl-prolyl isomerase D	0.841	218-224	EKKRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7J3	Uncharacterized protein	0.97	127-144	KSKKGKKKTKSELAPKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KH43	Mediator complex subunit 19	0.999	146-177	RKHKKKKKKRRHGHEHDGEDGHEHKKKKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKP0	Arrestin_C domain-containing protein	0.966	640-655	RKKKKEQKELRKKHKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVC7	Methylsterol monooxygenase	0.657	287-292	RLQKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX55	50S ribosomal protein L18e	0.994	165-197	GMGPHKNKKPFVRSKGRKFERARGKRASRGFKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J973	SCY1 protein kinase	0.962	783-814	RKAELERRREERRQRMAELREKKKGGGLGAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9G3	NADH dehydrogenase	0.836	377-388	KARKDRRLRKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9I1	WD_REPEATS_REGION domain-containing protein	0.995	361-379	KDKKKRKKTQKKMKAEKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF36	HAL protein kinase	0.81	226-235	KKNQDKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF36	HAL protein kinase	0.79	590-603	KKKKTPDHHNRSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJB9	Non-histone chromosomal protein 6	0.944	10-26	KRETKKRGKKDPNAPKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JX69	Elongation factor 3	0.998	1018-1041	EKKKKLSSKELRKKKKDRMERRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZW6	Uncharacterized protein	0.999	415-444	LKRKFRRKKSKAAKKGNRSRKSKKSKGKNQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0D2	EF-hand domain-containing protein	0.923	348-373	ILDRLKKMKRKNPQEFLMKRIRRKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0D2	EF-hand domain-containing protein	0.648	495-502	KFTRKMKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4G0	Uncharacterized protein	0.877	328-343	PRRKMRKASRSTKSRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KDJ1	PlsC domain-containing protein	0.746	130-145	WKSNDKRIEKQRKALR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KL36	MFAP1 domain-containing protein	0.649	400-403	KRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUU9	GATA-type domain-containing protein	0.963	175-193	KKRGRKRKNPLDTINKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZP7	Uncharacterized protein	0.812	385-410	KIRHPVVLIKKAPPRIKNPVVKIIKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZP7	Uncharacterized protein	0.676	275-284	KKEKQKSAPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZP7	Uncharacterized protein	0.649	294-302	SKNKPAAIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J287	Uncharacterized protein	0.717	261-266	KRKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J287	Uncharacterized protein	0.677	466-471	HRRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4Q6	WD_REPEATS_REGION domain-containing protein	0.907	39-54	KPRSRPKAKTTKSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W5	Uncharacterized protein	0.881	4-17	QRQKKKSSRRRINP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J972	Nucleolar protein 9	0.995	5-22	ERKGRANKKRGKKGGKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCP2	Uncharacterized protein	0.821	752-761	RQRALARRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCP2	Uncharacterized protein	0.748	567-576	RKKSKSSKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDH2	60S ribosomal protein L36	0.722	65-77	DKRARKLCKAKLG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDH2	60S ribosomal protein L36	0.648	80-84	LRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDU7	CMGC/CK2 protein kinase	0.89	69-79	KPVKKKKIKRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGW8	60S ribosomal protein L3-A	0.902	28-46	FGPRKRTRSHRGRVKAYPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGW8	60S ribosomal protein L3-A	0.657	249-256	KLPRKTHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKM9	STE/STE11 protein kinase	0.718	423-438	REASRKYKNNKMVRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN98	Elongator complex protein 1	0.995	1166-1187	KSRKTSKLRKKEERKRARGKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP06	Uncharacterized protein	0.662	534-543	KRKANHQKRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPB0	ATP-dependent DNA helicase II subunit 2	0.794	537-543	KGKKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPI8	Uncharacterized protein	0.854	382-404	KERAIRERQQAAAAARRAAKRRF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRQ9	Rho family, other	0.626	184-192	HRNKLQEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSS2	Sterol 3-beta-glucosyltransferase	0.631	18-21	KKGP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV89	GATA-type domain-containing protein	0.987	338-380	IKKRNRSPSGNKRRSSSSTGISKKATGRHTKNSRRKSKSRGRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV89	GATA-type domain-containing protein	0.784	263-276	AKKKPGNNKTKNKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWT5	Uncharacterized protein	0.997	803-854	KKSTTRAKKPVKRAPRSSIAIKRPANNPKKPSSIPIRDNPAPKKRRKKVKRT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWT5	Uncharacterized protein	0.969	393-426	KKAKQKIITFQKSRKSKKGKSVARKFLPSSSAPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWT5	Uncharacterized protein	0.921	331-357	RKSSAKSKSKKTSLPSKSNKPAKDRPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2P1	RING-type domain-containing protein	0.967	297-324	RKMKRIRKKNASLVKIKQRMKDEKWRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2ITQ5	Uncharacterized protein	0.646	570-579	IPVRRQFRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2ITQ5	Uncharacterized protein	0.614	563-568	RKVFKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2J2	Ribosomal protein L19	0.939	163-184	LRAKNKALRERRANKKAEKLEA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2J2	Ribosomal protein L19	0.913	66-91	ERAAAKRNGRHMGHGKRKGTADARMR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2J2	Ribosomal protein L19	0.729	142-155	HIHKAKAEKVRAKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2J2	Ribosomal protein L19	0.614	135-137	NKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCI1	Uncharacterized protein	0.731	2592-2598	RKKSRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKB8	Protein-tyrosine-phosphatase	0.719	335-342	KRKLKPKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNX0	WD_REPEATS_REGION domain-containing protein	0.893	369-378	PSKKRKTRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP20	Uncharacterized protein	0.984	138-165	KPGSGHHHGGERGRGGRGRGGRGRGRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP20	Uncharacterized protein	0.782	14-31	TRRFAPVKRGGKSPAAQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP20	Uncharacterized protein	0.727	113-125	KFKPTIPHKRNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS53	MBOAT_2 domain-containing protein	0.912	254-262	KKKKKKTRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT26	Uncharacterized protein	0.849	229-237	KTRRKPKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXR9	MADS-box domain-containing protein	0.863	36-65	PARRSGRRKIKIEYIEDKNRRHITFSKRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K233	Transmembrane protein 188	0.846	154-165	ARKKARQAKLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9H7	Uncharacterized protein	0.633	37-39	KKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAY5	Uncharacterized protein	0.921	239-252	RKHLRKKLKKVIRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCX7	Uncharacterized protein	0.996	69-84	RKKKRLKKHHRPKRPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHR1	Uncharacterized protein	0.964	275-282	KKKKRRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLJ1	Ubiquitin_4 domain-containing protein	0.854	140-152	EKGQHRRAWRRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JML1	BUB1 N-terminal domain-containing protein	0.849	439-445	KKKRRKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP54	Zn(2)-C6 fungal-type domain-containing protein	0.8	226-240	RKKRGRPCGSSKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPN0	WD_REPEATS_REGION domain-containing protein	0.96	161-175	RPNKDAKKKREKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K700	CCHC-type domain-containing protein	0.611	323-324	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8M9	Flavodoxin-like domain-containing protein	0.908	397-408	KLKDNKPKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGT6	PH domain-containing protein	0.972	406-427	GRTKANSKKKPLTKKRRGGVAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHK3	DRY_EERY domain-containing protein	0.998	240-279	KKDRDEELRSLKRKQREGKPKDGSRSSRRNERRRKRRHRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHK3	DRY_EERY domain-containing protein	0.998	478-568	RNRKHYRSPSPNDRSSSRRRSPSRDRYRSQHHSSRDHRRHQHTRSRSRSRSPKRGRRYRSPSPGDDRRSSRKHKYSKSRSRSRQRERGSRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLH3	Uncharacterized protein	0.813	768-789	KSVMSRKDPHKHKGLGKTTSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLH3	Uncharacterized protein	0.802	664-670	LKKKKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLY6	Chitinase	0.988	46-78	AVSKKKKKKHTTVNKKTTTKKKTATKKTTTKKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN79	BRCT domain-containing protein	0.884	17-33	RKTLKRIIKVKQKPRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNK4	Uncharacterized protein	0.986	5-43	EKKSTIKFQKSKLKGVVKRRKEVNKFKRQIIKRQLRRGA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP92	NPL domain-containing protein	0.977	472-489	PIKKKNDKAAKKRAKKLA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP92	NPL domain-containing protein	0.952	742-763	RKERKKKKSQRSDEAVVKKARL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP92	NPL domain-containing protein	0.948	647-657	PRKKKKPAKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR40	Uncharacterized protein	0.834	40-48	KKEPKPKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRN2	Uncharacterized protein	0.663	106-110	KKPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUR9	Ubiquitin-like domain-containing protein	0.936	116-129	RKGKEKESRKRKLA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXZ9	Uncharacterized protein	0.975	33-55	KSKKNRKKKIGKLVDQVKKFKKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXZ9	Uncharacterized protein	0.975	214-235	KRKRLHIHLTNKRKRRQNRKKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXZ9	Uncharacterized protein	0.957	177-191	TRPTKKYFKKKKKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2W9	Uncharacterized protein	0.917	1313-1330	RIEKQKKREQERRKRANS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4W5	Uncharacterized protein	0.7	218-223	KRRKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4E7	Signal sequence receptor subunit alpha	0.947	224-237	KKTSPKMKKRSSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4E7	Signal sequence receptor subunit alpha	0.662	183-189	KSKKTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR10	Uncharacterized protein	0.968	98-109	KKTFKKIPKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR10	Uncharacterized protein	0.812	9-23	KRPSKKEKEGLAIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR10	Uncharacterized protein	0.616	79-82	KEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSU7	Uncharacterized protein	0.743	243-255	KRKNDKAPKAKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JX97	Uncharacterized protein	0.793	429-437	KRKKSTRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1T2	Uncharacterized protein	0.885	620-631	QKKKKHVRARRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7G9	Uncharacterized protein	0.639	673-677	RKIKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8D8	Uncharacterized protein	0.734	16-24	KKKRSNNKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYM0	Uncharacterized protein	0.807	249-255	KKKRRPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7E4	DUF2183 domain-containing protein	0.824	490-495	KKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7E4	DUF2183 domain-containing protein	0.692	547-552	KKKKFR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7K2	Uncharacterized protein	0.827	219-231	RRKRLHESRRKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7K2	Uncharacterized protein	0.704	68-76	KRNRYRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8Q9	Uncharacterized protein	0.966	117-138	SNKKKSTNIVGRDPRGRKKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCR0	Uncharacterized protein	0.603	531-532	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFZ7	PDCD2_C domain-containing protein	0.956	115-131	QKEEEKRKKEEKKKAAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGN8	SWIB domain-containing protein	0.994	141-152	KKPKKKRKKKPV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGN8	SWIB domain-containing protein	0.803	109-122	KKIKKRTSSQGKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN96	Uncharacterized protein	0.674	65-69	KKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN96	Uncharacterized protein	0.653	27-35	KAIVKNKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTV5	NDC10_II domain-containing protein	0.886	49-63	KEAPKKARISRPPKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVM9	Uncharacterized protein	0.943	60-70	KKRKKRRMEQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVM9	Uncharacterized protein	0.622	74-78	KKSRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0B5	Uncharacterized protein	0.864	83-92	KPRHNKRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2L3	BHLH domain-containing protein	0.806	223-237	KRRRRRESHNAVERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYB2	C3H1-type domain-containing protein	0.919	637-653	RKKAKARNARGRGNRGG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7A9	Uncharacterized protein	0.999	146-172	KKSDDDKSEKKDSKKPPKKAKKPKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7A9	Uncharacterized protein	0.987	106-129	NPKKTNKNRPAVKKPEPMKKKKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J811	Uncharacterized protein	0.927	255-270	KAKPAKSSKKKDSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCG5	Uncharacterized protein	0.991	75-98	EKKAMKKQAKEEKKRAKKEAKELK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE17	DNA-directed RNA polymerase III subunit	0.819	130-138	KRGKKKQKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG81	Valyl-tRNA synthetase	0.994	32-84	AKKAEKEKKNEEKRLAKMAKFAAKQAKLEEAKKANAANPDKKKKKEAKAPAPV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGN0	Uncharacterized protein	0.663	221-226	KRREKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH66	Uncharacterized protein	0.616	136-138	MKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH66	Uncharacterized protein	0.605	134-134	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHS5	STE/STE11/CDC15 protein kinase	0.728	886-891	EKKKRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K064	Uncharacterized protein	0.646	250-253	RKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K385	Uncharacterized protein	0.688	474-481	SRQERRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K385	Uncharacterized protein	0.609	461-462	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4Q8	FFD domain-containing protein	0.984	464-487	GKRNRHRGSRGGRGRHHRNGRGKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXQ5	Uncharacterized protein	0.957	582-618	KKKARNKARKAALKAQQDAEAKKVQIKEEAAKHKHDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4C2	Uncharacterized protein	0.992	61-115	DKLAAAEKEKRRQKEQFLKDQKEGSKRQLKELERKAKKEKLEKQYKEKMERRKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4C2	Uncharacterized protein	0.775	179-186	ERAKKRKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6W2	Uncharacterized protein	0.857	279-288	DKPRSGKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHH8	Eukaryotic translation initiation factor 3 subunit J	0.951	44-75	SKEKKPAPVLKKKVPLKQKIAEKQAAEEKKRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHH8	Eukaryotic translation initiation factor 3 subunit J	0.828	200-211	KEATKKGKGKSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM86	Uncharacterized protein	0.699	902-910	KKKTPKTPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM86	Uncharacterized protein	0.624	1213-1216	RKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN69	Cyclin-dependent kinases regulatory subunit	0.77	59-72	RGRKLLIKKKYIKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN99	Lipase_3 domain-containing protein	0.944	105-127	KRNKWRSKAKHIGKAKLKIAKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQM9	AGC protein kinase	0.94	2455-2469	NKKRKSKSSGKKPVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXU8	Brix domain-containing protein	0.703	328-337	KKKAEKDAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZV8	Elongation of fatty acids protein	0.613	330-332	KSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAF3	ANK_REP_REGION domain-containing protein	0.874	366-376	KRRKRTASRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAF3	ANK_REP_REGION domain-containing protein	0.77	24-42	TMKKNPKKAYQNPNRKDKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAF3	ANK_REP_REGION domain-containing protein	0.753	530-536	KKKRNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAF3	ANK_REP_REGION domain-containing protein	0.745	8-14	KKKRSRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFH5	GATA-type domain-containing protein	0.821	340-363	KRKYTKSSEAPQPAKKQQKRAAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KL32	Glutaminyl-tRNA synthetase	0.815	181-190	PQKKKKEPKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZS8	C3H1-type domain-containing protein	0.799	142-159	RGRRSDRSRSRSRSPERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB21	ZZ-type domain-containing protein	0.835	212-225	ERKSVSGKGKGKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB21	ZZ-type domain-containing protein	0.818	361-374	KKVKTKAKPKNQGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCL3	Uncharacterized protein	0.856	701-709	LKNKKKRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFN3	DASH complex subunit DAM1	0.656	160-164	RKKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLG8	Uncharacterized protein	0.762	285-298	RKSSTKSKKQNKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLP9	U3 small nucleolar RNA-associated protein 22	0.702	7-27	RKYKKSLNSEPASKQAKKDRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLU7	Uncharacterized protein	0.877	16-28	RRKEARRRALRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4Z5	OrfB_Zn_ribbon domain-containing protein	0.999	562-590	GKKYNKGKRKKTRANRKRRRKNRHSSTRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4Z5	OrfB_Zn_ribbon domain-containing protein	0.718	43-61	STKRKGSPALTTAKRNAKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8Q2	OrfB_Zn_ribbon domain-containing protein	1	419-457	RNKRSKEKEKKKRRRRKENKKKKVVIDNPSKPKKQKWKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAQ5	Kinesin motor domain-containing protein	0.865	589-598	RRRGPGKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAQ5	Kinesin motor domain-containing protein	0.728	919-936	KRRMIKRMKDEAERVKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKD4	Plus3 domain-containing protein	0.987	141-169	TRRREEKNKVRSKRHHRDSPSPDRKRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL35	ER membrane protein complex subunit 3	0.81	260-283	PKKKEPTVREKIQKAQKNNSNKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLM7	Uncharacterized protein	0.603	10-11	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM44	Histone acetyltransferase	0.961	106-133	PKKNVKDGAAPAKKGRAGTPSGGGRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM44	Histone acetyltransferase	0.897	455-462	KKRRRKRV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM85	Uncharacterized protein	0.861	55-66	RHVKKPVRRKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMM8	Uncharacterized protein	0.981	300-332	KREEKRLANPDYRPKKKPTPKPKPAAAAAHHKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMM8	Uncharacterized protein	0.97	201-238	KTIEEKKKQAAEKKKRQAEEEEQKPQAAKKPRVTKGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMM8	Uncharacterized protein	0.839	49-76	RKDLKNALKKAKNEETQKQNKKIKSARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMM8	Uncharacterized protein	0.722	269-281	KKPNRAGQRQRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMM8	Uncharacterized protein	0.611	95-97	KPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPS7	Uncharacterized protein	0.955	400-419	KPKHSPSLKVKKEKKSKGKM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPS7	Uncharacterized protein	0.663	75-81	KKEKKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ64	Histone H1	0.98	88-126	KPVKKTSEKTAEKKTSASKKSESAKKTSAKKVVKKKAAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRP0	Uncharacterized protein	0.793	340-348	TQKSKKRKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV74	Uncharacterized protein	0.991	236-260	ERIKRQGAKKKSAGGKKSGGGGKRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV74	Uncharacterized protein	0.657	207-211	EKKRD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXS3	Uncharacterized protein	0.821	1262-1282	MEKARRAEEERRERIKAQKLR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXS3	Uncharacterized protein	0.748	922-931	RKKRMLKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1N2	SGF29 C-terminal domain-containing protein	0.76	106-111	KRKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4R2	Uncharacterized protein	0.841	297-313	MKFRLSQERKQKKKENR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IV32	Uncharacterized protein	0.703	110-115	RRRKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J306	Uncharacterized protein	0.85	39-49	PPKRRRGRFRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J863	Uncharacterized protein	0.877	256-275	KLPAWKQKMLDKKNKNKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGP0	Uncharacterized protein	0.995	358-384	KTPRKKKSSSNRKKSKKSQSNKSKRRD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI34	Uncharacterized protein	0.66	156-164	KRNGSRKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL58	Myb-like domain-containing protein	0.701	129-133	KKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JND6	DPBB_1 domain-containing protein	0.998	106-140	KHKNRKHGKTSTIKARKSKKKHSYKRKRQSDKHKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSG5	FACT complex subunit	0.81	1024-1030	ARKKHRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSL7	Uncharacterized protein	0.647	426-429	KKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW25	Chromosome transmission fidelity protein 1	0.964	8-33	NRKKRGHVSAGHGRVGKHRKHPGGRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K737	Uncharacterized protein	0.642	204-209	KRAAKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIK5	Ubiquitin-like domain-containing protein	0.918	507-522	SKKPKNQKGKEKDKKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJV0	Uncharacterized protein	0.69	1193-1203	KIKKYSKKLAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJV0	Uncharacterized protein	0.629	819-822	MKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWS3	Uncharacterized protein	0.88	615-628	KPKKKSKPLPPIRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1F4	Uncharacterized protein	0.973	280-290	PKKKRGRKPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1F4	Uncharacterized protein	0.833	192-200	PKRKRGRPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2C8	BHLH domain-containing protein	0.819	50-65	KKRRRRESHNAVERRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2P9	PH domain-containing protein	0.868	308-329	RPKSIKRRGNSKRSATSRSLRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J377	Histone H2B	0.917	8-29	KAPAKTTKAKSADGKKRKISRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J583	Uncharacterized protein	0.735	418-429	AKRNLRKRNAAE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J583	Uncharacterized protein	0.705	434-445	KPTEPSSKRKSG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7X1	RRM domain-containing protein	0.908	177-187	TNKKKKKGSKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7X1	RRM domain-containing protein	0.869	222-254	LKEQQKRKREWEKKQDVDRSRSPSRSRSNSRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD45	Uncharacterized protein	0.999	173-263	GRSSTRRSRSQSKSRSRSPPRRRRRSPSESRSRSPPRRRRRSPSQSRSRSASRSRSPPRKREKRDSSDREDSRDRRRNKSESRSRSRSPAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDI1	Methyltransf_25 domain-containing protein	0.719	20-26	AFKKKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJK2	Uncharacterized protein	0.716	466-477	KKLKQSKQIKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJM3	40S ribosomal protein S6	0.947	187-207	LQRKRHRQALKRRRAEASREA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJM3	40S ribosomal protein S6	0.766	131-143	KRLGPKRASKIRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJM3	40S ribosomal protein S6	0.719	164-180	PKAEGKKAYTKAPKIQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJM3	40S ribosomal protein S6	0.709	215-230	LAKRVKESKQEKIERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJM3	40S ribosomal protein S6	0.671	88-95	RTGERKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLG6	Uncharacterized protein	0.665	571-575	KSKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLZ2	Uncharacterized protein	0.613	102-105	RGRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLZ3	Uncharacterized protein	0.994	9-59	KIKGHSKDRKARIAKSAAKAKRPTKPSVTTKRVITKKKQKQLEKALRHEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ04	Uncharacterized protein	0.634	237-240	KRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRJ8	Uncharacterized protein	0.921	26-52	PKKSQKIKLPKTNKGIKKVKHEIRYGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRJ8	Uncharacterized protein	0.726	110-119	KERNAKKTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSK1	50S ribosomal protein L18e	0.994	171-203	GMGPHKNKKPFVRSKGRKFERARGKRASRGFKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT82	Uncharacterized protein	0.97	58-71	VSKPKPKPKPKPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3G0	40S ribosomal protein S15	0.979	47-77	ARRRFQRGLKRKPMGLIKKLRAAKKNAAPGE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB32	Rab-GAP TBC domain-containing protein	0.749	459-468	ETRRNSRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZD5	LysM domain-containing protein	0.993	83-135	KKKTTTKKKTTTKKTTKKTTKKTTKKTTKKTTKKTSTKKTTKKTSTKKTTTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J324	Uncharacterized protein	0.986	57-90	RWKFPDSTHNKSKKKHPHQRHSKKKSLTHKPKAI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3G1	Uncharacterized protein	0.901	379-392	KRKKQELKRKNKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3G1	Uncharacterized protein	0.696	964-986	KRRRLELSKTKHHDRVAASERKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3G1	Uncharacterized protein	0.696	1359-1381	KRRRLELSKTKHHDRVAASERKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7B2	Endo/exonuclease/phosphatase domain-containing protein	0.98	270-288	AKKAPKSKPKSKSKPSAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7B2	Endo/exonuclease/phosphatase domain-containing protein	0.681	774-778	RRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8P9	DDHD domain-containing protein	0.628	734-736	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGB2	rRNA-processing protein FYV7	0.988	105-172	RKKQRSTKALKPNPFKAQLEEREKLKKESLNEKEERQKKFKEEKKARKEYYKERSEQRSKMLARTKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGB2	rRNA-processing protein FYV7	0.895	4-25	KPQAKKPRKPLTPLQRKQQKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTA8	ENDO3c domain-containing protein	0.78	22-36	YKEKKIPKLSKARVS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV27	Uncharacterized protein	0.902	39-67	KRDEAIRKKLESELSKKKTGSKRVRQTRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV27	Uncharacterized protein	0.696	609-615	KKSKRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2S0	Uncharacterized protein	0.96	6-24	KKRKHKDSSEKSHKKKHKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3U9	Uncharacterized protein	0.879	996-1002	KRKKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXH5	Uncharacterized protein	0.987	317-375	FAKKLAADRAEELAKKKAEAKRAEEERVKKLSPAEQRKWEEKERARNMKKQQKKQGRKM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYB9	Chitin synthase	0.643	607-612	KKPNKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0A3	Uncharacterized protein	0.971	198-211	LKKKTRRLRKRKGF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEE7	40S ribosomal protein S25	0.981	10-32	KPSSSSGGKKAKKKWSAKKVKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEX1	Methyltransf_25 domain-containing protein	0.925	13-25	RLKLKRKKKTTRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM57	TFIIS N-terminal domain-containing protein	0.959	129-140	KALKGGKKKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSV1	PH domain-containing protein	0.944	32-46	KRHRLLKKLKPRKRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSV1	PH domain-containing protein	0.816	121-136	PKKHHRRIITHKSRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KA70	Uncharacterized protein	0.845	183-213	ERMRAKSLRKDQKCERREIKKEEREAKRCER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBN0	Nkap_C domain-containing protein	0.997	13-54	RRRSPSSPRGRSGSSRRRSPSPRRRSPSPRRRDDNRKRYRDR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBN0	Nkap_C domain-containing protein	0.994	147-198	RHRRHRRSRRSSKHKSSGSSSRHKSSRHKSSRHSSSRHKSSSHRHSKKKRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBN0	Nkap_C domain-containing protein	0.8	118-126	RPRKSKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGB9	Uncharacterized protein	0.765	439-444	IRKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJS5	RalA-binding protein 1	0.898	638-651	KKRKNEKPRKLSKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXS4	HTH La-type RNA-binding domain-containing protein	0.968	104-152	SPRRSTRRANGEGRTNKKSNTNKDKENKPVKDDEKKPKSRSVRPKNSYR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0G8	Uncharacterized protein	0.923	620-630	RNKKRRKRHSS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0G8	Uncharacterized protein	0.92	499-513	IKDEKRRQEKKLRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0G8	Uncharacterized protein	0.867	367-377	HARRRRDRKAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J470	Uncharacterized protein	0.613	284-286	KKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J766	IPT/TIG domain-containing protein	0.695	328-335	RKRSQRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD75	50S ribosomal protein L5e	0.915	257-282	EKKGKPAKPYRRLVALNKKQRLNKIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFX8	DNA damage-binding protein CMR1	0.923	37-66	RSKPLKKHTPKPTPKQPKVATRASARIRGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH70	IRG-type G domain-containing protein	0.956	341-355	LEEKRKKKLDKKRQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNY4	Uncharacterized protein	0.974	594-620	KEKSIPLPRKKSIPLPRKKNIPSPRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNY4	Uncharacterized protein	0.773	480-490	RPKRQTRRKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRN0	Uncharacterized protein	0.971	496-528	VKAKVKKAAPPPAVKKSPAVVKKPAAIAKPKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRN0	Uncharacterized protein	0.849	548-576	PKRKPPARLAGASSMKKPALSSSKPKPAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRN0	Uncharacterized protein	0.656	583-588	GPKKSA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0E4	SANT domain-containing protein	0.936	392-408	KRKNTQKSGGKNKRKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5W2	Uncharacterized protein	0.803	137-144	KRKQKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXR4	Uncharacterized protein	0.952	322-333	RKDKWKRRKKHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1B2	Adenosinetriphosphatase	0.963	60-102	AKRLALRSSARNKGKGKAKLEEPSMPPPRPKLEREASLLRGRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1B2	Adenosinetriphosphatase	0.836	257-269	RRRRAVPRRRMVR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J870	Ubiquitinyl hydrolase 1	0.702	366-374	MKRKTTKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9Z8	TPR_REGION domain-containing protein	0.92	620-632	KKKMPKVVKKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBB1	Uncharacterized protein	0.794	419-427	TLRKRRSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGH4	GATA-type domain-containing protein	0.788	194-202	RQRKRGKRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIL9	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase	0.713	8-12	KKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJS5	HMG box domain-containing protein	0.948	111-126	RPKPKKNKKPTATKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJS5	HMG box domain-containing protein	0.867	24-36	PRGRIRKPRVRKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKG4	Non-specific serine/threonine protein kinase	0.611	1636-1638	KMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKI7	Zn(2)-C6 fungal-type domain-containing protein	0.685	195-198	KRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN59	Uncharacterized protein	0.985	377-392	KQGKNKNKKNKKKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN59	Uncharacterized protein	0.907	311-333	RDKPKKISKNQQKKLRQAAKKAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUE8	WD_REPEATS_REGION domain-containing protein	0.964	164-178	SRSPKRTRAKKKKQP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IY60	WD_REPEATS_REGION domain-containing protein	0.993	430-459	KAPKKKLLKKKKKTSSESADERPRKAFKKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J159	Uncharacterized protein	0.951	12-59	QAAPRAVKTRKSPRRFGLPSQRRAAAAPVTVKPRRKFGFGSSRKHRHG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J159	Uncharacterized protein	0.945	78-105	RKLKAKISPGPKVATTSKRSRKHAKKDP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J159	Uncharacterized protein	0.762	121-138	AAPRHRSRGFGFGRRRPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4T5	Uncharacterized protein	0.822	229-241	DKLNRRKSRRVLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J533	Elongation factor 3	0.998	1050-1074	QKKKKLTSKELRKKKKERMERRKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J533	Elongation factor 3	0.62	30-33	KPKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J533	Elongation factor 3	0.618	21-23	KRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAR3	HDAC_interact domain-containing protein	0.829	882-897	PRKRSQSPSRRRSGRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBT0	BZIP domain-containing protein	0.951	165-174	PKKKRGRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBT0	BZIP domain-containing protein	0.745	293-306	KNRAAALLSRKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN0	Uncharacterized protein	0.984	298-316	KMKGKPIFKGKGKSSPKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN0	Uncharacterized protein	0.908	249-283	KRAKTDKKSAPVKSQKRINKDLKYGSGGKKGRFAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN0	Uncharacterized protein	0.878	189-228	KRQRQLKKFGKKVQVEKQLERQKQKSEMLEKIKLLKRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDX3	Phospholipase	0.974	1135-1157	KQKKYGRRMKRRLLRRKSSGQHS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDX3	Phospholipase	0.801	212-233	HRTKLPKFPSLPSRQIRKQRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDX3	Phospholipase	0.691	406-411	RRRRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDX3	Phospholipase	0.657	763-768	RKKPTA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFQ0	Uncharacterized protein	0.902	1055-1063	KKKPKKKAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGT1	Uncharacterized protein	0.981	5-35	RKRKATAEAGPSKPRKPKRTEPAPPPPPPPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGT1	Uncharacterized protein	0.93	878-887	SRRKKRKRFR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGT1	Uncharacterized protein	0.745	969-980	RKKRHRIAGVEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM73	Uncharacterized protein	0.928	58-79	FRRRKVKRMRMERQKVEKFWRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM73	Uncharacterized protein	0.766	177-185	KRRRSRRER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM73	Uncharacterized protein	0.605	201-202	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWF1	Chitin synthase	0.813	606-621	RAPTMRRRTTKRRPEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2J2	USP domain-containing protein	0.924	504-522	KKKQQEKKKRHFRIKLESR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5S1	50S ribosomal protein L4e	0.909	187-206	RKLRAGQGKLRNRRHRQRRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5U3	ANK_REP_REGION domain-containing protein	0.849	539-550	RKHKDVKPKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5U3	ANK_REP_REGION domain-containing protein	0.638	347-352	KKQAKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8F0	40S ribosomal protein S24	0.999	91-133	PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWW3	Uncharacterized protein	0.797	241-257	RRKSEPDQHTKRKLKRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZL5	BZIP domain-containing protein	0.992	37-75	RVRKRKKPGRKPNPPTIQERRAQNRAAQKAFREREQQRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZL5	BZIP domain-containing protein	0.654	231-235	PRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHH2	Uncharacterized protein	0.953	53-67	KKGKKKPESKREVKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLB9	Uncharacterized protein	0.752	306-317	PRRSRSRSPARR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JML6	FYVE-type domain-containing protein	0.987	680-697	KKAPKSNKSNKRRSKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRT9	Peptidase_S8 domain-containing protein	0.996	209-276	TKKKTTKKTTKKTTKKTTKKTTKKKTTVKKAATTKKSTTKKKTTTKKKTTTKKKTTTKKKTTTKKKAT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRT9	Peptidase_S8 domain-containing protein	0.61	144-145	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRT9	Peptidase_S8 domain-containing protein	0.603	153-153	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2Z4	HTH La-type RNA-binding domain-containing protein	0.715	562-568	IKSKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8J8	Zn(2)-C6 fungal-type domain-containing protein	0.901	412-425	KPRGRPKLHKKLTK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8J8	Zn(2)-C6 fungal-type domain-containing protein	0.705	265-278	KKKTNKFDPKGRRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBG0	Uncharacterized protein	0.737	465-473	RKKRAYKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4I6	Zn(2)-C6 fungal-type domain-containing protein	0.979	80-97	RKERKKGIKRGPYKRRQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5S4	Uncharacterized protein	0.989	337-364	VPKPKPTRTTKKREPKRPRTVKEKAAPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBG9	Transcription initiation factor IIE subunit beta	0.888	250-263	SKPKKSKTRNKKIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDP5	Uncharacterized protein	0.782	210-217	RRPKRKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF26	MADS-box domain-containing protein	0.924	72-87	KKPQRRSGRRKIKIEY
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF26	MADS-box domain-containing protein	0.663	89-102	EDKTRRHITFSKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JII2	SMP-LTD domain-containing protein	0.982	437-472	KRSKTEQAKREKLKQKQEKEEKKRLAKEEHRQSKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNA7	Uncharacterized protein	0.799	256-269	KPKKAKTSSDKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNA7	Uncharacterized protein	0.665	228-236	KESKMPRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNM5	Uncharacterized protein	0.712	243-248	KKKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNU0	Uncharacterized protein	0.9	381-398	RRLRRETRFKRSSRRSRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRC0	Uncharacterized protein	0.918	186-199	KAPKARARPKNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRR3	Translation factor GUF1, mitochondrial	0.664	630-636	QKEGKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW71	BHLH domain-containing protein	0.814	145-160	KRRRRRESHNAVERRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXE2	SCD domain-containing protein	0.963	67-85	RRANKSKRKPAATRKKAAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXE2	SCD domain-containing protein	0.63	284-286	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K043	Nop domain-containing protein	0.999	458-493	KPAKKSKKEKKEKKEKKEKKEKSKDKKSKKEKKSKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7W9	Methyltransf_11 domain-containing protein	0.99	17-32	IPKHLKPLKKKKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K962	Uncharacterized protein	0.989	124-134	KKNKKKKKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K962	Uncharacterized protein	0.931	391-401	QAKKGKKRTKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K962	Uncharacterized protein	0.663	95-99	RPKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGL3	Kinesin motor domain-containing protein	0.704	1073-1079	TRKRKNP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGL3	Kinesin motor domain-containing protein	0.639	583-587	RRARR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYI6	Uncharacterized protein	0.995	67-89	AKKKRKPSKKTKKAVAVKEEKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYI6	Uncharacterized protein	0.93	655-672	KKKKEKQAEKKAKLDAKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYI6	Uncharacterized protein	0.752	1151-1157	KDKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6I9	Enhancer of polycomb-like protein	0.744	396-408	KQSGPKYRKRMGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8W2	Uncharacterized protein	0.942	1737-1753	KPKPQKRQIRSRKRKSP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAM2	Uncharacterized protein	0.972	119-179	KKHSTKKHNSQSSHKKSVQTKSKSKKHSTSTKHKSKKHTTVTTKHKSKKHADSSTKTRKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD87	Uncharacterized protein	0.999	31-77	RLAEKAEKKRLKKEMTKEERQAQREINRKNREKKKSKKDLNKKRKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD87	Uncharacterized protein	0.854	106-115	KKPKAEKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD87	Uncharacterized protein	0.844	365-378	KREFRERRPKKAVN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGH2	Ribonuclease Z	0.819	816-830	KKPSKKQQQKKKDIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK14	rRNA-processing protein FCF1	0.901	27-41	NREKLKKKEEKKEEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPE0	Uncharacterized protein	0.958	1422-1436	KANRKKPKKGRALMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPG7	RING-CH-type domain-containing protein	0.778	399-407	IRRRRSRRV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPG7	RING-CH-type domain-containing protein	0.67	414-418	KRRSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K123	Uncharacterized protein	0.978	268-299	RKKKQRENLNIVEKKQRMKRMKLQKEKKEKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K123	Uncharacterized protein	0.97	320-356	KKKRKVKGAEIAKIKSKRSVSKADVEDEPALKKKKKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K123	Uncharacterized protein	0.837	368-399	EDKPVAEKKVKVVKAAPATKKTLAKKDAVAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1U8	Uncharacterized protein	0.951	253-265	EERLRRRKKAKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K926	Uncharacterized protein	0.707	325-330	RTPKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9V5	Uncharacterized protein	0.787	567-575	LPKAKRRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXY8	Ribosomal protein L19	0.939	168-189	LRAKNKALRERRANKKAEKLEA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXY8	Ribosomal protein L19	0.913	71-96	ERAAAKRNGRHMGHGKRKGTADARMR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXY8	Ribosomal protein L19	0.729	147-160	HIHKAKAEKVRAKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXY8	Ribosomal protein L19	0.614	140-142	NKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5L9	DNA polymerase epsilon catalytic subunit	0.71	1287-1295	RKWKRQRLI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7P4	Uncharacterized protein	0.984	84-132	LRRRAASHNINRLPARLRAKAAKEAHSSAPNSKLIRKKVKKIKTPRNTV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7P4	Uncharacterized protein	0.714	13-21	KRRERNKSV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7P4	Uncharacterized protein	0.669	136-143	LRRQKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8G2	Serine/threonine protein kinase	0.998	706-743	AKKPKTPKKYYVPTGRPVGRPRKKVRPKPPGRPKGSKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JES5	Uncharacterized protein	0.713	416-422	RRSKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JES5	Uncharacterized protein	0.694	67-78	RLRRSRTVRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJV9	Uncharacterized protein	0.983	835-860	PRPNPKRIYKKRNKKFNKKQHMSRLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJZ3	Uncharacterized protein	0.825	277-290	KIRAKKAVLKAKKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJZ3	Uncharacterized protein	0.706	139-143	RKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM98	RNA helicase	0.998	10-36	ARSEKKDRKEKKEKKEKSSRKRERDEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUI4	G-patch domain-containing protein	1	120-156	KEKKKSKKEKSEKKSKKEKKEKKEKKEKKSKKRSREE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUI4	G-patch domain-containing protein	1	162-210	EGEKKSKKSKKEKKSKKDKKKSKKSKKEEAPAPVVLRNAARAKFLRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUV5	Uncharacterized protein	0.738	201-207	QQKKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0I3	Fcf2 domain-containing protein	0.758	224-234	RKRHYKKMGKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0I3	Fcf2 domain-containing protein	0.748	295-307	GKKHYKKLKAQRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1G9	Eukaryotic translation initiation factor 5B	0.993	220-338	KSKKQLLKEKKAKKLAAKEAEPEAAPAVEEPAPIAAPKGKKGKGGNVAALRKLVEAQRAAEEAERKRIEEERRKAEEEEKRLAEEEAKREEARAAKRERERLKKEQLRKEGKLLTKAQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1G9	Eukaryotic translation initiation factor 5B	0.985	368-414	KPKKVVYGNKKKKGPTKEEQEKKKQEAAERKRLEEEEKKRKEEEEAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1G9	Eukaryotic translation initiation factor 5B	0.974	163-187	KKEKEKLKKEKLKEQKRLAALEKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1G9	Eukaryotic translation initiation factor 5B	0.963	70-83	AAKNKVKKGKKGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1G9	Eukaryotic translation initiation factor 5B	0.951	461-489	KKPAAPAKAAPTKAAPAKAAPAKKAPAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1G9	Eukaryotic translation initiation factor 5B	0.813	129-137	KKGKKNKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1G9	Eukaryotic translation initiation factor 5B	0.652	4-9	KKGGKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K342	Uncharacterized protein	0.874	715-731	LRKERQERKNAKKEKAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8W2	Serine/threonine-protein phosphatase	0.958	8-22	KKGLKKDKRAKKSKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KD49	U3 small nucleolar RNA-associated protein 11	0.872	233-249	ATQKALRQKGRKKQVGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KD49	U3 small nucleolar RNA-associated protein 11	0.718	258-265	KWKADRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KD49	U3 small nucleolar RNA-associated protein 11	0.6	230-230	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIC9	Uncharacterized protein	0.995	111-125	KKKKSHKKKKNRRER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUV1	Uncharacterized protein	0.876	150-174	RKLPARSGRPKRAAATAANASMKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX65	Uncharacterized protein	0.625	81-83	KKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J293	PHD-type domain-containing protein	0.984	262-294	KPKRKQAKPSEKKVNGRINGKSNPSKRGKPRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J293	PHD-type domain-containing protein	0.974	5-25	RRGGRPSGGGRRKQRAPARRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAR0	Uncharacterized protein	0.943	466-485	RVRKPEKSSFLKKRRQKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAR0	Uncharacterized protein	0.942	695-705	KEKKKKKGLKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBC4	MRC1 domain-containing protein	1	138-159	KKSKAAKKPREKKKRRDKGKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBC4	MRC1 domain-containing protein	0.851	200-214	KKSKQKSSGRKTRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBC4	MRC1 domain-containing protein	0.848	754-764	AARRRRLLKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBC4	MRC1 domain-containing protein	0.634	526-529	KGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN3	NUC173 domain-containing protein	0.982	1108-1138	PKKAKRPVKKYERIGKEFRSKRAGGDVKRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN3	NUC173 domain-containing protein	0.873	915-924	KRRLRAKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN3	NUC173 domain-containing protein	0.83	1151-1161	VIKKKGRRDNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN3	NUC173 domain-containing protein	0.643	1084-1090	NRIKFKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE69	Glutamine amidotransferase type-2 domain-containing protein	0.974	351-370	AEKAKTQPAKKSKNRKPKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGB5	Uncharacterized protein	0.757	47-67	AIRKKIEQELMKKRGGSTRIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKT4	FHA domain-containing protein	0.668	277-281	RKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN95	Ribosome biogenesis protein NSA2 homolog	0.96	13-68	RHGRRLDYEERKRKREARQAHKASQYAQKVHGLKAKMLNKKRHAEKIQMKKTIKQH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN95	Ribosome biogenesis protein NSA2 homolog	0.604	110-111	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRH6	Uncharacterized protein	0.959	121-135	KKSWQKKKRLRKQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K792	Lysophospholipase NTE1	0.731	769-775	NKKGKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K792	Lysophospholipase NTE1	0.71	1632-1638	KGKRGRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXL8	Uncharacterized protein	0.941	153-179	RKTKKWGKPERELTEKERRRAERRQAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1B8	RING-type E3 ubiquitin transferase	0.865	16-35	KNRNFRKNHAKQAKKPAVKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1B8	RING-type E3 ubiquitin transferase	0.832	713-720	GKKKKGRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1B8	RING-type E3 ubiquitin transferase	0.735	403-411	KKNKGKGKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBM2	Ubiquitin-conjugating enzyme E2 S	0.98	206-223	SKKPKIKKNDKKKALRRF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCR8	Actin-related protein 8	0.89	114-128	TTKREKPGPKPGRKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCR8	Actin-related protein 8	0.64	100-105	HKKGSS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEQ4	Uncharacterized protein	0.83	184-195	KKSKTKTSKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFP6	PHD domain-containing protein	0.852	133-142	KRPTKRRKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG24	Uncharacterized protein	0.973	107-121	SSKKNQKRLRKKGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG24	Uncharacterized protein	0.673	193-197	IRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGN7	WD_REPEATS_REGION domain-containing protein	0.667	728-735	KPQKKGPI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIC3	Uncharacterized protein	0.966	1028-1047	KRVRSIVENWRKQKKSRKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIC3	Uncharacterized protein	0.897	85-100	RSTIRERRKRREGVKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIG3	Uncharacterized protein	0.989	963-979	PKKRVIKKKKSGIKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKK8	HSF_DOMAIN domain-containing protein	0.763	314-320	GRRKKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKK8	HSF_DOMAIN domain-containing protein	0.712	103-110	KIRRKPPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JST9	Uncharacterized protein	0.919	379-395	HGSKKKSSKHHSSKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU61	Methionine aminopeptidase 2	0.998	49-64	AKKKKKNKKKKKNGPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ56	DNA helicase	0.88	50-72	KKKQKTSPPATPKPRTAAARKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ56	DNA helicase	0.768	597-602	GGKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZX1	50S ribosomal protein L4e	0.91	210-230	RSRKIRAGQGKLRNRRFRQRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3J6	Uncharacterized protein	0.649	120-123	AKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KCV1	C2H2-type domain-containing protein	0.979	41-61	RKKRGRRSPTPPEDRRHKRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEG0	PPR_long domain-containing protein	0.926	45-72	PRRKPQRKEKYHRLTTKDAKGTKKSVKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR1	DNA topoisomerase I	0.827	134-153	RKRPADTKATPVKREKKVKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR1	DNA topoisomerase I	0.753	324-338	RGRGSHPKTGRLKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR1	DNA topoisomerase I	0.744	276-291	EKKKAMTKEEKLRAKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR1	DNA topoisomerase I	0.629	700-704	KKERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR8	Uncharacterized protein	0.631	356-359	KKKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2Y0	Uncharacterized protein	0.656	364-374	KPQANRRVREK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3U3	Uncharacterized protein	0.895	1013-1034	KEKKKQEKREAELKLGRGGRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF65	Uncharacterized protein	0.999	66-108	HGKKNKTGKKNKAGKKNKAGKKVHHKKKPNNRNMIKHAKKVKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGM2	Uncharacterized protein	0.945	60-71	PKKKKKQTKKKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGM2	Uncharacterized protein	0.703	292-297	KKNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJI4	Fork-head domain-containing protein	0.854	128-137	KRPIRKRRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMY1	ADP-ribosylation factor-like protein 6-interacting protein 4	0.988	7-39	KKHSKKQDKPDVLEQLRKLAKKHKKSKEKSSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR68	Uncharacterized protein (Fragment)	0.628	93-95	KRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU74	C2H2-type domain-containing protein	0.984	161-183	EFKELRRQLKKNRKKLQPPKPRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVL8	C2H2-type domain-containing protein	0.682	50-59	KRWKGHSKKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KCF1	Uncharacterized protein	0.931	116-135	KRRAEKQRRREEREKRLQLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEJ0	Uncharacterized protein	0.995	884-923	KGPQPKGKKAKRDAKAKEDKAALEKERAAKKEADEKARLL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEJ0	Uncharacterized protein	0.978	830-863	KQAKQKQAPAKPKTVAAPPVSTRGKKGKAKKMKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEJ0	Uncharacterized protein	0.891	1068-1077	SKRKKGGNRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIE5	TAFII55_N domain-containing protein	0.971	7-39	APKIVKIRKPRQPRGTRDKTIKIKLTAKKNKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIE5	TAFII55_N domain-containing protein	0.843	177-190	HVRQRRFRKKLSKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUQ7	Condensin complex subunit 2	0.728	632-637	PRKKKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUQ7	Condensin complex subunit 2	0.629	135-139	KRVRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWI4	AdoMet-dependent rRNA methyltransferase SPB1	0.999	807-882	KEKAKNIGKLLARATKSKPKKDVKVVVAKGANRGVKGRPKGVKGRYKMVDGVMKNERRAEKRREKKAKKRSGNGRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWI4	AdoMet-dependent rRNA methyltransferase SPB1	0.979	366-381	AKKKRERRKANEKKMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWI4	AdoMet-dependent rRNA methyltransferase SPB1	0.979	761-794	KLKALNARPIKKIAEAKARKKFKAVQRITKAQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWI4	AdoMet-dependent rRNA methyltransferase SPB1	0.814	559-569	KPKAPKEKKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J155	Pre-mRNA-processing-splicing factor 8	0.702	165-175	REKRDRRHFKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J273	Uncharacterized protein	0.974	386-404	APKRRGRGPNKNPTKKRRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J273	Uncharacterized protein	0.703	307-316	AERRKIAQKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J273	Uncharacterized protein	0.689	491-496	KTKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6E3	Uncharacterized protein	0.826	66-79	PKKKTSHSKKRMRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7R8	MI domain-containing protein	0.994	42-78	FGKKFTIKASTRKELRKQKKVEKGKRNAERHQRKRPI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7R8	MI domain-containing protein	0.607	220-221	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCJ8	BZIP domain-containing protein	0.735	128-145	RRLWRNRVAAKECRKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE35	DPBB_1 domain-containing protein	0.995	137-191	KKSKHSTRRRKTTTKRKTTTKKTTKKTTKKTTKKTTKKTTKKTTKKTTKKTTKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJU8	Uncharacterized protein	0.893	479-491	RQGKKMKKSWKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMV1	tRNA_int_end_N2 domain-containing protein	0.894	19-29	KKSKKPKRGEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPL4	Uncharacterized protein	0.968	276-292	ISKAAILLKRRRKKSKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS22	Uncharacterized protein	0.999	356-381	RKGKNKFSSARSKKKGGRPKAKKRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS22	Uncharacterized protein	0.833	202-220	RKSGKKERDEARMKEKASR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS32	Uncharacterized protein	0.892	420-434	KVANGTLRKRRAKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW42	CUE domain-containing protein	0.989	113-149	KAPARGNNGKSKINGKHNKSKRNGSRKDKSEKKVVEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW42	CUE domain-containing protein	0.814	72-82	KSKKPKPKPTP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0P7	HAL protein kinase	0.822	535-550	KEKRRRSSRPASPIPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K422	Uncharacterized protein	0.953	107-131	RHGARSASPLKRKDRKRQHSRHHHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBA1	Uncharacterized protein	0.719	261-268	KRKKAAKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBR8	40S ribosomal protein S24	0.999	88-130	PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZE7	EF-hand domain-containing protein	0.663	183-186	KRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J255	Transducin (Beta)-like 1	0.948	127-146	KRKSKEEKRQQKDREKRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7J7	FK506-binding protein	0.999	182-255	KKRAAEVAAKEQPSKKQKAAAAAPAAKEEPKKKEQKKEEPKKKEEPKKKEEPKKEEPKKKEEPKKKEEPKKNKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9Q2	RRM domain-containing protein	0.87	63-108	GGGGGGGHRRGGGGGGAMREQRGGRRHNNERFNDSRPYNKRPNRPH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAC9	MFS domain-containing protein	0.773	475-490	RWRKERIERLARKLKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM47	Homeobox domain-containing protein	0.766	267-275	KKRASKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN36	Zn(2)-C6 fungal-type domain-containing protein	0.632	92-95	KRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ8	Uncharacterized protein	0.678	65-69	GRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQH2	Uncharacterized protein	0.964	851-888	MRHQTRNKRSRMRKRVASRQSDGSLRRTRLKLRIRRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSI7	SNRNP27 domain-containing protein	0.995	29-122	RSRSRSPGASRRRRREDSYDRYESRGRRRDDSRDRYRRSRSSRSPPSRRDRRSPDTRDRGRPRNRSRSRSESPSYRRPRSRDGPVSRRPEQKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTI4	Uncharacterized protein	0.713	116-124	KRKPSTKKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVY6	Uncharacterized protein	0.934	19-30	GPRKKKGKEKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5K9	CBF domain-containing protein	0.619	205-209	KKQKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KK59	DRIM domain-containing protein	0.934	2735-2754	AKRKLDKHQRSQNKKKRTRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKK4	Eukaryotic translation initiation factor 2A	0.672	519-529	KKIRNLEKKLR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZ53	50S ribosomal protein L5e	0.915	257-282	EKKGKPAKPYRRLVALNKKQRLNKIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JB88	Zn(2)-C6 fungal-type domain-containing protein	0.764	25-37	SKKPAGAPKRQKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC37	Uncharacterized protein	0.99	586-614	AKEKKEMDRKKKSAHRLAQKQRAKEKKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC37	Uncharacterized protein	0.869	703-726	RPMAPFKAKPRSIRANTRRGKSVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCM1	Ras like family, member A	0.717	173-180	PRKKLLRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF56	Uncharacterized protein	0.993	655-676	PPLPKFKPFGKRKKRHPQGKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI24	Uncharacterized protein	0.83	32-46	ARKRAARARDKGVGM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMT7	Rab-GAP TBC domain-containing protein	0.636	235-241	KLKEKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQF8	Uncharacterized protein	0.625	81-83	KKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD2	Uncharacterized protein	0.747	942-962	RRHLELSKRRAHDRIAAAERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD2	Uncharacterized protein	0.686	376-390	GRRRLFRNEQQKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUG9	Bromo domain-containing protein	0.99	1029-1129	KNRPRYPPTNKTAAGRKKSAKEASSSQADHRKNKRKRPTEEIVAEKAEKAEKKRQKMEEKAQRIAEKEQKRKLREELREQERQAKIEAKEKKKLMNKKTKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW14	Uncharacterized protein	0.942	673-688	KQKKLEKKIKRKERER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW14	Uncharacterized protein	0.853	600-613	KRKLKMSKKERAKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW14	Uncharacterized protein	0.781	483-502	KIKFVKKAEKKLMGAQEKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWK2	Uncharacterized protein	0.988	860-885	VKKNKKKKKILKVTKGIDADKRKDAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWK2	Uncharacterized protein	0.983	405-430	RHEIKNKRLKKIKSKSYRKLQRKEKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWK2	Uncharacterized protein	0.606	11-11	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWK2	Uncharacterized protein	0.604	14-14	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3H6	Uncharacterized protein	0.994	59-74	KSKKSKKKKEKKEKQP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6P6	Uncharacterized protein	0.918	20-35	KRKPIPESTKKKRKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6P6	Uncharacterized protein	0.758	70-82	KKMHHKKNKATAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAG6	GPN-loop GTPase 3	0.984	195-206	KKRRRQKRRRRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFZ2	RRM domain-containing protein	0.707	241-257	KRSNRASRPSRNNDKKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KI62	Uncharacterized protein	0.951	30-64	KKKKMEEAKKLKEMQQKASGKGPLLGGGIKKSGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KI62	Uncharacterized protein	0.871	7-18	GKLKPLKKPKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE40	H/ACA ribonucleoprotein complex subunit CBF5	0.999	446-468	KKVKKEKKEKKEKKAKKEKKSKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGZ6	Phospholipid-transporting ATPase	0.664	6-11	KKPPRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ94	Uncharacterized protein	0.89	166-178	KEAKRPKHVKKPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ94	Uncharacterized protein	0.633	141-152	KRSNKDIKAALR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN91	ATP-dependent DNA helicase	0.867	1309-1319	ESKGRKRLKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN91	ATP-dependent DNA helicase	0.776	1345-1363	SREPSKKKFDKNQNSRHRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN91	ATP-dependent DNA helicase	0.669	756-760	RKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS93	DPBB_1 domain-containing protein	0.996	15-47	KRRRHEHKHRGKGRRHRSSLSSRRAAQSSRKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD4	Phosphatidylserine decarboxylase proenzyme 2	0.999	262-286	KSKKGRQLKNKFRRRKGGRRSKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD4	Phosphatidylserine decarboxylase proenzyme 2	0.601	135-135	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXC4	BZIP domain-containing protein	0.832	189-206	KRKRNTAASARFRIKKKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ90	SH3 domain-containing protein	0.999	12-34	EKKEKKDKKDKKKDKKKKKDKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K375	Uncharacterized protein	0.655	317-320	SKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K375	Uncharacterized protein	0.641	218-224	KRKAPAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3B3	Uncharacterized protein	0.654	8-12	KRKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9I6	Zn(2)-C6 fungal-type domain-containing protein	0.813	59-67	KHKKRGRPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KF58	Ribosomal RNA-processing protein 36	0.961	276-305	KSVDRILEKRRKRNTTKDRKHLPFNKRRSA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KF58	Ribosomal RNA-processing protein 36	0.919	97-146	EKKKISKDQILKDLKGAVGKLKKTNKVKLTKQDMKRESKHRPMEISSKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KF58	Ribosomal RNA-processing protein 36	0.72	229-242	RKRKQALLRDRKKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KF58	Ribosomal RNA-processing protein 36	0.648	257-263	KRSEKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKX6	Uncharacterized protein	0.77	133-140	SRLKKKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLR4	NUP214 domain-containing protein	0.695	860-880	EKRAAEERRIAEEKRIAEEKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB4	Uncharacterized protein	0.973	254-317	PPPSSASIPARRRPLSPPPPRPTSKRPALVADRKPPPPAMRRMPFSGRPLDPAARKPSAPPRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB4	Uncharacterized protein	0.94	19-76	ARQKRREDEERRRREERALREREEAQAQLARKRELQDKRQKSLIDQKKLMKGQEKKKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB4	Uncharacterized protein	0.865	412-419	RLKKRRKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMB4	Uncharacterized protein	0.745	201-226	PKKVNAQKRDRRSIAEIQREIRRSKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMG7	Ribosome biogenesis protein YTM1	0.923	228-244	HKKRKKNSEKSDRKIKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMT5	Zn(2)-C6 fungal-type domain-containing protein	0.778	107-118	KIKGRPQRRQRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR82	RRM domain-containing protein	0.999	31-122	RRERSRSPRSRSRSRSRSRSPKREARSRSRSPVRRSSSRRHDSPKRRRSFSRSRSRSPRGDRRGRRRSPSPPPRRRSRSPRRRSPIRGGRRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR82	RRM domain-containing protein	0.996	243-279	YRHGGRDDRRGGRRRERSRSPRRRYYRSRSRSRSWSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSZ6	Uncharacterized protein	0.993	42-82	RRKRIKELAAKREAGEKKAQLEASKESPKKSNKKKSNKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSZ6	Uncharacterized protein	0.886	132-143	KKLSKKEKKKAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWU7	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.913	291-303	QRKNREKKMKKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ08	RRM domain-containing protein	0.901	196-214	KEPVEKKKSTTGKLKAKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ08	RRM domain-containing protein	0.712	72-78	PKEKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZC9	Snurportin-1	0.984	143-155	PKKKSKSKNKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4H7	Uncharacterized protein	0.799	194-201	IIKKKPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K816	NAK protein kinase	0.735	576-587	KKNKPAPPPKPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX90	C2H2-type domain-containing protein	0.991	123-148	PKKEKAQKRKRRLKDPNETPSKNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX90	C2H2-type domain-containing protein	0.636	165-169	KPTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J008	Enhancer of polycomb-like protein	0.715	318-323	KRKRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5F5	Mitochondrial genome maintenance protein MGM101	0.857	262-271	KKKKKLWRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7J6	Ras-like C3 botulinum toxin substrate 1	0.601	185-185	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFB2	Homeobox domain-containing protein	0.659	46-50	KAKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG20	SWIB domain-containing protein	0.998	254-282	QKKKTKAKKKKAPKIVDPNAPPKPKRKTG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJH1	Uncharacterized protein	0.837	194-208	RKSIKSSKRRDKNKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLR1	RING-type domain-containing protein	0.996	85-104	QRRNNRRVRRRGSRRRRRRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMG4	5'-3' exoribonuclease 1	0.978	1282-1305	RGGRGGYRGGRGGRGRGRGRGGKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN76	WD_REPEATS_REGION domain-containing protein	0.994	476-497	KEKKRMRGRNSALKRHRRKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXX9	Uncharacterized protein	0.998	106-188	RLEREKKQREESRRKDDERRHSRHHRHHRHESDSRSRRESQSPERTHNKRHKRSRSRSPSKKNKKRHKHDEEEKPVQFKGRGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXX9	Uncharacterized protein	0.995	225-239	KDKKKKSKKKAKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2Y9	DUF1713 domain-containing protein	0.999	105-132	RKRRLKMNKHKHKKLRKRTRALRKKLGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K312	Uncharacterized protein	0.943	675-685	EKKKKKKSPAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZD8	WD_REPEATS_REGION domain-containing protein	0.891	11-42	RKRKRPAKTTSTVQRKGLASKAQPKGRSAPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J237	Uncharacterized protein (Fragment)	0.806	93-99	IKRKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J354	Uncharacterized protein	0.782	96-106	RRKARREARER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFY4	VHS domain-containing protein	0.89	182-223	RRRSPSPTREEKRRSLPPAMPSRPAQPVDRSPPPPKNKSKPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFY5	Uncharacterized protein	0.975	6-20	DKRAKKTKAPAKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH07	YjeF N-terminal domain-containing protein	0.711	254-265	KPKKPLFGGKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHW7	Uncharacterized protein	0.714	368-380	KPPPLKPKPSIGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIG4	Uncharacterized protein	0.776	462-468	AKRKRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIG4	Uncharacterized protein	0.693	936-960	KQIKKEEGKFHSVKKAQLFPRRTRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKJ5	Adenosinetriphosphatase	0.994	120-134	RRIRKKEKKIRKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKJ5	Adenosinetriphosphatase	0.752	81-95	EKAQRKKEMKEEARL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMZ1	SAM_MT_RSMB_NOP domain-containing protein	0.99	6-63	KNKQGAPEPLEKPKFEGLSKRAKARLNKTKAAAAEKKGNNKRQHTEEPKKSNKKAKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMZ1	SAM_MT_RSMB_NOP domain-containing protein	0.856	627-634	RKRKGLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN29	Transcription initiation factor IIF subunit alpha	0.992	464-521	KEKEKEKKIPVPPKKKATAASKPMMPKKAHTTKLKKEGMSKPIGRPGSPSLYMKKKER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN29	Transcription initiation factor IIF subunit alpha	0.723	13-24	GKGRAVPRRGGG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPN4	CRIB domain-containing protein	0.961	45-60	HKKKKKNKLYSRKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR04	Uncharacterized protein	0.998	36-133	SRHSEHRHSSRSDSRHRSSHHRSDSRHSSRRYRRSSRSPSRERRHRRSPSREYKRRSTSRRRSRSPTRRRRSRSPPPPIHHHHDRYNDRRRGRGGRSP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV28	Uncharacterized protein	0.642	378-383	KSKHKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0M9	SH3 domain-containing protein	0.625	169-172	KRNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWS1	MIR domain-containing protein	0.676	913-916	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYS3	Uncharacterized protein	0.98	865-920	KRKEREQKHKEYEEKRAAEDKRRAEERAAREARDAAKEAAREAKRAEKEAAAAKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZZ1	Uncharacterized protein	0.66	117-121	KRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3K2	Uncharacterized protein	0.608	225-226	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7Y5	Myb-like domain-containing protein	0.677	155-162	KGSKNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8Z9	Uncharacterized protein	0.646	631-633	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDE5	26S protease regulatory subunit 4	0.99	6-33	DKKDKDKDKKKKWEPPVPTRVGKKKKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIC4	RNase_H2-Ydr279 domain-containing protein	0.647	269-271	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIX8	Dual-specificity kinase	0.787	317-323	KGRKRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLA0	Cir_N domain-containing protein	0.964	171-201	KKRDEKKHSRREHKSSSSSSSDKKKKKHSHS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMC1	Protein BFR2	0.95	437-457	RKQTEQKKKKKVVDRKASKGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP13	Osomolarity two-component system, response regulator SSK1	0.915	1069-1078	KLNKKKKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP13	Osomolarity two-component system, response regulator SSK1	0.738	1367-1373	KRRKKPT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQM8	Uncharacterized protein	0.818	65-77	RKRKEKINKALRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT84	Response regulatory domain-containing protein	0.914	134-145	IKRKTPGKKKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXY9	60S ribosomal protein L18-A	0.994	160-192	GMGPHKNKKPFVRSKGRKFERARGKRASRGFKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZM1	Protein-serine/threonine kinase	0.944	474-485	HKKKKTPKSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZP3	Uncharacterized protein	0.95	56-71	KRQERLRRRKPKAKQM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAD1	Zn(2)-C6 fungal-type domain-containing protein	0.883	123-133	RPKRKARRNGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZN7	Uncharacterized protein	0.673	1204-1211	GKKPANRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J930	Condensin complex subunit 1	0.957	1275-1302	QRGPEPEKTEKTPKRVGRAVKSKEKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAV1	Uncharacterized protein	0.742	629-635	NKKRKSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGL3	Uncharacterized protein	0.743	110-118	KKKKSGRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMQ2	Uncharacterized protein	0.978	292-318	KNQKERKRKTPKSATPKQKRVTTPKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMQ2	Uncharacterized protein	0.686	89-97	KKTNRGRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMQ2	Uncharacterized protein	0.634	130-133	KKPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0Z7	PSP domain-containing protein	0.995	21-39	KKAQHKMRKRNKKKSKKQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0Z7	PSP domain-containing protein	0.883	572-590	AKKAKTQDSRKEGKKKEFK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K933	WD_REPEATS_REGION domain-containing protein	0.758	243-250	PKRKSRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KDS7	Uncharacterized protein	0.622	220-222	RKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUZ5	Uncharacterized protein	0.773	551-557	KQRRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWM1	HDAC_interact domain-containing protein	0.988	811-842	RSRRPRRRAARSSSNGSGKGKSKKSQRTNKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWM1	HDAC_interact domain-containing protein	0.618	913-917	RKAHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4G6	ANK_REP_REGION domain-containing protein	0.784	312-322	RKRSQRRKENK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5C0	ANK_REP_REGION domain-containing protein	0.969	283-302	RERKRLKRKRDNKVARAANK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5C0	ANK_REP_REGION domain-containing protein	0.755	107-115	PPKKGKQKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J633	J domain-containing protein	0.971	292-322	TKKKALRKRGGGEKVNVMGAKVGGRRRPAKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEH2	Uncharacterized protein	0.666	246-253	KRLRKEQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFC6	G-patch domain-containing protein	0.999	236-309	KSKKRKHTDDKEDKKSAKKQKKLEKAARKEAKAARKLEKAAKKEAKEARKAAKAAKKEAKAAKKAAKESKKSKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFE1	MYND-type domain-containing protein	0.961	34-54	DPQFKKQLKRERKKAAKQEKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIC6	Zn(2)-C6 fungal-type domain-containing protein	0.692	241-244	KRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRZ6	BZIP domain-containing protein	0.791	105-117	KRSKKVTPKKSRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSY0	DNA polymerase	0.994	79-97	GKRKRKNKKKESAKKDKEA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSY0	DNA polymerase	0.715	822-830	KKKVGGRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSY0	DNA polymerase	0.621	20-23	GKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSY0	DNA polymerase	0.613	153-155	KKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSY0	DNA polymerase	0.611	158-159	GK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0U9	Ribosome biogenesis protein NOP53	0.936	275-294	TKKRKAAERKTRQQRQKSHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0U9	Ribosome biogenesis protein NOP53	0.934	9-24	KKKAQPSRKGKKAWRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0U9	Ribosome biogenesis protein NOP53	0.847	431-442	KRKRKVAAATKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0U9	Ribosome biogenesis protein NOP53	0.839	93-135	KSKKSPFKKPEMTDKIISKHELKTLKRKIENNAPVTPKKKTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0U9	Ribosome biogenesis protein NOP53	0.682	342-353	RRSEEEKKGLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5A1	Uncharacterized protein	0.972	339-355	KRKLEKKKRKELLRQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5A1	Uncharacterized protein	0.627	78-81	REKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAE1	Uncharacterized protein	0.942	233-247	ENEKRKKRGPNRLRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYV8	BZIP domain-containing protein	0.996	23-61	RPIRPRKKPGRKPNPPSPAQRKAQNRAAQRAFRERKRRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5Z5	Pre-mRNA-splicing factor SLU7	0.651	66-69	EKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAW1	Uncharacterized protein	0.604	92-92	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBL0	Uncharacterized protein	0.963	18-28	EPKKHKHKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCQ9	Zn(2)-C6 fungal-type domain-containing protein	0.966	64-80	RKERKKGVKRGPYKKRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFV6	Uncharacterized protein	0.994	997-1032	KEKENKTGRFSLGFFGGGKKEKKKEKEKEKEKEKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKS9	Osomolarity two-component system, response regulator SSK1	0.816	987-1004	KPKSKFNFKISNRKRKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKS9	Osomolarity two-component system, response regulator SSK1	0.773	541-552	PSQSRRHRRSKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRB6	TP6A_N domain-containing protein	0.692	108-112	RKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVJ3	Serine/threonine-protein kinase RIO1	0.999	527-579	RKPRTPRGKKNEDKDDKKERKQKAKEEARERRKHKLPKAEKKRKIKTSSKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K034	Uncharacterized protein	0.992	46-72	KLRRKPVGLDADKLLKGAEKKKKKKKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K034	Uncharacterized protein	0.717	271-276	KKRMRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0J2	Uncharacterized protein	0.738	320-331	RKHKRGIVSRPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1A8	Mediator of RNA polymerase II transcription subunit 6	0.916	226-246	KRSRKRLDEGNTSNRKKKAAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5G2	Trp repressor binding protein	0.887	298-330	KSESKPKVEEEKKPATASKPAAPKTTPKKEEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5K5	Uncharacterized protein	0.981	785-804	KSRSVRYRPRKKIKRRSRCK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5K5	Uncharacterized protein	0.612	496-497	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBX1	Uncharacterized protein	0.818	453-458	KRKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KDA9	Uncharacterized protein	0.965	11-29	LLKKSSHKAKPKPNKRLRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1X2	Uncharacterized protein	0.925	159-186	KTKKRLAKTLKRKSREVQESKSESKRQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JA08	GAR domain-containing protein	0.865	2735-2746	KRRIARRKEKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCN1	Uncharacterized protein	0.921	276-304	KQRKKRLRENERKYANSISSKKSKKNHKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM78	Uncharacterized protein	0.962	123-148	KRVTRSRSKPAMPSTPKKKRATRAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPJ3	Uncharacterized protein	0.992	316-364	RGGFRGGRGGGRGDFRGGRGGRGGRGGRGDFRGGRGDFRGGRGGGRGRF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9D3	Uncharacterized protein	0.951	276-295	SPTSSPRKFRKSSRLRRSKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IW23	CUE domain-containing protein	0.979	651-693	LKKENKRPPRSESKERAYKDKNKARFGNHNRKAQRDKKVAKTG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX56	Uncharacterized protein	0.954	68-94	RRRNSSSETDKKSKSKKLLKRTIPKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX56	Uncharacterized protein	0.664	424-430	HRPSRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX56	Uncharacterized protein	0.611	409-410	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZ02	Copper-fist domain-containing protein	0.68	85-89	KKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZU0	Uncharacterized protein	0.709	233-240	RSTIKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZX7	Kinesin motor domain-containing protein	0.955	503-526	EKTHRKKKHSYRFGSKRSKTSRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZX7	Kinesin motor domain-containing protein	0.785	748-765	KKKLIKRLKLESDRAREK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1X9	Uncharacterized protein	0.678	58-65	KKVVKKKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5P8	CUE domain-containing protein	0.646	82-86	KKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAT2	Aa_trans domain-containing protein	0.727	259-264	RRRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK15	Uncharacterized protein	0.9	507-517	KKVKRNKKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPI2	Exonuclease domain-containing protein	0.869	44-54	KQKKKAAKARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPR5	Uncharacterized protein	0.878	86-101	NKRRERRQNKTSKRAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS44	PseudoU_synth_1 domain-containing protein	0.999	61-111	PAKKPKRKEEWAKKAKKGNNKREQKGEKKEKTLQTRPEHLGPREPRIPKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU11	Uncharacterized protein	0.988	244-285	LGKRKKGAQTNANPAKKGMSLNKKSSLKRPGKAKRQMMRGRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU11	Uncharacterized protein	0.737	178-194	KKAKTNERAKLLQRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KA89	60S ribosomal protein L28	0.965	16-42	HNRKKRGHVSAGHGRVGKHRKHPGGRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAH4	Uncharacterized protein	0.964	146-171	RKKQERVRKWKEAKRLKEEEEAKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAH4	Uncharacterized protein	0.876	10-46	RHRSPSPGGSSSKRQRHSYRDRSRSRDRHRSSSHRHH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR6	Uncharacterized protein	0.729	446-451	KPKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYR6	Uncharacterized protein	0.707	606-613	KPNVPKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZ25	Uncharacterized protein	0.993	873-907	QRSKKTEKKRKKEADARIKAEEEAKKKAEEEAKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZ25	Uncharacterized protein	0.954	814-863	RRKKQTEKVEREKAFRQEVEAGREEKRQRGIQEKERRREAKNQRKEYTRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZ25	Uncharacterized protein	0.871	569-586	SKQSGATRKSKRTRKSNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3M8	Uncharacterized protein	0.974	81-118	KRKRGRPAKLNSDGTKKSAAKQVDPSAPKRGRGRPRKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3M8	Uncharacterized protein	0.921	29-46	PPATRKRGRPPTKKADAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7A0	Phospholipid-transporting ATPase	0.862	1314-1323	EKRIKKQKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7A0	Phospholipid-transporting ATPase	0.667	1339-1345	KSKRHRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEY1	5'-3' exoribonuclease	0.765	414-425	RAQGAKRRRLEN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL08	Uncharacterized protein	0.711	610-617	RSRRSKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL08	Uncharacterized protein	0.704	542-553	KIARAKTKGNKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLB3	Uncharacterized protein	0.991	233-284	KRRQVSKKRKGGRNAVKGKEWINNKKKVARDRGDKVVANDSKFTGRKRKVRF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMF5	Replication factor C subunit 1	0.989	907-934	MKEAPKKRKAAAASGSGRGTSKKAKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMF5	Replication factor C subunit 1	0.986	155-188	RPPKKSKKSDSPAPTKKPAPKKAAPSKTKEEVAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMF5	Replication factor C subunit 1	0.831	74-104	KKPAAAKASTSKLQPVIKLKSATKRKAPVKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMF5	Replication factor C subunit 1	0.793	10-27	KPATEKKPASTPAPRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPT7	Uncharacterized protein	0.896	405-424	KSKLRREKIRINKENEKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ63	Uncharacterized protein	0.983	479-493	AKTKREKRKEKKKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ63	Uncharacterized protein	0.968	399-408	KKKKKKSKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ63	Uncharacterized protein	0.921	532-542	SKGGKKGNKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ63	Uncharacterized protein	0.791	439-445	SKRRRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS27	Uncharacterized protein	0.935	151-158	KKRRRKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVW1	Uncharacterized protein	0.999	317-414	PKDDAKLLKKTIKRQEKLKTKSGQEWNKRIEKVKYDEKKHIKKREENIKAKIEEKKNKKRGIKMKPAAKKARPGFEGGKRSKGGKVTKPNPPNNKGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVW1	Uncharacterized protein	0.989	194-219	ILAARNKKKEDRKKAIKAQKEKGGKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVW1	Uncharacterized protein	0.98	47-69	HNKRKKAPKQAIKEATKKAKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVW1	Uncharacterized protein	0.844	261-289	DQKKKKGPSDAKTQLKMLEAKKEKLDKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW84	Chromosome transmission fidelity protein 1	0.966	51-77	HNRKKRGHVSAGHGRVGKHRKHPGGRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8E6	Ribosome biogenesis protein RLP24	0.872	41-58	KMKRNPRKVRWTKAFRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9U2	Uncharacterized protein	0.89	363-377	GKKTTKKKDDKKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBN4	Uncharacterized protein	0.68	71-76	KKKNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ96	DDB1- and CUL4-associated factor 13	0.992	370-434	KLKERYGHMKDIRRIDKHRRTPKDIKLADATKKEMIKAERRKEELRRKHSKKLDAVRRVPEREKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUS5	Uncharacterized protein	0.77	74-81	RKRNRRRD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUX5	Uncharacterized protein	0.968	162-197	EKRKIKGAAKPMDELLQQKRKAKIYQRKHRKLRARR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXC6	Uncharacterized protein	0.767	430-443	PKNVKNQIKKKSKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXC6	Uncharacterized protein	0.607	386-387	RR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0V3	Uncharacterized protein	0.68	11-17	RRRDRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J399	Regulatory protein SWI5	0.609	285-286	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J420	30S ribosomal protein S19	0.977	49-77	ARRRFQRGLKRKPMGLIKKLRAAKKNAAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5K1	Ras family, other	0.976	171-190	QREGLKPGGPKGKSKKEKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD35	Uncharacterized protein	0.618	115-117	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDS6	Kinesin motor domain-containing protein	0.61	2003-2004	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDT7	60S ribosomal protein L13	0.882	30-48	GRKKSRRIARVQKAGRIAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDT7	60S ribosomal protein L13	0.715	128-136	PRKAGKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNJ9	PHD domain-containing protein	0.838	229-242	KRPKRASPKKLTTA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNJ9	PHD domain-containing protein	0.763	244-256	EQVKSNKKEKKTQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQR8	FCH domain-containing protein	0.682	411-423	KKKSAADNPRNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JR09	USP domain-containing protein	0.945	6-17	EKKKKAHRKRDR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS56	Non-specific serine/threonine protein kinase	0.812	881-899	GKKMMEWIKKKSHGKESRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JX80	VASt domain-containing protein	0.998	664-700	KSKREGGSKSKRRKARKHKSAHTPKPEETEKKQEKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBA9	Uncharacterized protein	0.904	221-242	QRKTRKVKRFHRSSTKKPLVWK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXX5	Uncharacterized protein	0.996	102-154	QKIAAAKAKKSTKKTTKKTTKKTTKKTSKKTTKKTSKKTTKKTTTKKPSTTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYI5	50S ribosomal protein L39e	0.794	25-58	KLGKAKKQNRPLPHWFRLKTDTKIRWNAKRRNWR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYV9	SCA7 domain-containing protein	0.979	185-204	EKPDKKKMKKEKQKKTTKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1N4	Uncharacterized protein	0.941	113-123	YKRERRRKRRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGU6	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase	0.752	348-356	ARRQKKRQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHG4	Uncharacterized protein	0.76	434-441	KKRRGRPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHG4	Uncharacterized protein	0.742	16-24	RERKRVRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK36	BZIP domain-containing protein	0.621	143-150	QRAFRERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK36	BZIP domain-containing protein	0.601	140-140	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRN4	PHD-type domain-containing protein	0.999	37-62	KSRRNNKKPVKKTKTKPKKKKKTTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRN4	PHD-type domain-containing protein	0.998	293-342	KKKHKSKAPKKKTLSKKSTPRRGKSKTVLANIVRQKAPPSTLTKKGKGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRN4	PHD-type domain-containing protein	0.768	228-242	PKKSSKVISSKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB58	Uncharacterized protein	0.913	52-82	KRKVERKNKTKEKYALLAKEEKLRNRREARE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB58	Uncharacterized protein	0.812	23-30	AKKRKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJT7	HMG box domain-containing protein	0.685	139-147	SKPRAYRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVP5	Uncharacterized protein	0.704	27-32	KKRRSN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX70	Homeobox domain-containing protein	0.886	4-13	RHKKKKKVQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZ32	Uncharacterized protein	0.908	276-285	PRKKRGRKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7P7	Uncharacterized protein	0.898	952-962	KERHRQKKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJT5	Uncharacterized protein	0.925	432-446	KNKTAKSIKKKRRGS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLJ8	Translation initiation factor 2 subunit 2	0.975	107-115	LKKKKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLJ8	Translation initiation factor 2 subunit 2	0.972	22-32	KLKKKKKSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLJ8	Translation initiation factor 2 subunit 2	0.97	74-83	KKKKKKKSKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMV6	Uncharacterized protein	0.971	177-213	GKKAKRKARERQLEEARRLTALQKRRELKAAGIHMRM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMV6	Uncharacterized protein	0.891	270-280	EKNREKKRKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSP3	RRM domain-containing protein	0.971	133-173	KAKRSRPRTPTPGRYYGPPKRGGAGGPRGDRRDGGRPPRGG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSP3	RRM domain-containing protein	0.894	16-43	RGRRSRSRSRSRSPGRDHSDHRYRSRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXY0	ThrE domain-containing protein	0.999	232-256	RRPTVKRRKTIKRKKDKKAPKLRKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0F7	Uncharacterized protein	0.908	31-43	SAIKKKKQKIGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K578	BHLH domain-containing protein	0.818	248-263	KRRRRRESHNAVERRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBK5	WD_REPEATS_REGION domain-containing protein	0.846	454-464	SKRRREKLRKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KC27	Uncharacterized protein	0.766	406-411	KRRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0D6	Uncharacterized protein	0.958	285-306	RKDALKRHEKSKKSDRQKRKIQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4J0	Uncharacterized protein	0.911	324-338	PRKLRKSSRLRRSKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J775	Uncharacterized protein	0.779	707-716	KRNRRSRKPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAD3	Uncharacterized protein	0.77	7-19	RQARRQASKRKAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEC0	Uncharacterized protein	0.992	233-358	AEKKTTEKKTAEKKESVKKEDKQASGKKAVSADDEEPAKKAAPVKKTAAATAAAASKKTTPAKKAPAASPAKKTSATATEKKAAAPKKTVATAKKAAAEKKIAVAPAKKAETKKVTKKAATPKNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFI0	Zn(2)-C6 fungal-type domain-containing protein	0.836	648-654	KKRKRRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHC7	60S ribosomal protein L3-A	0.899	23-40	GPRKRTRSHRGRVKAYPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHC7	60S ribosomal protein L3-A	0.657	243-250	KLPRKTHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLE3	Uncharacterized protein	0.627	44-48	HVKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPU2	Uncharacterized protein	0.991	20-88	KKRKANEKGAAVKARQRLELKKTKKNLRKTQFKRADEFIRNRRMVDKQGKRLRSISSGKRKGSNKKGDG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSR4	Chitin synthase	0.668	593-603	APSQRRSTRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWA5	GN3L_Grn1 domain-containing protein	0.998	4-47	KKVKSKRVRTAHKHRILGRIRDHHRKERRAARKNPGKHNKTKKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWA5	GN3L_Grn1 domain-containing protein	0.92	86-129	RAKAKKAAKKAEIAENIAAAKAAAAAAARAAVVVDKKPKKTSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ13	Uncharacterized protein	0.959	84-100	RKRKRKAKNGNQSNKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGM6	Uncharacterized protein	0.717	213-232	TRNRSRSPTRAEGRSIKRER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IV86	DBF4-type domain-containing protein	0.738	479-488	RRERELKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IV86	DBF4-type domain-containing protein	0.622	282-289	RKATPPPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J718	UDENN FLCN/SMCR8-type domain-containing protein	0.976	939-959	KEYKKPSRSGGRRGKHRFRKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8R8	PCI domain-containing protein	0.744	14-18	KKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8R8	PCI domain-containing protein	0.637	155-157	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ28	Uncharacterized protein	0.993	6-29	QKKNKLIFKGDKEQKKKKRKHRSV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL83	Uncharacterized protein	0.639	258-263	KRQKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMT0	RNA helicase	0.712	603-618	KKRGTNKQVRHSKNKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSI9	Uncharacterized protein	0.999	26-51	AKSKKSSQKKEKTKKPKKKKSSKSKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSV0	Uncharacterized protein	0.642	36-45	KRQKVLKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JYW5	BHLH domain-containing protein	0.925	417-441	LLPKPERRPYRRRQSSKNSKSASKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1A3	USP domain-containing protein	0.839	611-619	SKKSKKHHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3Z4	E3 ubiquitin-protein ligase PEP5	0.683	749-754	RQKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6Q0	Uncharacterized protein	0.862	163-169	KKKKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8R5	Uncharacterized protein	0.871	559-571	LRKKKSMKKLRQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8R5	Uncharacterized protein	0.785	592-606	APNLKKKQSSKKMSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KE26	zf-C2HC5 domain-containing protein	0.669	464-473	TKKTKGQLRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWF1	Arf-GAP domain-containing protein	0.88	211-229	GGARAPRKSAKSGKLGIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYL3	Uncharacterized protein	0.958	22-33	RKGGRKGGKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYL3	Uncharacterized protein	0.619	280-282	RKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2B9	PseudoU_synth_1 domain-containing protein	0.83	41-53	KHKKRRQREQKNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2B9	PseudoU_synth_1 domain-containing protein	0.741	436-444	KFEVRKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J382	Uncharacterized protein	0.971	67-90	GKKRRARGLLKKAESKAEKKIRYQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J382	Uncharacterized protein	0.848	276-284	SKRKQKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4F6	RRM domain-containing protein	0.856	314-345	PIKLRKSTWKERNIDVRAKKERDRVGPYPKHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4F6	RRM domain-containing protein	0.829	215-221	KKKKKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J675	Uncharacterized protein	0.909	52-66	RKTKDRKKEKEKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8E9	Uncharacterized protein	0.966	10-61	KLKNAGAAGPSGSKEKRAEKEKNAPPPPGNPSVGIYDAKRAKTRRNKKKSYR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAK5	B30.2/SPRY domain-containing protein	0.608	621-622	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC22	TEA domain family member, other eukaryote	0.779	317-334	KKPKKMNTTRKYNKKQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD19	Uncharacterized protein	0.998	168-277	IKAKIEAKKAKAEAEKEQREQRRKEKKEARVQKAKERVKAHRKLVKQRKWEREQAAKKEAEAQKEEPVKEKEAPVKKDAAPKKTAAKAATKKAPVKKAAPVKKTTKASKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD19	Uncharacterized protein	0.742	53-60	RYKKRARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD19	Uncharacterized protein	0.605	142-142	R
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHX3	Chromatin modification-related protein	0.994	148-178	RERATKRLERERKDPKGEKKIVKKRKTAKDP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHX3	Chromatin modification-related protein	0.602	295-295	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIJ5	ENTH domain-containing protein	0.844	125-133	ERKKAKKNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ47	HSF_DOMAIN domain-containing protein	0.825	236-249	RRKATRYSRKRKVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPT5	Uncharacterized protein	0.783	51-62	APPKRRFYKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGZ5	Uncharacterized protein	0.682	22-28	GRTKRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVM2	Nudix hydrolase domain-containing protein	0.999	210-226	GKKKEKKDKKKKKKKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVM2	Nudix hydrolase domain-containing protein	0.999	281-297	GKKKEKKDKKKKKKKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVM2	Nudix hydrolase domain-containing protein	0.994	326-341	LKKEKKKNKKNKKKGE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVM2	Nudix hydrolase domain-containing protein	0.985	181-193	KKKEKKEKKKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVM2	Nudix hydrolase domain-containing protein	0.865	256-264	KKEKKKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0A1	Chromo domain-containing protein	0.961	134-161	KKGKSKEKSTENRPSKDKGKLKDKSKGA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7S2	OrfB_Zn_ribbon domain-containing protein	1	287-324	RNKRSKEKKKKKRRRKEKKEKKVVIDNPSKPKKQKWKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAK9	Glutamate synthase [NADPH]	0.777	1558-1579	RREKLDKLRGFMKYKRKADPYR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG12	CK1/CK1 protein kinase	0.615	539-540	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHE5	Zn(2)-C6 fungal-type domain-containing protein	0.992	106-131	RKERKKGIKRGPYKRRQKTGEEKPRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLR0	Uncharacterized protein	0.941	461-480	IKGRGRGRGANKDKGKAKAV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLR0	Uncharacterized protein	0.719	414-431	KARSKSRVAATRRQPARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN01	RING-type E3 ubiquitin transferase	0.935	24-52	KKRNNHRRRNNNNKKAEDGGKKARSSAAN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN01	RING-type E3 ubiquitin transferase	0.904	666-674	RKKKGKKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN01	RING-type E3 ubiquitin transferase	0.847	59-78	SEEKGKQQEKKPLKGFKKNP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT86	Uncharacterized protein	0.716	39-52	KAPRGTFKNKPSKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWY0	Myb-like, SWIRM and MPN domain-containing protein 1	0.747	90-94	KKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZS2	Uncharacterized protein	0.689	962-966	KKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0N2	Uncharacterized protein	0.627	607-609	KKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLZ0	Uncharacterized protein	0.94	103-140	AKREKERQIQEANPPSPPPKSKEASPEKVPVAKKRRKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLZ0	Uncharacterized protein	0.711	41-46	KRRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT98	Uncharacterized protein	0.999	105-127	KPREPKPAGEKKKKKRNNKKSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT98	Uncharacterized protein	0.993	240-285	ERKPKAKKAKAQTAAPVAEGQQEPKPKKSNRSRKSANKKKAAAKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUP4	Restriction of telomere capping protein 4	0.745	52-59	PKRRAKPL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVE5	Uncharacterized protein	0.922	23-42	KGLKKKLKQVERFRKHKERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVE5	Uncharacterized protein	0.63	291-296	RRGMRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEJ7	Usp domain-containing protein	0.817	380-390	PQKKKKAVHKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUN1	Uncharacterized protein	0.965	127-144	GKKRKKKSAAPPPPSIKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUS0	STE/STE20/PAKA protein kinase	0.882	529-556	RKPKTNPSTAAPKPKRELPPKSSIYRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0Z3	Tyrosine--tRNA ligase	0.987	351-371	AEKVNPKKEKKEKKKAERAAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC41	Uncharacterized protein	0.898	68-78	SHHHKKKKKYK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHC8	Uncharacterized protein	0.998	59-74	EPQKKKKKKQPKKKRG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKS3	C2H2-type domain-containing protein	0.912	263-287	RHPTEFKEMRKEWRRQKKERDAAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV91	DUF3020 domain-containing protein	0.858	126-137	RASNRERKKKWR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV91	DUF3020 domain-containing protein	0.751	179-191	KRRQKRMDKERRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2G2	Uncharacterized protein	0.605	690-691	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6U2	Exosome complex protein	0.966	167-180	EPSKKKKKNKNRNA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKY9	DNA primase	0.657	270-273	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXL5	BHLH domain-containing protein	0.824	145-160	KRRRRRESHNAVERRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6J4	Uncharacterized protein	0.65	28-31	KRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBQ4	Uncharacterized protein	1	53-68	GKKKKKKKKKKKKKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD01	Ribosomal S17	0.633	132-140	GRRDNRGPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE11	Uncharacterized protein	0.955	122-138	SARPRKSRDARARKRPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFV7	Uncharacterized protein	0.707	2711-2717	RNKKKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFV7	Uncharacterized protein	0.661	2466-2470	KKRMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKK3	Uncharacterized protein	0.996	1049-1070	SVGKKRGRPKKGEPESKRKRGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKK3	Uncharacterized protein	0.947	1010-1042	KKERRKQKRMARMLGEPEPVEEAKRPGRRRREE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKP3	Dynein heavy chain, cytoplasmic	0.838	982-990	KSRRKRKAG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN75	Ribosomal protein L15	0.98	156-202	HKRREARGLTAIGKKSRGHGKGHRFNNTKGSGRRATWKRRNTLSLRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN75	Ribosomal protein L15	0.96	40-78	SRPSRPDKARRLGYKAKQGFVIYRIRVRRGGRKRPVPKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP48	BZIP domain-containing protein	0.718	112-125	KSKRKAQNRAAQRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQP7	Uncharacterized protein	0.607	258-260	RSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQP7	Uncharacterized protein	0.602	255-255	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS39	Clustered mitochondria protein homolog	0.945	1192-1207	KSKKGTQKKSQKKQRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS39	Clustered mitochondria protein homolog	0.776	871-878	RGKKNKKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSS6	Uncharacterized protein	0.672	646-652	KPKGGKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXA6	Signal recognition particle subunit SRP72	0.995	651-667	AKSTASKKKKGKGKSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXA6	Signal recognition particle subunit SRP72	0.951	544-562	KKDPNGVHVKKPKTKKKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXA6	Signal recognition particle subunit SRP72	0.625	593-597	GKNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KED2	Uncharacterized protein	0.795	329-335	KKKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWE7	SCA7 domain-containing protein	0.999	75-96	KEKKRAKREKKAKPKAIPKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWE7	SCA7 domain-containing protein	0.866	29-40	KPNKKRKRNAIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3J3	Uncharacterized protein	0.627	6-8	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.999	1228-1271	RDKKQKAAAKAREGRVGRGRGRGRGRGRGRGGRVLGVDKGKAKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.998	242-277	VKSKSKPATKPAKSKRPPKPRAPSKSKATTSSRRKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.996	927-961	KLKAKPKAKTAGKSKAKGGPKTKETQKARARKTKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.977	712-738	KPKRKRAGPKAKGESTTKVPRTTKPPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.93	1018-1030	KKQAKRKYKPRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.826	1062-1075	AGRRQSARKSREKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.8	548-583	SKKGVNLKRNKSTTEAKSNSKTKVVRKRNSQNSRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4W4	ASXH domain-containing protein	0.769	685-692	KAGRKRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7U5	Uncharacterized protein	0.992	181-227	EQARREELKKAADKEKERNRMLQSKQKKEKEQDKEKKKTQKGERRRM
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG40	zf-C3H1 domain-containing protein	0.94	613-652	KAAKKPKAVQRPKLPPQPKASNTKFNGKSKALPPMKKPTK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG40	zf-C3H1 domain-containing protein	0.849	197-214	KNRKAVITPAKSKKGKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG40	zf-C3H1 domain-containing protein	0.761	390-399	PKKAKKLGQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHP8	XPA_C domain-containing protein	0.942	216-238	REAQKKDKKDKKFKEKLADLRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIV7	SWR1-complex protein 4	0.924	403-424	KVKKRSGSNAGSSSGHREKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIV7	SWR1-complex protein 4	0.871	295-310	KKKKKSIHDDSKKGRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTL5	OrfB_Zn_ribbon domain-containing protein	0.998	164-186	GKKYNKGKRKKTRANRKRRRRNR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV00	CMGC/CDK/CRK7 protein kinase	0.673	651-657	RKKQKAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JYY1	Mitochondrial GTPase 1	0.747	325-341	EKKVAKLEQRKNSRRAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K741	RRM domain-containing protein	0.997	170-260	KNEKKSKKKDRKSSSSRHHKHKSSRDRSREGRHRSSRDEDRHRSSSRRERSSEERPRRDDRYSSSRHRSRSPHSRSRSPPRRRSRSPRRRY
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0S6	Uncharacterized protein	0.985	13-41	ALRKQQRKRELKKNKEDRKRVRESALAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1X0	Uncharacterized protein (Fragment)	0.718	62-68	TPRRRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEB5	Homeobox domain-containing protein	0.961	71-92	RRAKENKKSKMKAHHQKKKSNG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ29	OrfB_Zn_ribbon domain-containing protein	0.92	19-30	GPRKKKGKEKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ29	OrfB_Zn_ribbon domain-containing protein	0.904	175-198	KMKQARSEAKRKARQKSSTTKSKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLJ2	Uncharacterized protein	0.966	343-359	PAEKKKKSKAWKIWKKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLJ2	Uncharacterized protein	0.965	20-49	EQSKRERKEEKKLKKNAPDSVRFNSKKSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMK5	RING-type domain-containing protein	0.906	85-107	GKRGAAVAARRQLEGKGKKKSSV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMK5	RING-type domain-containing protein	0.757	114-124	KIQKSRLKRKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMV0	Uncharacterized protein	0.726	14-23	RRPSRSKSKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPD1	Uncharacterized protein	0.95	315-322	KKKKKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPS3	WD_REPEATS_REGION domain-containing protein	0.956	408-425	PATAKKNNPNKKKAASKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPS3	WD_REPEATS_REGION domain-containing protein	0.867	377-394	AKLEKKKKQQQKAEPAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVE7	Zds_C domain-containing protein	0.702	565-571	NKKKDKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVE7	Zds_C domain-containing protein	0.618	556-559	KTRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1K3	RRM domain-containing protein	0.952	64-94	RGRREDRYQHRRHRRRSSSSGSRSPRRSYRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1K3	RRM domain-containing protein	0.878	36-48	RVKRRREKFKRER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3T0	Uncharacterized protein	0.914	51-66	PRKRAKPNASRSRKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K462	Uncharacterized protein	0.607	73-75	KSP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6H3	CMGC/CK2 protein kinase	0.914	76-86	KPVKKKKIKRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB83	F-box domain-containing protein	0.91	96-116	RKKRGKETPSHTKPKQKSKEP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIJ7	NET domain-containing protein	0.991	296-314	KTKRANNNKRKKRTAKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIJ7	NET domain-containing protein	0.935	241-259	PKKQPQTKNRSKNRRNRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIJ7	NET domain-containing protein	0.745	338-348	KPKRKSAVHKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUT3	Uncharacterized protein	0.724	43-56	SKKKGSSSRTLKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVH9	Uncharacterized protein	0.876	182-208	KRNKHEGEKADKLIQQESKKERKRMKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVH9	Uncharacterized protein	0.659	6-21	KGKSKETLKIRPYRPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZ57	30S ribosomal protein S27Ae	0.984	76-99	GGKKRKKKTYTTPKKIKHKRTKVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J393	IKS protein kinase	0.602	189-189	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3C1	PH domain-containing protein	0.918	504-528	RRPHKASTSSTSKRRGKKALDPRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3C1	PH domain-containing protein	0.715	1912-1920	RKRKSHHHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6Q0	RRM domain-containing protein	0.955	260-301	RKRSRMRSRSRSPKGYKDRVDRYGGSRGGRDRSRERMGSSSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFX7	Uncharacterized protein	0.988	18-30	KNRKKKQKKKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHA1	Uncharacterized protein	0.997	541-575	KKKEMIEASKKRKRVASQKEKKAKKEKKTEQKESK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHA1	Uncharacterized protein	0.888	75-92	KKASKEEKKASKSSKKAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIU8	Uncharacterized protein	0.903	611-630	GKVSKKKQKPKSALINVKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP00	Protein Ras-2	0.618	166-169	KNKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JX30	Uncharacterized protein	0.994	2390-2420	KQKRLLKRPALISKKTRRPRFLRRNRKKYRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KAD5	Uncharacterized protein	0.977	63-73	KKPKHRKKKKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKV1	Uncharacterized protein	0.997	87-160	KKALVAKIIEEKDAKKDQKAEEKKAKLEKVKQAYLEAQKKKKNEARKLKAKAKMEAARAKLQPVAPEKKKKSVR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKV1	Uncharacterized protein	0.87	32-50	IPAKKDANVKKAAHKRRVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1M2	Threonyl-tRNA synthetase	0.941	8-24	KPKVEKKPKAPKAPKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3V6	Uncharacterized protein	0.822	7-25	KKSKKSGKISSSSSKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6E0	Endo/exonuclease/phosphatase domain-containing protein	0.929	20-36	LRRLKQAKKEAKKKLNS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFT9	SPX domain-containing protein	0.994	688-700	KKKKKKKNKKDKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFU1	Uncharacterized protein	0.64	323-326	KKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ74	B30.2/SPRY domain-containing protein	0.851	257-269	KLSKKRKLFRKPQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK40	Uncharacterized protein	0.742	60-69	KPRKVAKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLX2	Uncharacterized protein	0.994	344-375	PKPRKTRTTRKSTTTKRGGRGRFRPYRRKKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLX2	Uncharacterized protein	0.931	120-141	PAKKAQPKPKLKQKETPKQKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMK4	Tudor domain-containing protein	0.729	180-185	KKKKAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMK4	Tudor domain-containing protein	0.729	202-207	SKKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMK4	Tudor domain-containing protein	0.646	149-152	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPF6	Ribosomal protein	0.747	93-104	NKNKKLIKKLAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ22	Uncharacterized protein	0.793	99-119	RHRRHEMDERKQKNREKERLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQX5	Uncharacterized protein	0.72	547-553	RLRKKRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQX5	Uncharacterized protein	0.7	471-478	AAMEKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQX5	Uncharacterized protein	0.616	467-469	KKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW33	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	0.973	11-29	APKKRIVRRRKKQLTPKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW33	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	0.969	358-371	PPKSKKSIKKKKKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0L0	Smg4_UPF3 domain-containing protein	0.999	41-63	EKKKKRAKRKPKRHSRKPTLKTK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0L0	Smg4_UPF3 domain-containing protein	0.986	292-311	GKKKRERNRKKKDADGSTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0L0	Smg4_UPF3 domain-containing protein	0.982	243-267	QAAAKAKAAAKKNARKRADKAAQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0L0	Smg4_UPF3 domain-containing protein	0.981	335-364	KNRPPRDNTKTKEPRPARPPKEPKAPRPPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2F3	Uncharacterized protein	0.867	129-141	PPPRPRRKSPPSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4F5	Uncharacterized protein	0.745	19-26	KRIKKKNS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KHE4	Uncharacterized protein	0.784	293-316	NKKPHKLRFMRALSPPKYMSKRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJP0	J domain-containing protein	0.839	69-88	KHRARQERQKKKQEMDSKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J049	AAA domain-containing protein	0.99	236-247	KTKKRRKKKHKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J049	AAA domain-containing protein	0.679	725-730	TRSKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0T2	Uncharacterized protein	0.637	118-124	RKPRVSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J337	Uncharacterized protein	0.724	709-719	KKKAPSTHKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J341	ERCC4 domain-containing protein	0.633	622-628	AKRLVKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J341	ERCC4 domain-containing protein	0.63	90-92	RRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3A2	Uncharacterized protein	0.869	462-472	NRRSRKGKGKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCE1	Uncharacterized protein	0.793	82-94	RRRKIRRFQKTRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF73	Uncharacterized protein	0.627	394-396	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP19	MHYT domain-containing protein	0.879	456-475	GASKTKKTKKSYKWGHQKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPH9	Uncharacterized protein	0.996	355-396	KSQKKKKPEKVIRRTSKPAVKEKKQPPVVKEKRKRVTKKKEP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPH9	Uncharacterized protein	0.878	131-140	VKRRKKNPKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPH9	Uncharacterized protein	0.615	181-182	RR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQY0	Uncharacterized protein	0.633	548-551	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW47	Uncharacterized protein	0.99	49-61	KSKKKKKPKKDKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW47	Uncharacterized protein	0.771	319-340	SPLKPRGFLPRRKDAFVRGSKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW47	Uncharacterized protein	0.757	252-274	KKKRATSKLIPMPIPPRKISQKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8I5	Exonuclease domain-containing protein	0.999	37-73	SKKRSHPAHDSSEKDKKKKKHKSDKNDKKDKKAKKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8I5	Exonuclease domain-containing protein	0.981	128-174	PNSKKPNAPKKSNKVKGKQPPKKLTQEEVLARVAAIRKKKQLKRQAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IY43	PHD-type domain-containing protein	0.974	76-114	NKKRKRTNKDQLSSTAAPKKPRQKRQTKNKAAVKRQLNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J0K7	Uncharacterized protein	0.623	30-32	RKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J370	Histone H2B	0.878	11-25	KKTAPKDSKKRKISR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4Q8	Uncharacterized protein	0.618	400-401	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHI8	rRNA-processing protein	0.993	52-123	RSKERARNDATKSLEKQLKAEKQAEKDAKRAVSLERKKLREEQERMEALAAKMSAKRLERLKRREARKKARV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIJ3	Velvet domain-containing protein	0.673	866-877	SRRKSSLVEKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJW2	Uncharacterized protein	0.67	128-136	GKLKRMAGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKN7	Usp domain-containing protein	0.927	307-319	PQKKEKSKKHKKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLE1	Eukaryotic translation initiation factor 3 subunit C	0.615	150-152	KKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMJ0	Uncharacterized protein	0.949	223-245	RKKNMMRKKMNTRRDRKLRWRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNR5	Uncharacterized protein	0.769	1229-1243	KHRLAKEEEKRKLKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQF4	Uncharacterized protein	0.898	336-354	PKAKKKELQDKSKGKGKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQF4	Uncharacterized protein	0.883	939-963	RRRHLELSKRRARDRIAAAERKASG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQF4	Uncharacterized protein	0.686	378-392	GRRRSFRNEQQRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRB9	Uncharacterized protein	0.702	469-475	KKRADKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV83	PHD-type domain-containing protein	0.852	566-573	EKKKKHKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFW8	PC4 domain-containing protein	0.619	74-77	KKVR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZC5	Swi3 domain-containing protein	0.97	204-219	KKKAKAKAKSKSKPAI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9Y5	CAMKK/CAMKK-META protein kinase	0.656	99-105	GPRGRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFL6	bVLRF1 domain-containing protein	0.801	547-561	KEKKKQAKEQEKKRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFL6	bVLRF1 domain-containing protein	0.626	624-627	KRAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH57	PH domain-containing protein	0.824	45-52	KKRRKKLQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJD5	C2H2-type domain-containing protein	0.8	373-393	KRQPSEFKELRKMWRKQKRDN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJD5	C2H2-type domain-containing protein	0.686	330-335	KKRPRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM65	DUF2431 domain-containing protein	0.889	298-320	KGAQKRKLELLKIQMGKKVKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM65	DUF2431 domain-containing protein	0.734	5-24	KRKKLANALDRMLKKNEKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMN4	DUF1752 domain-containing protein	0.618	295-297	KKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JP64	FAM192A_Fyv6_N domain-containing protein	0.602	179-179	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQP1	Zn(2)-C6 fungal-type domain-containing protein	0.856	399-412	KHKPRGRPRLQKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQP1	Zn(2)-C6 fungal-type domain-containing protein	0.673	279-283	KRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUX6	Uncharacterized protein	0.935	168-188	RRAKKAEARRKSLGLPKSRLR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW94	BZIP domain-containing protein	0.838	185-194	TNKKPRRQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXT5	Uncharacterized protein	0.851	366-376	KSKGKGKGKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXT5	Uncharacterized protein	0.812	399-416	NGRRRLFRNEQQRKKKHE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXT5	Uncharacterized protein	0.613	714-715	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JY43	DNA polymerase	0.835	750-757	KREKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JYE1	Uncharacterized protein	0.865	12-25	KREHTPKRKRSRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JYE1	Uncharacterized protein	0.658	69-74	KRGRPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2J4	Uncharacterized protein	0.964	42-49	KKKKKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2J4	Uncharacterized protein	0.961	183-221	KKVDPKMKRAEEARRRKEQIEKEARKMEWGKGLVQRREA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2J4	Uncharacterized protein	0.608	225-226	RR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K705	Zds_C domain-containing protein	0.611	629-630	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1E5	ANK_REP_REGION domain-containing protein	0.873	176-189	RRERKRAERKKDSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8L3	Uncharacterized protein	0.781	176-182	RKKKKRV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8L3	Uncharacterized protein	0.77	121-133	KRKRQAKRADQVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC24	Uncharacterized protein	0.619	379-381	RRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI80	Uncharacterized protein	0.999	159-220	GRSRRKSSRDRSRSPRRSSRRRSRSRDSRSRSRSRSRSRSPRRDRSVSRSRSSSRGRSSERR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JID9	SWIM-type domain-containing protein	0.999	16-124	KRPVGRPRKIAPATSASKRKAEDSEEGAPLKKVKDELAVQRSVRPKRTSTIKREPKIEQAPVVKKELKVKKGPAAKTKPKVKKEVKPKKQLKEKAKKEPKPKRQIKSRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JII1	Lysophospholipase	0.824	737-754	RKVIKETWKRKRDERLKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXY8	Arrestin_N domain-containing protein	0.66	503-509	RKNTRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K511	Uncharacterized protein	0.991	6-41	RSGKRKDHSNEASSAKKRAPKKAKLEQPSKAKDKGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7F0	BZIP domain-containing protein	0.706	177-193	KRKAQNRAAQRAFRERK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXV5	WW domain-containing protein	0.984	205-232	INKKKPLTRKEVEYFKKMKKEKKSKRAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5J3	MMtag domain-containing protein	0.998	173-236	KDKKRSKKHHKHHKSEKRKRHHRDRSRDDSEDEERSSKHRRHHRSSSHRDREGHHRSHRSSKSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J969	Uncharacterized protein	0.874	517-528	IPKPKPPKKTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAC2	Uncharacterized protein	0.971	10-18	KKKKKKKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAG8	U3 small nucleolar ribonucleoprotein protein MPP10	0.991	531-551	RKRLRAQKKKLKRKERDMKER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAI8	Uncharacterized protein	0.957	417-437	KPKRARKVSAKKASVSAKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAI8	Uncharacterized protein	0.889	383-394	RKSNKGARKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAI8	Uncharacterized protein	0.747	515-525	KKPAAKRNAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAI8	Uncharacterized protein	0.617	549-553	RRSRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBE0	Uncharacterized protein	0.791	1034-1047	KKNKKANRIKEVKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBE0	Uncharacterized protein	0.624	19-22	GRPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHV9	Uncharacterized protein	0.992	80-101	KKTPRGKAKAKSKAKPSKNSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHV9	Uncharacterized protein	0.991	12-33	KSKKAITKKKISSKRTKKKKSP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKD8	Uncharacterized protein	0.626	583-586	KRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPM5	Adenine DNA glycosylase	0.675	274-277	KKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JV24	SRP54 domain-containing protein	0.802	185-195	RVGGRPRKGKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JX14	Uncharacterized protein	0.607	29-30	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8N2	Uncharacterized protein	0.797	330-356	QARREETLLHKAKLKEERDRLRIERKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8N2	Uncharacterized protein	0.791	711-739	RKHRQISRQEKLKQKQKAREEMEIQRKKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8N2	Uncharacterized protein	0.697	744-764	RQIAKAKNQEHRNRMSERRKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K939	Uncharacterized protein	0.999	80-120	KKPDGKKKPAEKKPVDEKKKKKEEERKKKAAALAKEKENRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3W9	RRM_2 domain-containing protein	0.691	384-389	SSRRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J589	Uncharacterized protein	0.845	31-48	KKKSTSGKHHKHHKHHRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5D8	Uncharacterized protein	0.696	1312-1318	GKPKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJI3	Uncharacterized protein	0.772	6-20	RHRKQKPPSPKFQKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNT2	BZIP domain-containing protein	0.985	123-158	RIRKKPGRKPNPASPALRKAQNRAAQRAFRERKERH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPU3	Uncharacterized protein	0.903	212-226	AKKRRKEDTKKKVDP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQ57	Uncharacterized protein	0.78	191-197	GKKRRKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUN1	NUC153 domain-containing protein	0.861	667-680	SNKDNNKHKNKRRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0G1	Bromo domain-containing protein	0.999	50-66	KKKKHKKKHKKKHKRSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0G1	Bromo domain-containing protein	0.982	163-198	KKGRRSSSMKSSTGAAAAGEKPKKRGRPTNKAKAAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0G1	Bromo domain-containing protein	0.738	424-429	KKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1S1	PAN2-PAN3 deadenylation complex catalytic subunit PAN2	0.963	399-417	RNQRPRKKKTIAKKNGPKF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2H9	SAP domain-containing protein	0.979	329-378	KKRAERFGLPEKKVEETKTPAKKANNKNKKKASVATPKESPVKKVQNGRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2H9	SAP domain-containing protein	0.809	213-235	KAPPKSKIKPAAAAKPTPVPTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2H9	SAP domain-containing protein	0.675	545-552	RKRGPGSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2H9	SAP domain-containing protein	0.61	249-255	RRLERSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZM0	Chitin synthase	0.688	873-879	KKNKKPR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J117	Flap endonuclease 1	0.998	357-382	AAPKDDKKRGAKDAGKKAPAKRGRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J117	Flap endonuclease 1	0.62	101-103	RKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8M2	Ribonucloprotein	0.977	39-74	KKLVKKIYKTIKKASKVKHVRRGVKEVGKALRKGEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8M2	Ribonucloprotein	0.621	7-10	KEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHM4	Uncharacterized protein	0.911	855-865	KRRRRRSIKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHM4	Uncharacterized protein	0.811	759-765	KHKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJX7	Uncharacterized protein	0.753	70-86	KKKFDRRSDNKMNKRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKY0	B-related factor 1	0.947	620-654	VPYGRKNKYKKKKLPQANSPAEAAKQLLEKKKLSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKY0	B-related factor 1	0.618	392-396	KPVRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPI0	Uncharacterized protein	0.731	74-84	LRLSRRKLLKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPX9	Uncharacterized protein	0.902	1446-1468	KIAKRKAQPDKVKKYLRKLAKLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPX9	Uncharacterized protein	0.609	891-893	KPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPX9	Uncharacterized protein	0.6	1486-1486	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQW1	Uncharacterized protein	0.992	207-228	RKRKKKQSTIPKIAKKRYKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQW1	Uncharacterized protein	0.948	91-109	MSKKKRKKMEKYIEQKLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQW1	Uncharacterized protein	0.85	5-27	RPRFNEKARASSRKPNQRPHPKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS47	Uncharacterized protein	0.725	776-788	RRHLELSKRRARD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZW8	TPR_REGION domain-containing protein	0.882	1071-1102	GGGRGGYNKRGGGNMPMRGGGSGGKPMKRRGG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2H3	Uncharacterized protein	0.998	92-122	RRAKEKARKDKERAKERARKSKEKEERKDRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2H3	Uncharacterized protein	0.832	310-317	RMRKRKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K697	Phospholipase	0.888	961-982	PPPPPPPPPPLQPRSKRRIKSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9K2	MSC domain-containing protein	0.855	106-124	KRRQKRPEEALKAPAKKDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBK9	MFS domain-containing protein	0.694	272-277	RKKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KHU9	BZIP domain-containing protein	0.997	23-61	KPIKPRKKPGRKPNPPSPAQRKAQNRAAQRAFRERKRRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWX1	DNA polymerase delta subunit 3	0.819	313-324	KVRKKVLKKRTT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J260	Uncharacterized protein	0.945	55-98	KVKKATIKRGVNAKKQKKLARALMIADKEEKRIEVAQSKAEKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JA34	AAA domain-containing protein	0.841	819-825	GKKKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCZ1	BTB domain-containing protein	0.927	875-891	SPPPKQPQQAKEKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK30	Polynucleotide adenylyltransferase	0.833	577-589	NHHPKEDKKPRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK30	Polynucleotide adenylyltransferase	0.799	715-725	KQKKKNIKPRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK30	Polynucleotide adenylyltransferase	0.751	552-567	GTKKAGGNSHRRKNQG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW18	KRR-R motif-containing protein 1	0.949	233-250	FKKRNVKSKKKVIEKPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW18	KRR-R motif-containing protein 1	0.606	282-282	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KDI1	SET domain-containing protein	0.672	251-256	KKARRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX06	Uncharacterized protein	0.988	997-1023	VKAKLSKKKKKTRNEIKMQEERRRARH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZK5	Uncharacterized protein	0.874	116-129	LKRRRKYLKKALRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J617	NCD2 domain-containing protein	0.851	271-289	KLKAQERKHQWYKRRKMKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIA7	WW domain-containing protein	0.989	427-482	TWSRSRSRSRSHSHSRSRSPSRSRSHSRSRLRTRSRSRSRSPSGQTRRHRRSVSST
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIA7	WW domain-containing protein	0.856	379-395	RKKPRRLISPTIPKRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K836	Uncharacterized protein	0.93	377-397	HKRNLRKREKEHPESKSSKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IWW5	Uncharacterized protein	0.966	49-59	LRKKKSKRRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5F4	Uncharacterized protein	0.876	157-165	VKKKKKTKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6I5	Cnd3 domain-containing protein	0.916	58-67	AKSKARKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6I5	Cnd3 domain-containing protein	0.639	985-992	GKPRVLRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC48	Uncharacterized protein	0.685	165-170	KKPKKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDH8	Uncharacterized protein (Fragment)	0.819	26-39	RRQWKLSKLRKKRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JED4	BZIP domain-containing protein	0.852	88-112	PKKQRKKLLEKNREAAYRCRQKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFN0	Uncharacterized protein	0.91	433-449	GKPHNKKKGSNKKLQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL18	Uncharacterized protein	0.999	219-239	KKKVKKEKKVKKEKKIKKEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNP2	Uncharacterized protein	0.994	184-263	KAKTTSKAKTTKTKTTKTKNTKTKTSKSKKTKTTKTKKIHTTKNKKTHTKGPWWKTTKKAHTKKTKNTRSHRSHGDEKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPD2	Uncharacterized protein	0.996	128-191	RKKIEQSIKRTDEMEKRRKEKEKKAKAEAKEELKMQKLQEKDAKKRQSRFSKYGEKLKKLVKER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPD2	Uncharacterized protein	0.977	83-102	RVKKVGKKRGEKLRRKEEMR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWA7	Uncharacterized protein	0.881	159-205	GKAKKESSRREEVAKQKEKLEKEEAERLAREEKEREEIRKENERKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWA7	Uncharacterized protein	0.818	38-47	AKRRRAGRRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8I0	Uncharacterized protein	0.663	13-16	KKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGJ4	Cir_N domain-containing protein	0.996	163-199	KLKELKKKEKKDKKKKSSSSSSDHKHRHHHHSHREER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGJ4	Cir_N domain-containing protein	0.978	225-249	SRDDRRDRSRERSSRRRSASPRRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J777	Uncharacterized protein	0.717	337-342	RKHKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCV8	Trimethylguanosine synthase	0.753	478-487	RKTKRQKTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGC5	Uncharacterized protein	0.862	208-230	HHRTREMMTKIKRRIIKISRHRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHQ4	Uncharacterized protein	0.77	87-95	NKRRVRKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM71	C2H2-type domain-containing protein	0.778	8-14	KRRKKKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMP7	RING-type E3 ubiquitin transferase	0.804	501-507	PRKKRKQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN74	ATP-dependent DNA helicase CHL1	0.723	131-138	RGKKRFKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNL0	B30.2/SPRY domain-containing protein	0.868	854-867	RFRHRRHRRHGNKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT71	Uncharacterized protein	0.612	41-42	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUA8	Chromo domain-containing protein	0.965	1172-1209	SKKGKRNILPKSSNQRKIESRQEKSVRRKARIAAVSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K2Y8	Atypical/HISK protein kinase	0.884	780-786	KRKKRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4T1	Uncharacterized protein	0.615	72-74	KKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEV2	HECT-type E3 ubiquitin transferase	0.954	2546-2581	TRAEEEKKRQEQRRKEEEERRKAEEEKWRLAKEARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEV2	HECT-type E3 ubiquitin transferase	0.921	2774-2793	RPAPAEDDAKTPKKKAKARR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KEV2	HECT-type E3 ubiquitin transferase	0.636	2940-2944	RKGKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIP0	SANT domain-containing protein	0.996	322-358	RQKKKFKPLKPKGKNKEKDASLAKSKSKTANKGSKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIP0	SANT domain-containing protein	0.956	11-30	KNKKGFAPKLSKRKDRKDRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIP0	SANT domain-containing protein	0.856	500-519	RIAKEKRDAAKAKEEERRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KIP0	SANT domain-containing protein	0.827	405-415	KTRKKKRTGYR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1T2	Zds_C domain-containing protein	0.864	239-258	KKKPTSKPKEQAKKIPNLPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2C2	ATP-dependent RNA helicase HAS1	0.971	9-27	KKRKRSHADKRANKKKQEI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3B1	Ribosomal protein L19	0.939	175-196	LRAKNKALRERRANKKAEKLEA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3B1	Ribosomal protein L19	0.913	78-103	ERAAAKRNGRHMGHGKRKGTADARMR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3B1	Ribosomal protein L19	0.729	154-167	HIHKAKAEKVRAKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3B1	Ribosomal protein L19	0.614	147-149	NKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4R0	Uncharacterized protein	0.869	173-189	REKKLARERKREERELK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6K5	Uncharacterized protein	0.999	214-293	SRRRRSRSPQSRSPRRSRSPPRRGRSDRRSRSPRRSPSPRRRSPSRSRSPSRRRRSDSRERSASPTQRRRSVSPADRRRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6S9	Lysine--tRNA ligase	0.963	25-53	FKRREKVRAKEAAKAAKAAAAPPKEAKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8V8	SWIB domain-containing protein	0.657	49-52	KKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCD6	Uncharacterized protein	0.999	51-77	HKKVDKKSKKKKSRKHKGKGKDKHYKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCP7	Nucleolar protein 16	0.612	23-25	RHR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCP7	Nucleolar protein 16	0.604	18-19	RR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKS5	Uncharacterized protein	0.993	7-32	KEHVKKERKHSSHDKRRKSKHTKKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKS5	Uncharacterized protein	0.867	117-133	KRQAHKEKKRQEREKIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMG9	Uncharacterized protein	0.648	108-115	KKQRQLKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS25	zf-LYAR domain-containing protein	0.841	97-117	KKRKAESSKDEEEKPKSKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JS25	zf-LYAR domain-containing protein	0.82	156-180	VRKKTIELIEKHPKYKKSGKSDLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTT0	Uncharacterized protein	0.789	2984-2993	SKLKKSKKGS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K6S2	HSF_DOMAIN domain-containing protein	0.87	156-170	LIRRKTPRYSRRKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K782	Uncharacterized protein	0.919	280-289	PKKKRGRKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K782	Uncharacterized protein	0.691	177-182	KRKRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K782	Uncharacterized protein	0.61	311-312	KK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KA55	Serine/threonine protein kinase	0.978	1385-1407	KKKPRRKANNTGSKGRGRPKIIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGN5	CAMK/CAMKL/MARK protein kinase	0.683	49-58	KLRKPPSPPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYT0	Endopeptidase S2P	0.862	30-39	RKKKEPPRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6M4	Fork-head domain-containing protein	0.675	277-281	LKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J7S7	Uncharacterized protein	0.837	132-141	KKKEKKPAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAT5	Uncharacterized protein	0.993	159-178	RAGKRSHKRHSKKHSKRPRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBR3	Uncharacterized protein	0.857	606-627	AATPAVKEKEKKEEKEDKSKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JD58	Nascent polypeptide-associated complex subunit beta	0.819	17-28	GKGTPRRKVKKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDX1	Tr-type G domain-containing protein	0.94	132-183	NKFSKPPLKKTETQAQKRERKKREEELAALAKEEEKERQQIALRKAKQKAKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDX1	Tr-type G domain-containing protein	0.671	72-79	KKPGKGLA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHF0	Uncharacterized protein	0.845	135-147	PPPRPRRRSPPSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHN7	Pescadillo homolog	0.981	498-513	KAKLEKKKKALKSAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHN7	Pescadillo homolog	0.722	47-53	PKNKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI25	Uncharacterized protein	0.846	1188-1215	RGGRKADRSKSVYHSKNTVRKRKSSARK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJR8	Uncharacterized protein	0.812	566-575	KKRKAQPKRL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM67	Uncharacterized protein	0.996	350-367	HKKDKKDKKEKKKSKKHG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM67	Uncharacterized protein	0.883	385-397	RKGKKHDKHHKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM67	Uncharacterized protein	0.675	282-290	KKKEEEEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQP9	Tubulin-folding cofactor C	0.78	95-104	KFSFKSRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRI5	J domain-containing protein	0.772	161-175	RRRQRVEKAAHRRRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUD7	BZIP domain-containing protein	0.984	45-65	SKTSSAKGPIKKAKKPGRKPL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUD7	BZIP domain-containing protein	0.759	75-87	PKLKRKAQNRAAQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUD7	BZIP domain-containing protein	0.608	34-35	RK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUY8	Uncharacterized protein	0.647	877-883	RRGSKTR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVA7	Phosphatidylinositol 4-kinase	0.843	721-730	GKQRKKKSKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWC2	30S ribosomal protein S27Ae	0.984	76-99	GGKKRKKKTYTTPKKIKHKRTKVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXG3	Uncharacterized protein	0.995	49-82	GKEKEGVAKSEEPPVAKVPAKRKPRAKPKPKTPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZX9	Uncharacterized protein	0.631	196-201	IKGPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0M0	Uncharacterized protein	0.64	92-95	RRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0Q7	50S ribosomal protein L35e	0.81	100-128	VKKTRAMRRALTPFEKSKKTVREQKKLAH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5L4	DUF4211 domain-containing protein	0.634	150-155	KRLKDR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5L4	DUF4211 domain-containing protein	0.602	140-140	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKZ3	AAA domain-containing protein	0.922	211-227	KKIEKEIEESRRKKKKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKZ3	AAA domain-containing protein	0.739	805-813	RNKGNKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KKZ3	AAA domain-containing protein	0.624	184-188	KKSRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYU7	Stress response protein NST1	0.999	449-613	EREAKKQKEREKKKDKKRQMKQQQEAERLAREAKKKAEEEAAKREKQKKLEMERQKREQERLRKEEEKRQKEEERLRKEEEKKRRIREEKERAAEKERKRKEKEEKERAEKEKIEKAKAEKEEKERLEREKAQKAKAEKEDRDRLEREKAQKIKAEKEERDRLKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IYU7	Stress response protein NST1	0.992	38-50	KKKKKHKKKSKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEC5	FHA domain-containing protein	0.977	287-316	PAEKKLTKKEIRKALKREDKKKALILQEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JET1	NUFIP1 domain-containing protein	0.973	819-883	KRQPSNSPRRSRSRSHSPSRRPYRRARSRSCSYSRSRSRSRSRSRSSDRSYYRSKSPPRRRRRLS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG97	Uncharacterized protein	0.907	780-798	KRKTETKASTGKKRLKKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG97	Uncharacterized protein	0.883	567-583	PPSPKKKKEAAPTKSSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG97	Uncharacterized protein	0.826	729-737	IRPKRRIRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JPS4	Uncharacterized protein	0.848	819-828	SKKKPKVPKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUK2	Uncharacterized protein	0.997	529-552	GRGRGRGRGRGRRRGGGRGPGRPS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUK2	Uncharacterized protein	0.986	1299-1312	QKRKRKHANSKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUK2	Uncharacterized protein	0.944	867-918	KEAEHQRAIRARVEGRAKARALREENKRKGILPAVNPVEEKIKSKTLRKLRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K0Q2	Uncharacterized protein	0.72	245-254	PKKTPRSRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KA26	Uncharacterized protein	0.999	189-230	KKAESHKPQPKKRKVKGVNPLAMKKKKKKTPPPPKKKTESAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBZ0	Uncharacterized protein	0.961	46-61	AKKNNRRRNHRGKKKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBZ0	Uncharacterized protein	0.759	97-105	RKRNNRKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2ITS1	Uncharacterized protein (Fragment)	0.672	27-31	KKRKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IU31	NARG2_C domain-containing protein	0.74	285-291	RKRKPKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVF3	SNF2_N domain-containing protein	0.964	246-272	KRKRSTSKPARNRSRPRMRLPYAKRMK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXY4	Uncharacterized protein	0.945	341-351	PKRKSEKKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IXY4	Uncharacterized protein	0.637	75-80	KEKREK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J000	Homeobox domain-containing protein	0.898	318-324	SHKKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J000	Homeobox domain-containing protein	0.733	219-232	RKTNAGNRLKKSRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J2F9	Uncharacterized protein	0.996	35-54	SPKSKSKKRTHKKRKSKPSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J628	J domain-containing protein	0.632	455-458	RRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JF62	50S ribosomal protein L35e	0.81	87-115	VKKTRAMRRALTPFEKSKKTVREQKKLAH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB9	RNA cytidine acetyltransferase	0.976	1039-1071	SKKRKAESAKQMSEKERNRNNGKVKLSKKAKRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHB9	RNA cytidine acetyltransferase	0.769	69-81	RKKRENKIKNDIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHV7	PLD phosphodiesterase domain-containing protein	0.908	184-206	KPRPSRKSGSDTTPTKKAPRKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKI5	PWWP domain-containing protein	0.971	149-160	KPKRKDRKKPRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMI2	Uncharacterized protein	0.737	298-304	SGKKRKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN05	Kri1_C domain-containing protein	0.998	504-594	PERKKAKDENVFQKNQKMKKKLLAKHVKAVAKKLEKEQKKLAKKEAKLHKSSSKKHKRARDDDAEESQKKHKKAKIESSEESHKKHKKSKH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN05	Kri1_C domain-containing protein	0.995	297-324	RRKESKRAKRRAREKAHKQALKEQKMEE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JN05	Kri1_C domain-containing protein	0.601	326-326	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNN6	CHZ domain-containing protein	0.956	83-106	KPKKSASRGSSSSSKKPKQKSRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNN6	CHZ domain-containing protein	0.898	27-50	KPQRKLLKKKSNNVASKKKQQKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5M5	Uncharacterized protein	0.969	109-127	KKKTSSSKKNQKKRKRNHA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVX5	MI domain-containing protein	0.994	610-641	RSRSRSRSRYSRHSRRSPRSRRSPHDSKRRRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IX84	SAP30_Sin3_bdg domain-containing protein	0.606	29-29	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8Y5	TPR_REGION domain-containing protein	0.733	582-589	KANRRKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9D4	40S ribosomal protein S24	0.999	88-130	PKHRLVRIGLAEAPKGGRKQRKEKKNREKKFRGVRKSKKPRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJX2	Uncharacterized protein	0.666	558-563	LKQKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJX2	Uncharacterized protein	0.661	597-602	MKSKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKA5	DUF2040 domain-containing protein	0.859	97-111	KKKKEAVKPSSKKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKT2	Uncharacterized protein	0.604	538-539	RR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNV3	Uncharacterized protein	0.624	155-157	KKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQT8	Uncharacterized protein	0.731	161-171	KKKKLLEEKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRE2	Usp domain-containing protein	0.9	384-393	RRQKKKKRVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRW7	Uncharacterized protein	0.994	176-212	TKPTKSDKKHHKTKVNKTNKKTKASHKKAKKHCKKHP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRW7	Uncharacterized protein	0.725	145-161	TKSEKPTTRSEKKHHHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRW7	Uncharacterized protein	0.705	135-143	EKKHRKFTE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSW5	Uncharacterized protein	0.934	305-317	KSKKKKEKPEKKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVP2	50S ribosomal protein L35e	0.81	88-116	VKKTRAMRRALTPFEKSKKTVREQKKLAH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXH8	Uncharacterized protein	0.912	53-76	EPLKPLRKLTKSEARKKNRIPLRV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXH8	Uncharacterized protein	0.753	243-264	KRNQKPITQKKPQETARNKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K269	SET domain-containing protein	0.977	72-111	KRKRPKLSKRITISKKKFRKLDAAEETLPKDSKKKRIVKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K269	SET domain-containing protein	0.842	499-513	RVRKKKSSNRHHHHH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3Y2	Uncharacterized protein	0.995	484-534	RSKAETKEEKRARKQAIKDAKKNRREEKKSTKSAFKTEENRQKKILQQKRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KA68	RGS domain-containing protein	0.968	337-357	PSKKLTKRRLSQKRRKSERRI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IV02	Adenosinetriphosphatase	0.996	96-164	VKSKGKPGPRPKAKPGPKSSATTSTAPTSKSKPGTKPRAKPGPKPAAKLVDAKPRGKPGPKPKSRVKQP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IV02	Adenosinetriphosphatase	0.859	174-185	RHKRKRPEPVRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JI26	Brix domain-containing protein	0.985	12-53	KNKHKRENLYQKQRLEKQKAKSAKRKQLAKAEEKNPELKKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIT3	Uncharacterized protein	0.692	710-717	FHKKDKKL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL33	SAP domain-containing protein	0.91	276-291	RHRLYDRKPSSGRKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JL33	SAP domain-containing protein	0.719	38-49	ELKQRYRKALKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLD8	MADS-box transcription factor, other eukaryote	0.844	31-43	PSRRSGRRKIKIE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLD8	MADS-box transcription factor, other eukaryote	0.672	47-60	DKNRRHITFSKRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGH0	Uncharacterized protein	0.833	271-282	RKARKTPSKKKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IVL4	Uncharacterized protein	0.931	153-167	GKKRKKKLAAAPSPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZC3	Uncharacterized protein	0.604	341-341	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J240	Uncharacterized protein	0.995	50-69	KRKSHSKSKKKSKSKSKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4Z4	Uncharacterized protein	0.965	101-194	GGRDSGRGGRGGRGGSRGGFGRDRSPRRDGGRGNDRDRSLWFRDNRGYERRRDDRDDRGGRDRSPRRNDYRERNDRGYERRGGNDRRDDRGDRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9E6	FHA domain-containing protein	0.997	13-86	RSISPSERHERNRRYSRSRSPPRRRNHRSRSRSYSRSRSPPRRRQSRSPPPSRRREDNNREDRRQRNAERGGKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFK6	tRNA (guanine(9)-N1)-methyltransferase	0.948	48-81	ERKSTLREKVRVKRLEKRRQMREGIIERPPTKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT73	G-patch domain-containing protein	0.782	217-227	KEQTHRKRKPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT73	G-patch domain-containing protein	0.666	202-209	GRRRNAWK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JUG2	Translation initiation factor 1A	0.908	4-16	NKGKGGKSRRRGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JVU7	Cation_ATPase_N domain-containing protein	0.911	47-64	PSISAPKRPEKKSKAEKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K039	Uncharacterized protein	0.719	8-14	KKSKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7V7	Elongation factor 3	0.998	1021-1044	EKKKKLSSKELRKKKKDRMERRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IZN9	Adenosinetriphosphatase	0.946	68-88	PKSKKRSKAAKDSGSAPKRPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5A2	Uncharacterized protein	0.614	322-324	RKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J790	J domain-containing protein	0.758	179-204	AHKKRMDAEKKEEAAFLRRQKDDKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J790	J domain-containing protein	0.602	242-242	K
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAD4	20S-pre-rRNA D-site endonuclease NOB1	0.949	436-452	RKNPNASKKRVGKKKRT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAD4	20S-pre-rRNA D-site endonuclease NOB1	0.666	181-199	AKKYNHTPKKILPVVKKEE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAY0	Uncharacterized protein	0.678	370-376	KGKGKQK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JAY0	Uncharacterized protein	0.652	56-65	KKACRGRPPK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JC30	Methyltransf_25 domain-containing protein	0.654	477-480	RKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG37	Uncharacterized protein	0.999	73-104	KKKISTSGPRSNRHARKLKEKKKKGKKSAIKF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ92	Uncharacterized protein	0.801	35-53	RAARRAAQKKENKESKAAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQN5	BHLH domain-containing protein	0.729	234-240	AERKRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ54	Uncharacterized protein	0.992	975-1004	RKKKKIDFKALMKKGRRGKATKHRDRIAAA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZ54	Uncharacterized protein	0.702	1037-1050	RKAKEKDAERRSRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8V2	PHD-type domain-containing protein	0.779	8-20	SKNNAKPKPRQKS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8V2	PHD-type domain-containing protein	0.745	228-236	DRKRPGRPP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB85	PH domain-containing protein	0.707	152-160	PKQKKSKPF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGH8	DNA topoisomerase 2	0.988	43-75	AKKRKTAAPKGKTKAATPAIKKTPIKRTTKKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGH8	DNA topoisomerase 2	0.959	1341-1353	RTKKRKRVVKKKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KGH8	DNA topoisomerase 2	0.95	137-157	PKPKAARKKAATPKATSKKSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KHU1	Uncharacterized protein	0.847	24-51	PEKSSKKTKSSSSRKPVSSKKVEHQLKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KHU1	Uncharacterized protein	0.825	254-267	IKSKIRKALKKSIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KHU1	Uncharacterized protein	0.749	55-78	DKVQKKKTRSSDAISGSKKTSLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KHU1	Uncharacterized protein	0.733	136-146	KKKSTSKKLKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5L4	OTU domain-containing protein	0.921	41-55	LRKGVPKSDKRKKRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5L4	OTU domain-containing protein	0.796	127-140	KKKVNKAKLRIEKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J6K6	Polyadenylate tail-binding protein	0.855	519-545	KKENRGVEIKARAFVPSPPKSPLKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J753	NDC10_II domain-containing protein	0.761	376-383	KPRPKKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8C9	Uncharacterized protein	0.973	823-840	RKKVVQKKKKKTKSSGFK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J948	Mitochondrial distribution and morphology protein 34	0.661	484-490	KKVPKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDV6	Uncharacterized protein	0.807	363-371	KKRKALKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JE15	Uncharacterized protein	0.757	344-354	QKQKANLKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNK6	U1-type domain-containing protein	0.996	175-193	RQKRREKKKQKKDHKKKPA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNK6	U1-type domain-containing protein	0.891	26-56	KAKARENRDRLAEKNDERKKLGLPPLKPKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSD6	Uncharacterized protein	0.99	14-112	SPRPSRRGRSYSPRSTRSSSSRSYSRSRSRSRSYSRRHRSRSRSRSPYGRSSSRSYRHYYSRSPPPPPHHHHHRRSPPPPPPPRGRYRSRSPPPLRRRP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K3Y8	50S ribosomal protein L5e	0.915	261-286	EKKGKPAKPYRRLVALNKKQRLNKIK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8G2	HMG box domain-containing protein	0.816	111-121	KPPKKKKDPNA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9J9	Uncharacterized protein	0.603	417-418	KR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9S9	Uncharacterized protein	0.903	404-431	KKEKRKQKLMKASYDARQRAKKAKEEAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K9S9	Uncharacterized protein	0.789	500-507	PKSKRRRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KB27	RRM domain-containing protein	0.969	7-61	TKKDTKAPAKKAPVKKTEKASPAQKETESSKRKRVSFQEASNKKKAVGNKAKKVA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J4Z8	SRR1 domain-containing protein	0.68	25-30	KKKSKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBQ2	Uncharacterized protein	0.698	174-180	RKRKTLK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDI3	Rab-GAP TBC domain-containing protein	0.912	24-45	AKKLEAKKQRESNRKREEKDKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JEQ7	Velvet domain-containing protein	0.786	189-200	PVRREKAKKQNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFF3	IPPc domain-containing protein	0.671	250-260	KKPPPPPPPSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG18	THO complex subunit 2	0.962	1619-1682	DRDRERDKRRDIRDDRVRVERRPDDRRGGDDRRRDDRRVDDRRLDDRRVDDRRERERHDRRRRH
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JG18	THO complex subunit 2	0.615	1416-1418	RKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JGI9	Nop domain-containing protein	0.999	461-500	PKKAKKSKKEGKEKKEKSEKKEKKEKKEKKEKKKSKKEKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKY4	Uncharacterized protein	0.799	646-655	KKTQKKKAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMN9	DNA-(apurinic or apyrimidinic site) lyase	0.76	291-301	KTKSKKVVKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JNK8	C3H1-type domain-containing protein	0.772	238-250	RGELPANKKRKFN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRY9	Aa_trans domain-containing protein	0.915	172-186	KRKRRHSAKQQKKSE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSF9	J domain-containing protein	0.973	192-208	FQKKGGKKVKKIRKSGL
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JSF9	J domain-containing protein	0.777	142-173	RKRRQMKKEMEAEGAEKRKAEQMVNERKRKAE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JTU0	Uncharacterized protein	0.916	134-148	KRRRKYLRKALKKSI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JZT5	MFS domain-containing protein	0.703	73-80	KKRLKKEK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K020	Uncharacterized protein	0.939	929-946	ASQERRSHPRRRRSRGSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K020	Uncharacterized protein	0.895	1011-1024	PPTKPRRKQHRHKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K020	Uncharacterized protein	0.823	1130-1139	KKPTKPKKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K763	Uncharacterized protein	0.923	266-276	APKKKKRGTKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7P2	Uncharacterized protein	0.992	250-262	SRPKRKRGPKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K7R9	Uncharacterized protein	0.969	2-20	KKTKKSKRLNRKKSKSTDK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBR5	1-phosphatidylinositol-4-phosphate 5-kinase	0.681	428-439	RQRKLKLGPQKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUW3	Uncharacterized protein	0.968	212-261	GKSKKKSKSNKNYPSIKKGKKTNIKYASIGKGSIARKQVQHDKMPRQKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUW3	Uncharacterized protein	0.895	92-102	SRKKPRFKKKV
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2IUW3	Uncharacterized protein	0.671	68-72	KAKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J3R9	40S ribosomal protein S30	0.981	20-37	KVAKQEKKKPKTGRAKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JA63	KH domain-containing protein	0.717	115-120	NKRKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDW1	Uncharacterized protein	0.916	910-916	KKKKKRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDW1	Uncharacterized protein	0.866	466-481	RRGKSASRKKVKTGRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHX0	Transcriptional activator HAP2	0.957	231-256	KKGGKGRWHKGGDHDKKGGKGRWHKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHX0	Transcriptional activator HAP2	0.889	481-519	KRRAARLKLEEQYKTSRARKPYLHESRHKHAMRRPRGPG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIT2	GRIP domain-containing protein	0.62	137-139	KKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JWE9	PH domain-containing protein	0.633	269-272	RKRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K225	Uncharacterized protein	0.705	63-74	NKKWPKSIRLKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KBJ6	Non-specific serine/threonine protein kinase	0.74	2713-2727	KKKNTKEEKYKPRRF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KC90	Uncharacterized protein	0.973	472-490	KDRTRESRRKRRGVRNRKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KC90	Uncharacterized protein	0.625	213-215	KRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KFP6	Lipase_3 domain-containing protein	0.69	580-587	KKKKASNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5T0	DNA topoisomerase	0.991	817-842	RKNVRARFGGRRRGRGGKKFDPKLRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBG3	E2F_TDP domain-containing protein	0.749	167-175	KKKIDKRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCI6	SPX domain-containing protein	0.617	28-31	KLRK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDR3	C2H2-type domain-containing protein	0.855	316-327	RKHMRKKKHFKI
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDR3	C2H2-type domain-containing protein	0.69	44-50	RRKSRHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JKY1	Diadenosine tetraphosphate synthetase	0.951	144-152	VDKKKKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JU16	Uncharacterized protein	0.679	178-183	KRKQKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K489	SWIB domain-containing protein	0.658	27-30	KKKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KI77	50S ribosomal protein L24e	0.872	41-58	KMKRNPRKVRWTKAFRKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KK53	Uncharacterized protein	0.694	450-456	KKKSAKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J140	Zn(2)-C6 fungal-type domain-containing protein	0.968	99-115	RKKRQKGMKRGPYKRKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J1K9	DPBB_1 domain-containing protein	0.999	64-186	GHKDKHVKAAAKKKHGKKRHTTTKKVSALSKKKKKTSSKKKSLTKKSTTKKKSSSHKKLTTHKKKKTTPKKKTTTKKKTTTKKKTTTKKKTTTKKKTTTKKKTTTKKKTTTKKKTTKKTITKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J8Q0	Amino_oxidase domain-containing protein	0.701	143-156	KKVSKRAHASSKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JBL5	Uncharacterized protein	0.888	487-509	KKSGKKEKLRSSLKSAFGKMKKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH61	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.988	722-740	NKKVKAKRSKKSSERRKRA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JH61	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.981	446-459	KKKKSAAKKDKKKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ04	Ubiquitinyl hydrolase 1	0.884	364-395	DKHRPKTKTEKKLEQQQHKLKKQAKAAEAKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JLB5	Uncharacterized protein	0.742	521-530	KHKAQKKGRS
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JM23	Uncharacterized protein	0.779	90-101	LIHKVKRKGPSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JQA6	Nucleolar complex-associated protein 3	0.828	335-352	KKRKNNNKPFLTKKARKT
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JT65	Replication termination factor 2	0.997	190-231	EEKKAKAKAERKAKKAENKKNGVVSEKKRKRDDSNSPDKPAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1Q6	Uncharacterized protein	0.637	545-554	KNSRHREQKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K1Q6	Uncharacterized protein	0.626	409-412	FRKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K574	Plasma membrane ATPase	0.898	867-882	RGRKAKLAHRKEAKAK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K5G7	40S ribosomal protein S15	0.979	60-90	ARRRFQRGLKRKPMGLIKKLRAAKKNAAPGE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K8Q0	Ubiquitin-like modifier HUB1	0.998	10-97	EKSESKKESRKEESKKDRSRSRSHSRSRSPRNRRDRSPPRRHERRYSRSPPSSRNSSSRRSRSPPRHRRDRSPDYDRHRSSRYRSRSR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCW3	Uncharacterized protein	0.989	510-523	MKASKKKKKDKKKG
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCW3	Uncharacterized protein	0.858	404-416	KHVKKGRKPLPKP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCW3	Uncharacterized protein	0.771	1045-1058	LAKLKRNAERRRQR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JCW3	Uncharacterized protein	0.628	1038-1040	KKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JDC2	Ubiquitin-like domain-containing protein	0.983	75-98	GGKKRKKKTYTTPKKIKHKRTKVK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JFY6	Uncharacterized protein	0.957	148-175	KRPAMRNNRKVFRPSRGPRRMKNRHYKR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JHW1	Uncharacterized protein	0.936	520-555	RSSSRGGKFRGGGSSGGGRGRGVGGGYRGRGRGRGR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JIV9	Uncharacterized protein	0.989	43-71	KKKKELDGNKRKKRIEERDRQKGLPKAKN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JJ23	Uncharacterized protein	0.744	362-368	KRRKSKD
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JK04	Uncharacterized protein	0.927	610-623	KKKKKEERELRKRQ
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JMZ2	Uncharacterized protein	0.765	27-33	AKKRRRE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRQ1	Cation_ATPase_C domain-containing protein	0.94	67-77	KSKSKKSRRKK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRQ1	Cation_ATPase_C domain-containing protein	0.833	250-263	PRRRHHKHHHRNGK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JRQ1	Cation_ATPase_C domain-containing protein	0.682	322-332	RRRSIPRRLHK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JXI2	Actin cytoskeleton-regulatory complex protein SLA1	0.762	412-419	EKERKRKE
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K472	Uncharacterized protein	0.999	91-144	KRTSRHSTNKSSKHSKRRSSKKHSTKKHSTKKSSKKRSSTKKSAKKSSSKKSSK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4P5	Uncharacterized protein	0.998	272-287	KKPKSKKKKKMRRKNK
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4P5	Uncharacterized protein	0.959	517-553	RKKERLRELEEKREKERRRGYDRRSNSDRQREMERER
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4P5	Uncharacterized protein	0.829	55-72	KEEEIRKNIEKSKNRKRN
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2K4P5	Uncharacterized protein	0.787	99-111	KKSRKREKDLAAR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KD64	HMG box domain-containing protein	0.84	110-128	GPRKNASATPRKKRDPNAP
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2KJ27	Uncharacterized protein	0.946	71-100	RKRRHGFLARLATKNGRRVIVRRRMKGRKF
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J5N7	Uncharacterized protein	0.893	263-276	KKQAKKRIEKNKKA
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2J9K4	HMG box domain-containing protein	0.848	175-185	PVGRPRKRHRR
UP000014254	Mucor circinelloides f. circinelloides (strain 1006PhL)	S2JW41	MADS-box domain-containing protein	0.877	27-56	PAKRNGRRKIKIEYIEDKNRRHITFSKRKA