ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IEB7	Citrinin biosynthesis transcriptional activator ctnR	0.674	57-71	RRPGPLPGTKRGSQR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRN7	Uncharacterized protein	0.904	199-235	RKRAPERRAQKRVWQNERVQRAPVKGVGRRRKWDEQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRN7	Uncharacterized protein	0.8	149-164	RRRMQPRRPRMSERRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYC2	L-arabinose-responsive transcription regulator ARA1	0.713	53-58	KKRKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1G3	Uncharacterized protein	0.985	76-96	PSSRRRPKRPDPARAKGKGRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J742	Midasin	0.73	601-611	RKRKDRVNKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JF56	Exocyst complex component EXO84	0.691	15-21	GNKRKGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ96	Uncharacterized protein	0.9	68-95	RRKKSTAVSIKPTTKPKTPRPAKQPKHK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JNW6	Uncharacterized protein	0.902	408-436	KKSLDRVKAIKALPPPADGKPKPAPKPAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPT6	Uncharacterized protein	0.925	32-68	KPPKAPKVLKPAKVSKKSQPSQAKNAGKGSNAKAAVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPT6	Uncharacterized protein	0.72	305-312	KKPRGRQR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSR8	Checkpoint serine/threonine-protein kinase bub1	0.901	111-120	KPKGKSKKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJY5	Exosome complex protein	0.981	156-179	ASSSGPEKKQRNSRRKSSGKKNKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FK10	Uncharacterized protein	0.914	193-202	RQRRKKRRIR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3C9	Serine threonine-protein kinase cbk1	0.824	492-503	RKYGRKERKRPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G578	Aspercryptin biosynthesis cluster-specific transcription regulator atnN	0.623	29-32	KRAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GI37	Eukaryotic translation initiation factor 5	0.991	145-167	QPKKGKKDKAERKAARRAKANGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKX4	Uncharacterized protein	0.956	254-273	ERKKRKIEKDAEKEKRRALW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKX4	Uncharacterized protein	0.723	280-312	SKQKAEWKRQRQAEYKQKVEEKRQQRQVAKKEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKX4	Uncharacterized protein	0.671	492-498	RLKRRPE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILE7	AMP deaminase	0.627	341-343	KKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUZ9	Poly(A) RNA polymerase cid13	0.751	1084-1092	KATKGRKKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV27	Transposon Tf2-6 polyprotein	0.987	637-656	PKPRRSGPKKVKKVEKAKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV27	Transposon Tf2-6 polyprotein	0.821	1829-1837	KRRGRGRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV27	Transposon Tf2-6 polyprotein	0.705	1886-1892	TRRRRGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDV0	Versiconal hemiacetal acetate reductase	0.764	21-38	RKKLQNKLNQRAYRRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ74	Putative mitochondrial chaperone BCS1-B	0.658	624-630	RKKDPRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQG1	External alternative NADH-ubiquinone oxidoreductase	0.613	65-68	RPGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8F5	Peroxisomal abc transporter	0.804	58-72	RRWWRRRREEREQGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GF19	Peroxin-1	0.646	258-263	RRRSAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF22	Putative transcriptional regulatory protein	0.725	26-34	KSKPKKTRN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXR6	Putative RNA-binding protein	0.996	21-95	AKKVTKAEKVEKTEPAPTKAKAEKAKAEKVEKVEKKATPKRKAPEEASPVAAKKQKPAKATPKTTPKSKKAAAKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXR6	Putative RNA-binding protein	0.989	378-393	KTKAKAKKGGRRKSKN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXR6	Putative RNA-binding protein	0.91	274-318	NKRFKKIPWNKMAANEVAKKRTESTWAQKVSREEKKREERAKKLK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6K7	NuA3 HAT complex component NTO1	0.923	6-22	STPRRPPTGRKRGRPPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6K7	NuA3 HAT complex component NTO1	0.913	1201-1218	KSNSKVRKRTSARSSRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JF05	Uncharacterized protein	0.971	641-656	RRKRLAKKKARQREMR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIF9	Beauvericin cluster-specific repressor BEA4	0.789	24-30	RKRRRRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLW2	Uncharacterized protein	0.933	259-274	REREERREERRGRRRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSI3	Transcription factor tau subunit sfc4	0.959	534-560	IKPRRKRDQRRRPTNNGVVRARYRPRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FHQ5	Uncharacterized protein	0.8	238-248	KKNRREKRAIK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXR4	Translocation protein SEC62	0.908	350-358	PKKGKKKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2C1	Uncharacterized protein	0.962	58-69	RRANKKKPKRRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9C1	DNA repair and recombination protein RAD26	0.968	292-304	GRKRRKGPSKKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9C1	DNA repair and recombination protein RAD26	0.879	336-345	KRRSRARRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9C1	DNA repair and recombination protein RAD26	0.804	251-258	RPRKKRKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF48	Uncharacterized protein	0.966	12-35	KKTNRRQRRATARAKQGTRRKKPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFU0	Uncharacterized protein	0.607	43-44	KR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IKV4	Uncharacterized protein	0.978	43-56	RRNRKRKRHREPKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IW64	Putative aspartic-type endopeptidase OPSB	0.747	415-421	RERRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Q2	Transcriptional regulator prz1	0.826	79-93	KRAEIKPNRPKRSAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4G5	Putative transcriptional regulatory protein	0.717	61-69	KRRSPKAKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8L6	Uncharacterized protein	0.99	188-260	ERRPKRGRPERSEEQPGRDSKRQSTDGRGRRGGRGNRHGRQGGGRQGGGGVEKQRSAAADPAEKARMEARAKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCM2	SAGA-associated factor 29	0.911	61-77	YKTKKKGIAKDKRPGPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGI9	Uncharacterized protein	0.96	157-180	ERRRRRRHSSSHRHSSRHESRRRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGI9	Uncharacterized protein	0.875	80-95	RSRHHRKHRSPARGPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK86	Chromo domain-containing protein 2	0.906	149-175	TKAKTTKKRGRPAASSTPPATTKKSRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBD9	54S ribosomal protein L25	0.974	113-157	KVKGKIHERMVMPRMEKRREAMLAMPKLIKEWKKVGKRNWKRFPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGS1	Multisynthetase complex auxiliary component p43	0.996	127-205	KAEKERLKKEKAAAAAAAGGKETALPDRTKEPKDKSAGEKVKEAVTEAKDKVKAAVGAGEGKPKKEKKAKEPKPQKAPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FY30	U3 small nucleolar RNA-associated protein 11	0.91	246-261	GVTKKGKKIMVRTRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ75	SLD3 domain-containing protein	0.947	314-327	GKSKKRRTKKMKLG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ75	SLD3 domain-containing protein	0.903	507-538	PPKPKTKPSSSKSDAKPGAAAKRPTLKAASKN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INA1	Uncharacterized protein	0.616	358-363	RPHARP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITF6	Uncharacterized protein	0.662	205-210	RRRERR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXX6	Protein MGA2	0.928	459-470	ERKRAARKKIKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBI5	54S ribosomal protein L20	0.757	191-205	GKIRTKAREDRSRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIW9	ATP-dependent DNA helicase MPH1	0.998	955-975	PRRRPKPAAKKRGKKATKKTR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIW9	ATP-dependent DNA helicase MPH1	0.99	732-747	PKKRRQPAKKKPPKKF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIW9	ATP-dependent DNA helicase MPH1	0.636	771-774	KRGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FH25	C6 transcription factor	0.886	29-38	PPRKRKREKH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GD44	54S ribosomal protein L35	0.96	409-449	KEPKKARGWEAKRQGPKYKHLWKYTKRIKGYSNAKGLIRKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GHY0	C-4 sterol methyl oxidase	0.961	290-306	HKKRRERKLKAIKAQKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJ18	Uncharacterized protein	0.991	292-304	PKKRRKRRSRAKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB60	Uncharacterized protein	0.622	19-23	RRHPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDB3	Uncharacterized protein	0.687	21-32	KKPFIRFTKRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDB3	Uncharacterized protein	0.664	85-92	KNKPSRAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEA7	Vacuolar amino acid transporter 3	0.92	347-359	RHKRRRRQRGGSG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FF70	54S ribosomal protein L4, mitochondrial	0.988	286-308	KKEKAEKKKPEGAKGAKKAAAKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FRA2	Methionyl-tRNA synthetase	0.998	606-641	KQKEEAAAKAAAKKAAKEADKARKKAKKEAEKAKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GA06	Ubiquitin carboxyl-terminal hydrolase	0.986	295-312	KKKQRRGPAKARKTKKQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCA7	Sodium p-type	0.669	252-260	NSRRRDVKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIU7	Asparagine-rich zinc finger protein AZF1	0.882	308-337	IKGHGKGRRVAYVSGKDDKVRKSRSARRPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INA3	Uncharacterized protein	0.656	449-453	GRKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPI2	DNA repair protein rhp54	0.677	88-91	RKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQF6	Uncharacterized protein	0.876	542-553	KRARKMRDRRRH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQF6	Uncharacterized protein	0.78	426-445	RDGRRHRSRSRSVVDSARKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQF6	Uncharacterized protein	0.777	514-523	RRRDRSRRRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQF6	Uncharacterized protein	0.727	259-275	RRGSPDSRGSRSKSRGP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQF6	Uncharacterized protein	0.66	368-376	GRSRSRSRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZ61	Uncharacterized protein	0.906	401-425	RQRRHSRREERERERERNPPPPRPE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0C1	Uncharacterized protein	0.956	741-770	KKSSPKPVTKPETKTPRGRGRPPRSANKIR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4I1	Receptor-type tyrosine-protein phosphatase O	0.631	64-70	RKSAFRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4I1	Receptor-type tyrosine-protein phosphatase O	0.625	72-79	HLRSSGKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR12	Uncharacterized protein	0.947	35-55	RAERRKRQNRLNVRAHRKKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBX7	Chaperone protein	0.989	262-400	QRAKEKQRKEAHQRAKEQQRREAEQRAEQKRKEAEQQAEEARRVERERKAEEMGVAEERREAEERRRAKEQRIAEEEKRKAEEAKRRAEEERRIAEEEQRIAEEKQRKAEEEQRKAEETKRKAQGKKRKAEDRLQEKQR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBX7	Chaperone protein	0.611	422-426	KERLR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FE86	DNA-directed RNA polymerase	0.863	493-503	SKSKSKSKRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FS74	Uncharacterized protein	0.997	127-148	QARKKCKRVRKPAKGKKGKKHN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCK5	Peptidyl-trna hydrolase domain-containing protein	0.873	158-187	KKKKHAEIAKSFNEGRLKQKKHLSSKKQNR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEG3	DDB1- and CUL4-associated factor 13	0.989	391-448	RRIKRHRHLPKVIKKAGEIKNVELKSIKRREENERRHTKKQFEKRRSEREKPILAREK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF87	Uncharacterized protein	0.631	257-265	RRERLDRGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQH8	Uncharacterized protein	0.919	693-714	SQKPGPRWKLGPRARKPASAAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQH8	Uncharacterized protein	0.84	9-37	RKRKRDESDDKKAATAAPSGSRRRVRARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITR8	RNA-binding protein with serine-rich domain 1-B	0.899	8-71	RSPGDRYRSRTRSPTPRSDRGRSASRSPVRRRDYDSRSPSRSQSPAPRRNGRYRSESRSRSRGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX12	Low affinity vacuolar monovalent cation/H(+) antiporter	0.694	106-115	KANNRSRKPP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXW7	Uncharacterized protein	0.846	179-198	RKRRSMGSDWLKRKDNKRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXW7	Uncharacterized protein	0.671	805-811	PRRQPKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J441	Multisubstrate pseudouridine synthase 7	0.944	182-206	SPPRGKGRGVRGGPQQKKKQEPKVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J603	Uncharacterized protein	0.998	200-222	AAKKIRKGKKKQSKKSNRKGGPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8J2	Solute carrier family 28 member 3	0.865	66-76	KKKKKFRISKF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JC92	Uncharacterized protein	0.988	739-770	RRNPMRSAKNKPPAAQPQKPPKKVRIKAPKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJB9	Uncharacterized protein	0.832	274-287	RTKASKGKRRADGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJB9	Uncharacterized protein	0.794	66-76	RARRRRERDRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJJ9	PHD domain-containing protein	0.78	356-365	GREKKQRRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJJ9	PHD domain-containing protein	0.708	485-495	GRSRGRSRHSA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6B3	Peptidase S41 family protein ustP	0.846	864-884	VKGSKAPAKNRIPKTGYKRPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAJ8	Uncharacterized protein	0.863	434-470	PRARKRRAAPEPADDQRTAHPKLTKSGAIDKRRTKRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GK72	Formin binding protein	0.979	570-645	KRLREKEEEADRDRRRRRGRDSSERDLYRERPRSRGERSHRSSGRATRRSRSPEPDAYEADRRKAIAERERNHRKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GK72	Formin binding protein	0.95	655-684	RDRRLSPPPRRERERERERDRDRERDRDRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GK72	Formin binding protein	0.913	743-773	DRRDSRDSKRVRRERTPRERTPQRDTRTKNR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GK72	Formin binding protein	0.826	372-382	KNKKFRKERKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GK72	Formin binding protein	0.64	734-737	RRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GK72	Formin binding protein	0.601	687-687	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQW7	Nucleolar GTP-binding protein 2	0.872	50-70	RGHKKMGTGKKEANRKVRQGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX47	Fusaridione A cluster transcription factor fsdR	0.644	61-65	RKPRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J5D8	Transcriptional activator protein UGA3	0.894	51-61	KQPRKRGRPRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0F6	Splicing factor spf30	0.959	219-252	KPPKAKKIKATKELEKGKSKWQEFNAKSKFGKQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3Z1	Cellular morphogenesis protein	0.608	12-13	RR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K2	rRNA-processing protein EFG1	0.923	37-64	RSRTGPVATKKKHKAKEGTPAWNRTRAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K2	rRNA-processing protein EFG1	0.641	120-128	KKAERLLKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K2	rRNA-processing protein EFG1	0.615	245-247	KKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K2	rRNA-processing protein EFG1	0.604	130-130	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCN8	GTP cyclohydrolase 1	0.986	41-94	SKRGKKDKSKRKREGDDAELNGNSKKHRRPSLSRPARDPRDTTSSSSKKVKKPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ38	37S ribosomal protein S9	0.96	308-330	ARRVERKKHGHLKARKSPTWVKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL49	Uncharacterized protein	0.689	615-619	RRRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J364	Uncharacterized protein	0.637	624-631	KPPPPRPV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGV7	Uncharacterized protein	0.978	629-651	KTRTRKHRTKSRKGPKPTGGAGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJP4	mRNA degradation protein pet127	0.866	163-171	PKKKGKSKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJP4	mRNA degradation protein pet127	0.738	896-904	RLKDRRRKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJP4	mRNA degradation protein pet127	0.639	95-100	RKGSKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMW2	Uncharacterized protein	0.953	3-33	KRGKRRDGQAPEAISPKPPSPRKKSAKMARE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMW2	Uncharacterized protein	0.921	84-134	VGITKKKAATTKKEPTVAQKAKSVAKSVSTKVSGATKAGKKETKPKTAKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQX6	Sterol uptake control protein 2	0.815	27-35	PKKRGRPRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GA69	Serine threonine protein kinase	0.987	351-371	ERKVRRRERKRREREAENRSL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDF2	Transcription factor IIIB 60 kDa subunit	0.995	581-600	RKKLEGQKEKPTRKRKKRPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGD2	Uncharacterized protein	0.872	6-13	RRRRRRRQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYI7	ABC1 family protein	0.862	402-426	ELRERPHREQLKPERGEWRGRRGRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYI7	ABC1 family protein	0.771	79-93	GAPKRARTYPKGRKW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0Z2	Transcriptional activator protein DAL81	0.679	110-114	RKRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4H4	Ribosomal RNA-processing protein 14	0.998	460-557	RRRAEGEKIRDDEGALKRAVKRKEQTKKKSEKAWKERSDGVAKAIREKQKKRDDNIKKRKDDKLAHKLGRKSGKKVGGGAKKARPGFEGSFGGGKKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4H4	Ribosomal RNA-processing protein 14	0.996	142-200	AKKEAKTQKRQDKKEKKAAKKAAKAEAAGEEPAEAAAESKPAEPAKAAKKAAPKKQQKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4H4	Ribosomal RNA-processing protein 14	0.944	317-360	RAARKADGADGKPIRTRAELIEARRTKQNQRKEHKKELRRQAKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4H4	Ribosomal RNA-processing protein 14	0.693	40-49	KKKQTKAEAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPJ5	Uncharacterized protein	0.962	26-42	FRKAKKKAKEEREVKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPJ5	Uncharacterized protein	0.715	326-333	RRRARARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FIN6	60S ribosomal protein L14-A	0.697	127-138	RLKKQRRFEQRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FYX8	3-amino-3-carboxypropyl transferase	0.876	111-126	KAKAPKGSKKGEKERR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G7H0	Transcription factor radR	0.796	60-70	QRNYRKKLKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAG5	Uncharacterized protein	0.67	312-317	RRRQKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IF32	Uncharacterized protein	0.854	108-116	RARKRKKVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFV5	Pogo transposable element with ZNF domain	0.722	307-313	KRRRAKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQE5	MICOS complex subunit MIC60	0.981	217-237	AVKEKPKPVEKKKKAPEPKPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J149	Bud site selection protein 6	0.69	173-185	KRKQQKLRQKGPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2B8	mRNA 3'-end-processing protein RNA14	0.634	91-97	PKSGKPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J626	Nitrogen assimilation transcription factor nit-4	0.615	30-34	RSARP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDH4	Uncharacterized protein	0.633	532-534	KKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKE8	Carboxypeptidase Y-like protein A	0.914	76-92	KNAIPSKPKPHRRKAEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2J3	Ankyrin repeat protein	0.966	1205-1232	KVVPEKRRERRRQRIDNREREERKTRMR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJW4	Histidine kinase 5	0.757	508-516	HKSRRRGRN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITS8	Bikaverin cluster transcription factor bik5	0.767	629-641	KPLKKLLRKARAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITS8	Bikaverin cluster transcription factor bik5	0.741	57-64	RKRNRKPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J218	Uncharacterized protein	0.819	218-231	RRQRRQKPKPIAWR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3W5	tRNA-dihydrouridine(16/17) synthase	0.988	365-384	ARKKRKKDTPGKKASGKKER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8Z8	Myb-like DNA-binding protein myb-1	0.702	104-111	RRKRHDRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR7	Uncharacterized protein	0.969	20-88	KKKEKEEDDRRSRERSARSRSRDRSISRDRAYSRDRASRDRASRDRVSRDRASSGERPRNRERERDRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEP8	ATPase family gene 2 protein	0.719	34-49	RARAKQRATTRKMAPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIB0	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform	0.729	16-27	KDKDPNKPKKNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKC6	Uncharacterized protein	0.995	335-451	MKQRKKGKPGGDRRSRGRSSSRSRSRSFSPGRSSGSNSPPAFKRRRLSPDSRSRSPSRSRSHSRDRRQSPPRKGRYDSRDYSRSRSRSRSRSRSPYRSRSRSRERGGGRRGRDDSSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKC6	Uncharacterized protein	0.775	96-107	KNKTKPSSKRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G775	DnaJ domain-containing protein	0.628	129-132	RRPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ47	DNA repair protein rad14	0.975	301-327	KREADKKRRKEAKFRDKLNDLKRKTRT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGU8	E3 ubiquitin-protein ligase RNF216	0.944	248-261	KKARPKSLKRKRES
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIK3	Putative endo-beta-1,4-glucanase D	0.883	309-320	KRRRAARKARRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRN5	Uncharacterized protein	0.968	34-49	RRRRRRDFPKRVRRRN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV84	Nucleus export protein brr6	0.893	166-190	KRHAPGKGEIPRGGRDYPAIRKRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV84	Nucleus export protein brr6	0.606	441-443	RSP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV84	Nucleus export protein brr6	0.602	445-445	K
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IW56	Uncharacterized protein	0.84	178-195	RFKPSPGSSRRQRRERRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J4U7	Uncharacterized protein	0.614	362-367	KSKTAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FK27	DNA-binding protein	0.875	263-273	SKKTKKGPKKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FK27	DNA-binding protein	0.772	201-223	KRKKSGEENGSNKKRQTRQGEGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKB6	DNA-directed RNA polymerase ii subunit rpb1	1	139-217	SRGKERGETKEQKRARKAARRARKEAREARRKERALKKAKKSKVVEKADKGQAREESKEERKARRKAKKAKREARKGKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNJ1	DNA polymerase delta subunit 3	0.968	164-264	RKRDRKGKPVPTPAPVASAAKPVKKEPSPPTTKPTADKKAEEPVKKEAKPAAKESPFSMAAGKKGAAPPPLKKSSSSGIMGSFAKAAAKAASKPKEAPKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNJ1	DNA polymerase delta subunit 3	0.945	355-367	GRRRGKRKVMKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNJ1	DNA polymerase delta subunit 3	0.689	417-423	KPKKAAP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU38	Uncharacterized protein	0.995	91-112	AAKREKKREKRRAYKKRAQERR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IT17	Lipase 4	0.61	651-653	RLK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX62	Retrotransposon-derived protein PEG10	0.699	318-326	RRKEKGEKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYD6	Uncharacterized protein	0.919	119-143	ERRRQQALKQKQARRSSSKKSPKSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYN8	Vegetative incompatibility protein HET-E-1	0.637	546-552	KEDKRMR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFF8	Uncharacterized protein	0.857	16-30	RRESSPRADRRRRPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JID6	Uncharacterized protein	0.994	182-203	PKKKNREKAAKKAQKKAAKKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JID6	Uncharacterized protein	0.694	443-461	WREDKLKHFKDKYADKKHK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN29	Tip elongation aberrant protein Tea4	0.996	404-436	KKDDKKKKDKDKKEKDKKPSAIRSFFSRKDKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN29	Tip elongation aberrant protein Tea4	0.632	237-240	RKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN44	Uncharacterized protein	0.727	95-103	RKIAKRRSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP67	Putative RNA-binding protein	0.99	234-284	RSRSPMPRRRGGGGGGGGRRPGARREGQRDQEGGRGGGGGGGGGGRSNGRT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP67	Putative RNA-binding protein	0.88	30-44	NNRRGGPPRRRERDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSC6	FK506-binding protein 4	0.944	287-302	SKPSKKDKKKLKNNKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JSC6	FK506-binding protein 4	0.719	144-151	GKSKKGKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FCH7	Duf1168 domain protein	0.999	120-153	REAKDEERTRKNREKREKKKQRGKKGSAAAGPKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G4L6	Uncharacterized protein	0.631	384-391	KKPGPLPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8G0	Uncharacterized protein	0.879	91-100	RSKKKRAMKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDN3	Uncharacterized protein	0.99	88-100	KSKKDKKKKKKQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IU13	Uncharacterized protein	0.823	45-61	PPNSEPKRSPKRLARPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX89	Uncharacterized protein	0.974	1086-1100	HAMRSPKKKGKRKSG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX89	Uncharacterized protein	0.941	992-1006	KERKERIESKRRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX89	Uncharacterized protein	0.939	595-606	DARRRAHKRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IY09	Uncharacterized protein	0.907	276-285	AKARKKKKQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J985	Uncharacterized protein	0.688	56-67	RPRSARQPNRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JD65	Mannan polymerase II complex ANP1 subunit	0.95	452-471	GGEEKKEKKKEREKEGGGFA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ07	Uncharacterized protein	0.925	374-383	PTKKKGKRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ07	Uncharacterized protein	0.761	677-694	KKQRTGLRIKTSPMKKKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FV26	RED_N domain-containing protein	0.992	497-511	GGKTKRKRGPKKRKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FV26	RED_N domain-containing protein	0.665	247-256	RKIGAKQKPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FV74	Spindle pole body component	0.654	172-175	RKKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FV74	Spindle pole body component	0.614	179-180	RK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G506	F-box domain-containing protein	0.945	86-106	KIRSRRTERRQRKMLKKTAKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILS8	Activating signal cointegrator 1 complex subunit 2	0.988	602-670	SRGGRGGRGRGGGRSRGRGGGRGGNVAGPTGDKDTEAARRRKEASKGSRANHNRRDQRAKKMGRGGLPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILS8	Activating signal cointegrator 1 complex subunit 2	0.912	297-318	KKPGGGFMRPKRLVKRKVDKGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IP43	Uncharacterized protein	0.658	64-71	RAKEKQRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITN8	Uncharacterized protein	0.667	66-71	RKPKKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8D6	Uncharacterized protein	0.707	105-111	EKKHKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFW6	Uncharacterized protein	0.91	405-439	RSDRPRSERSERSRRSGRDSGRTTPESVRRRATRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIS3	Uncharacterized protein	0.996	427-456	KDGKKSRKKKKVKTWAGSILTRKEKRRAKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIS3	Uncharacterized protein	0.731	904-915	KHKSSKSKRLSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JIS3	Uncharacterized protein	0.607	150-151	RR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN95	DNA cross-link repair protein pso2/snm1	0.854	125-137	AKPTKKAPGKRKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN95	DNA cross-link repair protein pso2/snm1	0.638	17-26	KNFKVSPSKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JN95	DNA cross-link repair protein pso2/snm1	0.605	11-11	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPW1	Putative catabolite repression protein creC	0.644	178-183	KKKVPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FD71	Chromo domain-containing protein	0.746	203-218	PRKRASSGEKSKSPTK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEX2	Uncharacterized protein	0.975	154-172	AKKKRATPAKKRTPAKVKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEX2	Uncharacterized protein	0.932	122-132	KKKRAPAKKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEX2	Uncharacterized protein	0.838	81-91	KRKRATPRKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAB8	Phosphoinositide phospholipase C	0.685	7-19	RRKAPGDERAPKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAB8	Phosphoinositide phospholipase C	0.681	425-435	KRKIMIKVKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GE19	G-patch domain-containing protein	0.999	191-212	KTRKKRRKEEKKEKKRKSKAAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GE19	G-patch domain-containing protein	0.999	225-294	KKAKKDKKKEKKEKKKAEKDSSDAESSDEKASKKKSKKDKAEAKETDAEKAARKEEKRKRKEEKRAKKEA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GE19	G-patch domain-containing protein	0.796	170-176	KKSKKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL7	Anucleate primary sterigmata protein A	0.924	1353-1370	RARRRSKELRRRQSRSRH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL7	Anucleate primary sterigmata protein A	0.874	30-62	PSRSSRKSRRSVTPPNGKKSPSPPPVPNEKSSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL7	Anucleate primary sterigmata protein A	0.679	881-899	RKTRSAAALPRTQRNRRHG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZ67	E3 ubiquitin-protein ligase TOM1-like	0.961	2843-2885	KLKAEEEERRKIREEERKKFEEEARRLKEAKEAEEKAAREKKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZ67	E3 ubiquitin-protein ligase TOM1-like	0.685	3342-3357	RRKDAQERAARDAKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J5D4	Zinc finger protein klf1	0.656	35-39	KRRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7M2	Uncharacterized protein	0.996	305-335	KLRPYMKHRKLRKETKLKRFKKKRVDRWRGS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7M2	Uncharacterized protein	0.982	107-127	RAEAKKRPGRKPRGPATPPPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB21	DNA-directed RNA polymerase I subunit RPA43	0.993	13-45	KSDKKSKKDKKEKKRSREEDAVEGEERKHKRSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB21	DNA-directed RNA polymerase I subunit RPA43	0.992	109-122	RKEKKDKKKKRKSQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB21	DNA-directed RNA polymerase I subunit RPA43	0.974	81-93	EKKRKHKKDKHRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB21	DNA-directed RNA polymerase I subunit RPA43	0.914	134-146	SEKKEKKSKKSKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB21	DNA-directed RNA polymerase I subunit RPA43	0.754	422-438	RRRRVGKSGGILSKERR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGX1	Uncharacterized protein	0.996	10-65	KRGRGRPPKVPGEKKVYVPTGRPRGRPKGSGGVKKATTPKKPAASTGRGRGRPKKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGX1	Uncharacterized protein	0.984	79-113	AKSGTPGRRGRPRKSDASAAAPTPKKETKKKARKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JKE2	Beauvericin cluster-specific repressor BEA4	0.645	58-66	RKATKTRAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JL10	Rho-GTPase-activating protein 5	0.829	452-462	KRQPNKLKKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JL10	Rho-GTPase-activating protein 5	0.818	582-593	EKKRRWRLSRQR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQI9	54S ribosomal protein L31	0.737	84-95	KEKRYRKGIHKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR68	Protein pob1	0.864	281-292	KPRKSSRRRQKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FID4	Uncharacterized protein	0.992	274-300	RKVREHHKNNPFARAKKRRDKKSLRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FQP0	Ribosome biogenesis protein	0.983	9-26	GLKRKRVPAKEKSKKRAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G1Z9	Ino eighty subunit 1	0.823	540-566	RATRRLRRWAAHEGPPLGVVPARKKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G1Z9	Ino eighty subunit 1	0.814	462-473	RKQHHKARKARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G648	Nucleolar protein 16	0.952	7-24	KKKRRAGQKTRQPNRPKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6U3	Alpha-mannosyltransferase	0.996	392-449	APSTKSKSNTARATTKKSADDRARDKEAKAAEREREKERKKQEKEAAKEQKAKEKERA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6U3	Alpha-mannosyltransferase	0.693	299-310	DKGKQRAESPKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9T8	Methyltransferase domain-containing protein	0.964	3-14	KKRRTKKRKGTR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GGZ9	DNA polymerase	0.957	160-192	RSGGKRNRSPERRRARVLSPAPETRRPLSKRPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL4	Putative transcriptional regulatory protein	0.864	85-104	EPKEPKEPSAPKKKATVAKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL4	Putative transcriptional regulatory protein	0.606	56-56	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFL4	Putative transcriptional regulatory protein	0.6	53-53	K
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INJ9	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7	0.758	151-164	KMRHGRKARIWYRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPI9	Nuclear GTP-binding protein NUG1	0.998	7-54	KPKKPKSKRTPVRLRHKIEKASAAKQRKQRKLAKKNPEWRSKLKKDPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPI9	Nuclear GTP-binding protein NUG1	0.762	72-87	KKLRKAEEAQKRRELA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IV55	Uncharacterized protein	0.794	111-127	GRRRAETRKLRHSLRKW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX93	Uncharacterized protein	0.855	21-31	RKPRRVHKKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J063	DNA polymerase iota	0.649	6-11	KRAPRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1R9	Glycine-rich domain-containing protein 1	0.745	665-675	KARKRANKTFK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6V3	Uncharacterized protein	0.961	358-372	GKKKPPPPPPPKKKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAX4	Oxysterol-binding protein-like protein 3	0.831	219-225	KRRRKKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM07	Putative transcriptional regulatory protein	0.796	33-42	PPPRKRKSTP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP73	Uncharacterized protein	0.983	4-25	KKNSKRAAKKKVQAKARKAARE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP73	Uncharacterized protein	0.824	46-61	EKKKLTRKEKVKLDKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKH6	Cryptochrome DASH	0.859	562-587	KPKNGRRQYANRRRGRGNQNGGHGGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNH8	Exonuclease 1	0.925	695-724	RKNTPPRRALSPTKSAIQRSPKRSPRKSRL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FS02	Uncharacterized protein	0.975	193-219	KLKATKRAREKDDQAKPPAKKARRSKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FX89	Chromatin-remodeling complexes subunit NGG1	0.921	132-145	SKKTGKTNKKKRKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FX89	Chromatin-remodeling complexes subunit NGG1	0.886	557-571	RTMGKSKKNKRPGGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEE7	Peptidyl-prolyl isomerase CWC27	0.904	219-227	RKKKRKGGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEE7	Peptidyl-prolyl isomerase CWC27	0.792	269-279	KPKKAKTKENK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IMF0	Uncharacterized protein	0.983	227-287	SKRKRRPASPSKSSPLKQPPLRPPEFSQKTKDPSKKAPLSVTREKSPSKPAKKTRTRKGPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IMF0	Uncharacterized protein	0.975	560-571	KIRTRRKKRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISR6	Telomere length regulator protein rif1	0.994	1553-1574	KSGKKKRKRGSSKYDTRRKKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISR6	Telomere length regulator protein rif1	0.827	1155-1171	KLKAQKVSKRTRGKART
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7X0	Smad nuclear-interacting protein 1	0.999	23-115	RRRRDTKDRDGHRRRRSREREGARNSDRHRERRRSRSRDKRERRRLRTPDPSARKRSCSRDRDRDRDRERRRERSPRDDDRRSSGKELKRRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAR8	Vacuolar fusion protein CCZ1-like protein	0.65	46-51	KRRHRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCI0	Protein transport protein sec73	0.642	674-677	KKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGD2	Iswi chromatin-remodeling complex atpase isw2	0.998	58-87	EKKRKAALLAKRRKKKKVEFTKEEREKKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGD2	Iswi chromatin-remodeling complex atpase isw2	0.717	505-517	KTASRSSSKRKNP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGD2	Iswi chromatin-remodeling complex atpase isw2	0.706	461-470	RNSPRKAKSE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IH25	Uncharacterized protein	0.876	290-323	PPRDRNNQNRHGKINRQDRRQDRGRRNKHNNQSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IH25	Uncharacterized protein	0.721	714-730	KEGKQGDGGAFKIRKKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J732	SEH-associated protein 4	0.754	902-912	KKSKRGGRPTI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBH6	Uncharacterized protein	0.976	146-176	RIRRLLRLHRRRPGSRSGGNATKSPRKAKKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJJ1	Uncharacterized protein	0.997	128-147	SRRKKTKASRRKDKKKSKKH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JL49	Mitochondrial distribution and morphology protein 10	0.926	382-392	EEKRKKKPRER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FPM6	Glutaminyl-trna synthetase	0.995	33-72	ELKKRLAKRAKKAATEKAKAAKEAAGGAAESKPKAAPKPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FQQ4	Uncharacterized protein	0.625	152-157	RPRPNR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G2P7	50S ribosomal protein L1	0.924	45-57	PKKTEKKKRKLPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K0	rRNA biogenesis protein	0.986	106-121	KSKAKKEKRRKAKEAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K0	rRNA biogenesis protein	0.964	6-55	RKDAPGGTPPSKSAKSTKASRPSKRDTPTKDRKQDGGKDKKSREEAPAPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K0	rRNA biogenesis protein	0.941	1713-1752	TKAKGLKAKKAEKWFKRWADWEEKLDPKGREKVMAKAKEW
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8K0	rRNA biogenesis protein	0.934	1457-1471	GKKSKASEKKEKKKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IC97	Uncharacterized protein	0.827	208-219	EKERSSRRKRTR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ICP6	Uncharacterized protein	0.867	110-144	RLMRPMRPISRRPFDPFIPIKIRKTASNRRRRNNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGZ2	Uncharacterized protein	0.825	63-78	EPKKGEPEKKSESKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J447	Uncharacterized protein	0.894	702-719	KPVPRWKLGPRARKPARA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J447	Uncharacterized protein	0.668	30-36	LRKRVRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J904	Uncharacterized protein	0.923	572-600	TPPKKLTKRARSPSKWKLFSRSRSQPNKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J904	Uncharacterized protein	0.836	184-203	KSSVKKKRLSPLPPSPPPRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J904	Uncharacterized protein	0.778	365-375	KKEKPARKGPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J904	Uncharacterized protein	0.657	329-333	KKKER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB33	Uncharacterized protein	0.97	475-514	SKEKSKKGSRNKAAVYKKDKAKGRDPTEDEPKKVSKRNPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB33	Uncharacterized protein	0.906	92-116	KRWRHHKGRANKGEVKDLKERARRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB33	Uncharacterized protein	0.882	411-448	GKGFSRRDAPGGKPSAGDHSEGRGKRPQAERGHLRRGP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFU0	Splicing factor ESS-2-like protein	0.86	25-35	PPAKKIKRPKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVF3	Chromo domain-containing protein	0.993	513-576	GGRDKVIKPIAAPAKRGRGRPRKESVVEDAPKAAPKAAPKAKAKEVKEAEEPAPKKPRAGRKKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVF3	Chromo domain-containing protein	0.963	605-618	PPKKRGRGRPKKTP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVF3	Chromo domain-containing protein	0.923	331-370	PAPKAAPKAAPKAAAKATPKVTLKSAPKITLKAKAAPKTA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3H4	ABC transporter	0.992	462-478	KDKKKEAEKKKNKKKGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G3S8	Uncharacterized protein	0.914	243-273	LRRGHRDPPKSDTSKSDKPKSDKPKPRSSNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G7Q9	Low-temperature viability protein ltv1	0.831	298-303	RKKKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GF98	Mitochondral 37s ribosomal protein	0.994	84-103	KARGKSAPKKAKEKVVKKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFC6	Uncharacterized protein	0.859	19-32	RLRKAKREAKIRAG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGL7	OTU domain-containing protein 2	0.901	115-131	GGGGKKRNRQKERLARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGL7	OTU domain-containing protein 2	0.783	27-38	SKKKNATKKTRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL77	Retrotransposon-derived protein PEG10	0.701	318-326	RRKEKGEKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILV5	Transcriptional regulator of form adherence 5	0.705	137-141	KRRKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUJ5	Uncharacterized protein	0.807	50-62	RGRKPPGSRARRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J128	UBP9-binding protein bun107	0.889	687-717	KEKGKDKDKKDEKDKEKDANGKGPSTPFGKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFV0	Unsaturated rhamnogalacturonyl hydrolase YteR	0.962	383-407	RGNGHGGPKPPRGGPKGPRPGRQFN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ42	Acyl-CoA dehydrogenase family member 11	0.732	56-67	RKKPPGKLLSKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FG11	Uncharacterized protein	0.837	17-28	IGRRRRRELLKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FU41	Uncharacterized protein	0.72	176-185	RPGRKSKNGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0J8	ERF-3	0.736	178-193	APAKEEKKEAPKEEAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0J8	ERF-3	0.626	165-169	KPKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8V7	Ribosome biogenesis protein ENP2	0.883	608-632	KKKKGRGPPQQQEESAPKEKKRFDA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8V7	Ribosome biogenesis protein ENP2	0.82	449-466	KVEKERASRIRGNKKVKV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GDL0	FAM50 family protein	0.977	77-88	SKPKKRKKKIGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GE96	Threonyl-tRNA synthetase	0.908	24-36	NKDKAPKKEKKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJT0	Uncharacterized protein	0.982	85-103	QKKTKRKRKRNEAAESKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IWS3	Uncharacterized protein	0.999	1793-1816	KKWKEKGSDKKKKKGKEKAKPRLK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IWS3	Uncharacterized protein	0.781	1914-1936	KPEDKPARMNPRNKPNRNNSKPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2B7	Protein argonaute	0.606	236-238	KPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JE35	Uncharacterized protein	0.884	56-88	RRLKRRKVDGPEAQRIPPHAKGGVARRHHHRNR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEU8	Uncharacterized protein	0.707	496-501	KKKRRE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK22	Uncharacterized protein	0.996	71-170	RDDREDRRRSRSRSRSRAKDRDRERDRDRDRRDRDRNRDRDRERDRDRDRSRDRRDRDRDRDRDRDRDRDRDRRSRRDRSLSSRRDRRDRSRSRRRSRSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK22	Uncharacterized protein	0.641	44-47	AKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBU8	AAA family	0.722	362-370	KGRMKGRRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN6	G-patch domain protein	0.966	276-320	GGKKKSSRPRLDEYRRDEEKRRTERKERRGESYRDERDRDRERDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN6	G-patch domain protein	0.819	74-87	REKKEKRPRELVIK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN6	G-patch domain protein	0.776	242-253	RGPNKKRPTERR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN6	G-patch domain protein	0.617	99-102	RGRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G414	Nucleolar complex-associated protein 3	0.958	49-63	RKHKRGKKDKKESNR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G414	Nucleolar complex-associated protein 3	0.954	361-383	GAPPPRKAFKKEFRTKKQRKQIK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G414	Nucleolar complex-associated protein 3	0.643	8-11	KRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G830	Cyclic nucleotide-binding domain-containing protein	0.716	966-972	RRRARKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IC22	Sterol 3-beta-glucosyltransferase UGT80B1	0.699	537-546	RGKKHVKLSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IC22	Sterol 3-beta-glucosyltransferase UGT80B1	0.65	844-849	KEKKGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJB0	Uncharacterized protein	0.944	102-124	PKNRVIRTPRPRKFLKRRPNSKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IK62	BTB/POZ domain-containing protein 1	0.999	1511-1587	RREAKGKAKGERSSKDSKRGRRGRGGGKGKGAGPPGASGDGAGNAEALGSPKPPAGGPASNNSRGRSHRGRGRGGKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IK62	BTB/POZ domain-containing protein 1	0.69	1160-1166	GRRKSKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J489	Coiled-coil domain-containing protein 25	0.695	161-181	KELRKRDQAASLVRKKEEARV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J489	Coiled-coil domain-containing protein 25	0.633	184-188	ERKEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDG3	Cytokinesis protein sepA	0.957	1646-1670	RESLRRSRRQTAEEERRMRRRRREK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDG3	Cytokinesis protein sepA	0.819	1555-1566	RDRRRRARLKDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK92	Uncharacterized protein	0.936	77-92	EPAPRTSGPKKKKKQP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JK92	Uncharacterized protein	0.602	305-305	K
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM83	Uncharacterized protein	0.812	171-182	LTGHRKRFAKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM83	Uncharacterized protein	0.6	169-169	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPB7	NIPA-like protein	0.853	468-495	AKDKERWARLRRVKSLFESKNAKKIRRT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEE9	Kelch repeat protein	0.996	3-38	KAKKGGKSDEKAAKAAAKKAKQANKGEKKAKTKAAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEE9	Kelch repeat protein	0.792	322-334	RRKKPANAPNPKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FGA8	C2H2 finger domain-containing protein	0.754	70-79	KGKPHKRRVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVK2	Condensin complex subunit 2	0.767	230-236	RKKPKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVK2	Condensin complex subunit 2	0.647	529-539	NKPAAPARQRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVK2	Condensin complex subunit 2	0.603	526-526	K
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWN9	Replication termination factor 2	0.996	202-219	LKKEKKDKKEKSKKKRKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFF4	Phospholipase D1	0.992	241-255	KPKKKRRMRRSKKDK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFF4	Phospholipase D1	0.81	1744-1756	KRRRRATTKGSRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IFF4	Phospholipase D1	0.639	576-579	RKKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQ80	Structural maintenance of chromosomes protein 4	0.939	144-172	RKPSPTPRKPRKSAAPKSATPETPMAKPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQ80	Structural maintenance of chromosomes protein 4	0.769	72-79	RRRGRPKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRV9	Uncharacterized protein	0.647	895-898	RRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITS7	Ribosome biogenesis protein nsa2	0.869	8-28	KRWRKRHGKHYTRYREASKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0Y9	60S ribosomal protein L15	0.963	163-193	GLTATGKKSRGLNKGHRYNKTRAGRRKTWKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J0Y9	60S ribosomal protein L15	0.946	40-78	SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKKPVAKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7Q6	Vegetative incompatibility protein HET-E-1	0.647	44-48	KAKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JAM4	tRNA (Guanine(26)-N(2))-dimethyltransferase	0.983	70-85	AQPASKRKEKKRRRAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCZ1	J domain-containing protein spf31	0.959	198-212	KGKSGDGKKKKKMKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FHA3	Pectate lyase	0.955	47-69	RAEKANPSKTKSAKKPKKTHATK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVA0	PX domain-containing protein	0.978	901-917	RRRRAKRRDRLRRSAGE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEL1	Serine/threonine-protein kinase RIO1	0.999	503-553	KGRPRGRKHEDKGEKKAHKLAVKEAKREKRKDKMPKSMKKKLVSSSSRKKH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJL9	Double-strand break repair protein	0.998	584-621	PAKRGAAARTTKAAAPKKAPAKKAAPAKKAPARGRKKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJL9	Double-strand break repair protein	0.842	517-527	KERSKRKIKPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IE05	Uncharacterized protein	0.713	329-339	KPKRAVRGKDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INW7	Uncharacterized protein	0.993	249-309	EEKPAEKKVKTGKPGRPPKATNGAAKKESPKKDKESLGHKISEKVKKVMPPVGRTARKTRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITT1	Ribonucleases P/MRP protein subunit pop1	0.993	139-220	SRRRKPKTTRARIRVETAKRLGFLAEKKRRRQMKAAKAKAQDGEAAGAPKVTVTTRAPRSKIRRNELNEPPKRKSKFRKRQI
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITT1	Ribonucleases P/MRP protein subunit pop1	0.967	103-127	RGMRRRTASHNAKRVPKRLRRRALK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITT1	Ribonucleases P/MRP protein subunit pop1	0.924	626-641	RAKRKRDWERRPKSKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITT1	Ribonucleases P/MRP protein subunit pop1	0.639	18-20	KRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3S7	Uncharacterized protein	0.769	132-138	RKKGRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8U5	Uncharacterized protein	0.709	31-47	VIRRSRRNVDARPFRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG69	ATPase family AAA domain-containing protein 3A-like protein	0.997	116-144	KRKAKSKKQVAKKSKKALSQPKKTKKSKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG69	ATPase family AAA domain-containing protein 3A-like protein	0.989	54-74	KKGDAKKPKKTDKTKSKKPKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG69	ATPase family AAA domain-containing protein 3A-like protein	0.978	354-375	KKLKKQEPKSSEKKARKKQQKH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG69	ATPase family AAA domain-containing protein 3A-like protein	0.773	241-252	RAPAPSKKRNGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGS0	Putative cytochrome b5	0.988	1316-1347	RNRGKMDVKRRLKEKHRIQRLRGKKTPGIRPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JP18	Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein	0.652	675-684	RRSPMPSKRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPP2	UPF0743 protein	0.987	204-223	PKHERRRKDGSEKKDKKRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPP2	UPF0743 protein	0.969	306-335	KTKAKKRKVSSSSKKHSSHRHRDGEKAPKL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPP2	UPF0743 protein	0.685	277-285	KTKHSKHKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FN17	Cell cycle control protein	0.997	15-120	KGERERIEREKNERRERKKQRSHHHHHRERDRSSDRHRERDRDRERDRERDRDRDNDRHRHHRSRRHDEDEEDGHRHKRSRHFRDDEERRSRRHRDRDGGRRDEKH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FN17	Cell cycle control protein	0.805	680-699	QGRWNKGDRRVEGFKKKWRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNS6	Transcriptional regulator	0.998	250-276	PKPKRKKKEAGAPKAPKEKKEKKEKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNS6	Transcriptional regulator	0.992	120-136	EKPKAKKKAAPRKKSRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNS6	Transcriptional regulator	0.984	83-109	KPKKGKRQSAATSPPAKRRKRASAAKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNS6	Transcriptional regulator	0.924	147-162	VKAKPSKAKNGRAKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	0.973	1018-1038	AKPKRGHPKAKTTTAKGKGKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	0.972	229-245	PQKKKAPAKPRAPRAKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	0.965	11-35	PKGGAPPKPAPKKVEEPPKSRRGRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	0.96	993-1008	KQPKPKAKRATKKAKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	0.895	392-431	GKGAEKAREKKKQEEENIKKQALEMEREEKARKAAAEKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	0.811	49-63	APKPAAKAADKKKIK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G329	Replication factor C subunit 1	0.736	191-214	KRVASRSAAAAAPTKAAAGTKRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GD39	Ser arg-related nuclear matrix protein-like protein	0.784	393-423	RDRERDRERERDRDRDRETKRTPTYKRDSPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GD39	Ser arg-related nuclear matrix protein-like protein	0.629	222-224	KRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GH24	Type 1 phosphatases regulator	0.928	132-163	GRKSDRDGKQKRRPSPNAYERVPKPPKPRDEA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GH24	Type 1 phosphatases regulator	0.77	101-118	RRRVPSADHKGKGKSNKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IIG2	Activator of stress genes 1	0.816	116-127	RRRRHRDKERVR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IM71	Uncharacterized protein	0.874	40-49	RRRRRRNRNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6X7	Nipped-B-like protein B	0.92	119-188	SPRRERESPRRERDVPRSRDRDWDRESPRRERDVPRNRNRDWDRESPRRDRDRDRDSPRDRDRERDSPPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6X7	Nipped-B-like protein B	0.745	56-89	ARVEKRERERDLPRGDRYIPRDRDRDRDRDRDKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6X7	Nipped-B-like protein B	0.669	91-105	DRERDRDRESPRRER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FL31	mRNA cleavage factor complex component pcf11	0.869	664-683	HRKRKAEGDHKSHRGRVKAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLR1	Pre-mRNA-splicing factor prp1	0.662	111-117	KRRQKQR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FMT2	rRNA processing protein	0.99	21-44	KKKLDRKIKAKHREAEKEKAKKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FMT2	rRNA processing protein	0.976	413-441	AKRMKGGVAKGRVTKTRPGKNRRKSMSNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FMT2	rRNA processing protein	0.877	376-399	GVNAKRQKKNDKYGFGGKKRHSKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FMT2	rRNA processing protein	0.876	291-336	KKAAAEARKLRDLKKFGKQVQVAKLQERQKAKKDTLEKIKTLKRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FRY9	Fructosyl amine:oxygen oxidoreductase	0.684	396-410	PRGLRKEWKYGNRKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FX61	GATA zinc finger domain-containing protein 7	0.931	20-33	PPRRRRRSSPKAKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GHR5	Uncharacterized protein	0.994	215-243	PTKKERAKKNDTKKEKAKKAREPEKLRPE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GHR5	Uncharacterized protein	0.948	114-155	GRRRLRKAGKGDKEKAAEAETSEEESKPNEKKKSKVDKKSKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GHR5	Uncharacterized protein	0.852	185-201	PKKTKDKKESKSANKSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIQ1	RNA-dependent RNA polymerase	0.644	82-86	RKGPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJM4	Uncharacterized protein	0.833	435-445	RRSRWRPRKRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL58	Transposon Tf2-6 polyprotein	0.996	349-366	KPKRPGPKKIKKVKKAKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL58	Transposon Tf2-6 polyprotein	0.785	1599-1608	RARRRRGAGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL58	Transposon Tf2-6 polyprotein	0.784	1543-1551	KRRGRGRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IL58	Transposon Tf2-6 polyprotein	0.724	301-313	RNKKGAPEPQRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISI2	White-opaque regulator 2	0.973	438-451	PPRPRQKKRGRRPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISI2	White-opaque regulator 2	0.663	413-418	KRRRFK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUB4	Cutinase transcription factor 1 beta	0.963	12-34	KPKSQSKIRKRAPKAWRASRFRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3A4	E3 ubiquitin-protein ligase CHFR	0.861	305-322	RRRQRERERARGDRTRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3A4	E3 ubiquitin-protein ligase CHFR	0.86	162-202	RHRRRREDSSSGDGRTRRSRDPSRDSRQSHRHEGSRRPRTE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3A4	E3 ubiquitin-protein ligase CHFR	0.808	217-229	PSEQRRRRRSESR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J3A4	E3 ubiquitin-protein ligase CHFR	0.774	387-392	RRRRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDN2	Sterol uptake control protein 2	0.68	33-42	RARRSGSRGS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FBL1	Inheritance of peroxisomes protein 1	0.835	557-568	RRKKLRSFRKGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6E1	C6 transcription factor	0.833	64-73	NGAKRRRARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GAD6	ATP-dependent 6-phosphofructokinase	0.683	764-776	KPERKLSGLKAKD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFX7	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.967	868-881	ASAKKLKSKKKSKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFX7	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.949	552-579	PRSRRTPSPERKRRTDQRLREDKDRRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFX7	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.792	1124-1131	KKRKKPVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IBR8	Uncharacterized protein	0.982	185-201	KVREKRKQKKKVARRGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IJ15	Forkhead box protein K2	0.997	539-641	PKKRGPGRPPKNGFMSKREQRLLKKQQQEMAKKTLPQPPPGEPPIKRKVGRPRKHPLPEEGGDRPEKRKYKPRKPKGEDGAEGSDAERRAKEKKEKKVRPKSP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IUY6	Anucleate primary sterigmata protein B	0.752	1416-1424	DRERKPRKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IXU9	Mitochondrial GTPase 1	0.844	353-368	RKREKEAKKDRALNKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J552	Uncharacterized protein	0.853	71-78	KKEKKKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBZ5	Kinetochore protein mis13	0.989	48-95	EPAPLPPKKSGRGRPPKERAAAAAPAPTPSKEPAVKKTATSKAKTRRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBZ5	Kinetochore protein mis13	0.864	332-349	KVKRLKEEKKKWLALKKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBZ5	Kinetochore protein mis13	0.833	194-213	KEMRKKGGGNRRSSTGMRGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBZ5	Kinetochore protein mis13	0.69	130-140	KPEEKPAPRRA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCM0	Protein transport protein sec1	0.985	701-726	GKPHKGEKEKKKRNFLGMKKSHKDKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCT4	Uncharacterized protein	0.987	270-307	RRRRGGARGEGSRGGRGSRGGKRASLAASRAEKAAERA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCT4	Uncharacterized protein	0.985	347-382	RGKRKRAAAKDDDDGGYRPRGSVGRPAKKKRKSEGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCT4	Uncharacterized protein	0.614	391-393	KRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMF8	Uncharacterized protein	0.703	89-97	RVRKARASK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMF8	Uncharacterized protein	0.65	72-77	VSKRGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JMF8	Uncharacterized protein	0.601	70-70	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FE99	Spindle pole body component	0.933	116-141	PERGDRRGDKGKPKEDKSRSAETKPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8V9	ABC1 domain containing protein	0.995	278-302	RRRSEGLLGRPARKRRRRGGPGRGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GC64	GTP-binding protein obg	0.966	179-193	LRAKRKAEKRAKRER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GC64	GTP-binding protein obg	0.681	125-135	RRRFIRAGRGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GI51	Pre-mRNA-splicing factor	0.836	771-779	SKPSKKRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GI51	Pre-mRNA-splicing factor	0.689	51-58	KATKKPAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IBX3	Uncharacterized protein	0.799	66-72	SKKRKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IE00	Transcription initiation factor IIB	0.983	401-417	KRQELRRRRKELRRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IEE9	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22	0.999	138-182	KARGEKVSSRKRSRSPNDGRESRRKRRDRSRSRDRRKRDKYRSRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILX6	Stress response protein nst1	0.997	523-682	RKAKKAKENQKRKDKAALKKQMQAEEKARKEAEKAAEEAARLEEQKKKAEEQRLKAEEKRRKKEEQKRLEEEDRLRKEAERLRRAQEQQEKRAEAERKARELKEKQKAKEARDKESREQKEREARERKEKQEQAKRDKDQKAKAEREAKVEKEAREKLKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILX6	Stress response protein nst1	0.995	151-165	AKSKKKNKKKKKAGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILX6	Stress response protein nst1	0.935	77-89	RKKQKRRAKAAAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IMY0	Glutamyl-tRNA(Gln) amidotransferase subunit B	0.991	57-80	PLRKKLKEEKKLLKKESKGKKPKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IR00	Uncharacterized protein	0.703	61-67	KARRKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX64	DNA damage-responsive transcriptional repressor RPH1	0.998	194-239	ARRGERRANVEKPKPRSAPRPRPAAKSTPSGSKKRGRGRPARGKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX64	DNA damage-responsive transcriptional repressor RPH1	0.991	598-622	SRKRKRAGDKGGKTKVKKIRLKVKT
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2X4	Histone promoter control protein 2	0.997	36-79	PRKKPGRKPGSTVKSKNPDEPPKVRRPRKPRDPNAPPIQRKRKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2X4	Histone promoter control protein 2	0.988	486-551	LPKRGRGSRGGRIGGRGGTTRGEGGTGRGGGPGSRGGRGSRGGSLTRKPRITKSEKEQREREKAER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2X4	Histone promoter control protein 2	0.87	425-431	KPKKKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2X4	Histone promoter control protein 2	0.606	293-294	PK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J7E3	Putative 20S rRNA accumulation protein 4	0.777	104-137	RGVRISKDAPAIATKKAAPAQKEAPRKEEEEPKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JE68	Protein MAK16	0.978	283-311	RKAGDKRKRGRAVKMNQKRLKQKQAERPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JE68	Protein MAK16	0.918	140-161	VPKMAPKIRRREEARERKAEAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFE7	Uncharacterized protein	0.954	170-179	SRKKKKRKAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQA7	Uncharacterized protein	0.812	164-178	RVKRRERKLLLRRQR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQA7	Uncharacterized protein	0.715	113-124	PRPPPHARVKKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXU3	Protein ras-2	0.815	223-234	RYRRKGGRREGK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G131	Ankyrin unc44	0.935	818-829	GKPERKKKPKNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G311	Centromere protein C	0.996	316-357	AAKPGKRGRPKAVPQELKGESRKDAAKADPKPKPKGRPGRKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G311	Centromere protein C	0.996	448-468	KEARKRRAKSRKAAGKGGRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G311	Centromere protein C	0.981	248-264	PKGRRGRPAKGKGKAKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G311	Centromere protein C	0.945	211-225	KQPAKRKGRPPKAKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G356	Mitochondrial import inner membrane translocase TIM40	0.948	239-291	KEAPKEAKQEAPKETKTEAPKAEIKSDSEIKKVEIKAEPEKKETEKKTKPKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8R1	Uncharacterized protein	0.974	469-499	KKQPYRRQPQPQRKKQAALKQSKKTKKKQHA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GCJ2	Swib mdm2 domain protein	0.966	146-165	TNKSNTKKKRTAPKKKSATK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIC7	Elongation factor 1-gamma	0.967	218-250	PKKPEQPKKEAKKEAPKPAAPAAEEAPAAPKPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ49	ATP-dependent RNA helicase ROK1	0.986	641-693	KKKLREKGVEARRSHGAAMISTESKWERKKEHNKKGAAAASKQRKKEAKQSRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ49	ATP-dependent RNA helicase ROK1	0.81	135-145	KVTKSTKKKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GJ49	ATP-dependent RNA helicase ROK1	0.645	50-53	HKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IG59	Uncharacterized protein	0.732	82-97	KKRAGTSKTNQKKPPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2X8	Uncharacterized protein	0.785	288-299	PRPRKKSLVKRV
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR9	Polycystic kidney disease protein 1-like 3	0.995	236-271	ARKRKKIEEEKRKRGEEERKRMDDERAKNRERKLKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR9	Polycystic kidney disease protein 1-like 3	0.992	334-357	RRGGRGRGRGGGRGRGRGGRGGRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR9	Polycystic kidney disease protein 1-like 3	0.884	49-82	KPEPAPPKPAAAEKPPPPPAKAPTAPRGLANSRF
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JBR9	Polycystic kidney disease protein 1-like 3	0.635	85-93	NKPAPAPRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJ68	Uncharacterized protein	0.957	406-425	KRSKTKKKMPLIRKKSAKAA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JJC8	Uncharacterized protein	0.881	513-532	RKWKASGRKVMKTRNGKKQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLC3	DNA repair protein RAD16	0.961	356-377	PKKTSKPVKKPAKKSARQSTRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLC3	DNA repair protein RAD16	0.928	305-324	RGRGRPKSAASAKKPAIKKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FLC3	DNA repair protein RAD16	0.673	432-437	SRRRGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNV2	Signal recognition particle 14kd protein	0.996	109-126	KPRDRSKKKAKARRKKGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FR07	Deoxyribonuclease Tat-D	0.624	310-315	KKNQKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FUC5	zf-C2H2_3 domain-containing protein	0.815	186-203	SPEPKSKAATAKPKAKSK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FUC5	zf-C2H2_3 domain-containing protein	0.613	251-254	KKTK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5R4	Uncharacterized protein	0.998	67-103	KPKRGRGRPKGAVAKPKPKAKAQIKAVPVKKGAKKQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5R4	Uncharacterized protein	0.628	16-19	RRRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GF36	Pentatricopeptide repeat domain-containing protein	0.824	589-600	KDDAKRKRATKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IT22	Phospholipid-transporting ATPase DNF1	0.857	32-55	KSSSKKRLSLMNRAHHKKKNSEKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J165	Ribosome quality control complex subunit 1	0.999	81-96	PAKKKNKKKKKKAKKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8X1	Transposon Tf2-6 polyprotein	0.987	900-919	PKPRRSGPKKVKKVEKAKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8X1	Transposon Tf2-6 polyprotein	0.847	2169-2179	PRTRRRRGAGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8X1	Transposon Tf2-6 polyprotein	0.821	2114-2122	KRRGRGRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J9V6	AP-1-like transcription factor napA	0.954	82-118	AKPPAKRKRENRYKNAPPSVLSRRRAQNRASQRAYRE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDS6	Putative WD repeat-containing protein	0.992	11-64	NKKRKRTAAPEAPKKRIAASKTANNRAPPKAAAAKGKTGAAKGAKSAAPASKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDS6	Putative WD repeat-containing protein	0.978	218-232	RKKPKKPPAPPRKRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FII0	Ribosome biogenesis protein	0.995	1081-1141	VARRAAKKEEKRAEYRKKVAESEEKKEAREKKESKEFWRKNGRKRQAADEGAGGGGQKRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FII0	Ribosome biogenesis protein	0.942	7-23	KPHRKAKDKKKGHTGDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FII0	Ribosome biogenesis protein	0.685	183-188	KKRIKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKQ1	Ubiquitin carboxyl-terminal hydrolase	0.663	580-584	HRRKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6N7	Protein lsb5	0.991	214-229	KDKKKKDKDKKGKRKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G6N7	Protein lsb5	0.641	375-395	PPRPAPMSRPSPPVPAAPPKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GFI9	Lysine--tRNA ligase	0.963	33-62	KKRQKAREREAQKAAKAAAAPPKPAAAKKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILJ2	Fusaric acid cluster transcription factor FUB12	0.642	397-400	KRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INH1	54S ribosomal protein RML2	0.892	204-253	GRGKSKGNRHPTSPWGTLAKGGFKTRRKHNFNKWVVEPRARNMGKRRDKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZH1	Intracellular hyphae protein 1	0.953	165-178	PPPGGKKTKRRRRN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1C7	Uncharacterized protein	0.869	198-220	KRRIAGRRTHEAERQHGRRKRAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J237	Patatin-like phospholipase domain-containing protein	0.947	154-167	AKRGSRRRRNRAKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JB37	Uncharacterized protein	0.875	273-285	KRIRRLRRPREPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM99	Enhancer of mRNA-decapping protein 3	0.981	192-206	PKKKNRRREKAKAPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JM99	Enhancer of mRNA-decapping protein 3	0.623	375-381	KPGAARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR34	Uncharacterized protein	0.84	9-37	RKRKRDESDDKKAATAAPSGSRRRVRARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR34	Uncharacterized protein	0.656	714-724	KLGLRAGKPAR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JS57	Uncharacterized protein	0.717	82-90	RKKKLKQLK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JS57	Uncharacterized protein	0.705	171-178	KRVKRHRP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FCP3	Developmental regulator	0.914	65-77	REKKKRNKSKPLK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZP2	Nitrogen permease regulator 3	0.997	146-160	WKKKKKKKGKPERAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8W2	mRNA cap guanine-N7 methyltransferase	0.966	13-28	RKRKRSQSPAKKGKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8W2	mRNA cap guanine-N7 methyltransferase	0.922	47-71	AKRRAVSPSEQPRKQKRPGARARIS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDN1	Uncharacterized protein	0.851	45-61	RPHRRRRRCAHLQPRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDT1	GTPase-activating protein gyp3	0.957	716-731	PRPAKPVKKPRSRRKN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IDT1	GTPase-activating protein gyp3	0.679	520-528	AKAKRFIRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVD6	1-phosphatidylinositol 3-phosphate 5-kinase FAB1	0.829	1924-1940	RQREDRRKRLAKGTQPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IVM7	Uncharacterized protein	0.997	13-56	HDPGKKVRLRAKKVPKPGKPHRSTPHARPAPAPRTPARVSRPVR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX19	Uncharacterized protein	0.988	399-447	NRGREGGSGHRGRGRGEWRGRGGFRGEGRGGRGRGGQRGGSVSMRGPRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IX19	Uncharacterized protein	0.832	17-25	SAKKKKAKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPB2	Forkhead protein sep1	0.641	450-454	RKRSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G4X0	Dienelactone hydrolase	0.982	486-501	KPKGGEKPKGRKKPKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8D4	Myb dna-binding domain containing protein	0.978	230-249	KASKAGSGKTRKKAMKPRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8D4	Myb dna-binding domain containing protein	0.915	361-374	PKAKKSRAHRKKLE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8D4	Myb dna-binding domain containing protein	0.76	382-394	HGPFKKSHRRERR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GBX6	Good for full DBP5 activity protein 2	0.829	285-293	KSKSKKRKQ
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQ73	Uncharacterized protein	0.936	34-61	PSEKEIARKLRKRELDRRAQRQARERTR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IYK9	Secondary metabolism regulator LAE1	0.635	35-39	KNRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JA20	Calcium-independent phospholipase A2-gamma	0.955	1253-1260	SRKRRRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JES9	ATP-dependent RNA helicase DBP10	0.995	854-907	VRKKRVAEAKEKRIGKFKDGAGSRKEIKGAEDIRKARVEKQKKMEKNARPSKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JES9	ATP-dependent RNA helicase DBP10	0.835	342-353	KKRKRGEGDGRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JES9	ATP-dependent RNA helicase DBP10	0.791	685-692	KGKKKKNK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JLI6	Uncharacterized protein	0.804	65-73	SRRRRRQRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPL9	Tyrosinase	0.753	434-445	KRKRALGRRDRG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JPM9	Uncharacterized protein	0.897	133-143	KRRKGRGRPPG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ39	Increased rDNA silencing protein 4	0.942	415-451	PKRPASKAKIRPPTPPQPRGTASKAKEPEAPPLRKPR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ39	Increased rDNA silencing protein 4	0.913	603-625	RKKKHQKASNKHSHAEGARRRWR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ39	Increased rDNA silencing protein 4	0.724	317-331	AKQPGSPAKRSPHRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ39	Increased rDNA silencing protein 4	0.694	747-752	EPKGKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ39	Increased rDNA silencing protein 4	0.655	256-262	KSKPKVK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ39	Increased rDNA silencing protein 4	0.609	242-243	KA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI29	C-type cyclin	0.769	709-726	GGWGGGRRNHHHDRRKGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FXL1	Phospholipid-transporting ATPase	0.995	646-661	SARKKRKGKGKDRKKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZM3	Putative RNA-binding protein	0.999	103-174	EKKKKKDKKSKKAKTEEEEAAPAEEEVKEEKKSKKEKKDKKKEAKAKEETKPETNGEEKSKKKDKKSKKTKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZM3	Putative RNA-binding protein	0.996	8-39	KKRKRADDDAATAKKSKSDKKDKKEKKEKKAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZM3	Putative RNA-binding protein	0.99	62-78	KKDKKERKRKEKEARKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FZM3	Putative RNA-binding protein	0.718	290-299	KSKFRREKIK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G5G1	Sterol 3-beta-glucosyltransferase UGT80B1	0.635	734-739	KRQRGR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IE59	Phospholipase A I	0.894	467-488	RKAKRQRPAQSRMTLRKRRRVA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IQI9	Uncharacterized protein	0.772	1449-1465	KKKFFGGLFRRKKDGEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Z9	Protein HOS4	0.996	1027-1224	KKERGDDDKRRQEEKERRREEKRQEERKRREAEAEEARKKEEERRQREAEEKKREAEQKRREAEQKEREAEEKRLKEEEEAKQREEERKRKAELERKRQEEEERQRREAEEKKRREEEERRLREEEEKKRREEEERKRKEEEARKQREEEERLRKEQLEREAAEEARRLREEEERKERERKERQQREEMERKRAAKEA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Z9	Protein HOS4	0.971	678-756	HRDISKTKSPNRRERERERERERERDRDQDRETKRQGRNELKDEARAHKRNLSSPSRDPESRKKISANRNVTSPKEKRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Z9	Protein HOS4	0.877	187-249	RRKSPKLSMKDRAKSTDRTLTHKRKAPKADSEDEAENRKARRQRISDAGADSRPIRAPREHKM
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Z9	Protein HOS4	0.813	821-841	KPRRKLISKGELRGEREKNRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Z9	Protein HOS4	0.743	768-776	KRGPGRPRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J1Z9	Protein HOS4	0.678	935-941	GKERRPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2M2	Calpain-D	0.992	606-662	RKIKEQQRASDSRKQERRKLWDRRHMTREITRKQKEKNGEKRARRIAKAEAAAKVKA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2M2	Calpain-D	0.984	28-44	QKKKKKKKAPPQQSINR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J2M8	PH and SEC7 domain-containing protein	0.952	712-741	QRGKTRKEKGHRQDKPSKESSPSRRPSQRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JCY1	Uncharacterized protein	0.996	68-110	PSRLRQPIRPPPLPTKNKRRPPRQLPKKKSKSTPKPSHRGSVR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDL2	Pre-mRNA-splicing factor cef-1	0.964	175-202	GKKAKRKARERQQEESRRLAALQKRREL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JDL2	Pre-mRNA-splicing factor cef-1	0.86	272-281	ENKRRKKEKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGG1	Chromosome transmission fidelity protein 18	0.661	20-34	KRARPAAADPTKSKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGG1	Chromosome transmission fidelity protein 18	0.646	186-194	KEAAEKPKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JGG1	Chromosome transmission fidelity protein 18	0.604	266-267	RR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JNS9	37S ribosomal protein S23	0.994	70-105	GKHIRRGKINQNSKKKRENIKVKKPAPGERKAFRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JR45	Uncharacterized protein	0.869	880-899	SKERLEREKLEMRARRKRER
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FJB5	Uncharacterized protein	0.989	283-307	AGKPLLGKKKIKFSRGKPALNRRRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8S8	Frg1-like family protein	0.959	8-18	KGEKKPKKRKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8S8	Frg1-like family protein	0.945	210-239	RFKPRIKASKEEKAKEKISRKELEEAVGRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8S8	Frg1-like family protein	0.764	245-253	VRKLKRARR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GEK1	Mitochondrial import receptor subunit tom-20	0.696	37-48	RRELRRNERRQH
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGR3	Uncharacterized protein	0.973	252-284	RSKKRHSGERRVSGEKLKDKDRKHRSSKSRTSS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGR3	Uncharacterized protein	0.872	483-498	RRQRRRRRADGSARSR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGR3	Uncharacterized protein	0.748	400-419	RRSDKRSESGRDSRHRERRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGR3	Uncharacterized protein	0.682	1526-1532	KAKKHKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGR3	Uncharacterized protein	0.619	296-299	SPRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IGR3	Uncharacterized protein	0.601	1816-1816	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITM1	Uncharacterized protein	0.948	450-498	RIKKMRRIVSNRMSDRSSRTKTISKTTGRSKLARHRNRKMKYHSKERDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITM1	Uncharacterized protein	0.784	185-202	RPTGLAKKARAHPLRGAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ITM1	Uncharacterized protein	0.685	343-357	AHEKRIAAKEERGGA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J599	Eukaryotic translation initiation factor 2A	0.976	530-547	ALKNKKKRNNKKKEGEAN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J599	Eukaryotic translation initiation factor 2A	0.898	560-601	PPPRDFGRSGHEGRSPERRGGGGGGNNHRHRSHSRNPGAPRN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J8D0	Meiotically up-regulated gene 89 protein	0.939	20-33	KGKKEEKKKSRRPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JQ68	SWI/SNF chromatin-remodeling complex subunit snf5	0.914	137-157	KPRPGKRQSHPLRWKKKDLKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI59	Anaphase spindle elongation protein 1	0.885	396-418	KGERRDPGKLLREEKMRKRIAKE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FI59	Anaphase spindle elongation protein 1	0.859	231-249	KAKRDKLSDEKKNREKKLK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKN1	ATP-dependent RNA helicase mss116	0.957	560-594	PKGRHGRGGGGGGGGEGRSAGSGGRGNRGRRGGRD
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FKN1	ATP-dependent RNA helicase mss116	0.802	9-22	NRRHPRRDNRRGGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0P0	3'-5' exonuclease	0.855	91-111	GKKGNRNPRKHSAAYKPNPKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G0P0	3'-5' exonuclease	0.846	396-410	KGKQKGKEDKAKKQK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G4X9	Alpha-1,3-glucosyltransferase	0.872	7-17	HKPRRRAGKKG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILJ7	Transposon Tf2-9 polyprotein	0.996	349-366	KPKRPGPKKIKKVKKAKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ILJ7	Transposon Tf2-9 polyprotein	0.724	301-313	RNKKGAPEPQRRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INJ1	Dehydrocurvularin biosynthesis regulator	0.69	22-27	KRRKLR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IR35	DNA mismatch repair protein msh6	0.953	168-186	RSKKRKRPETTKKTQSRKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IR35	DNA mismatch repair protein msh6	0.751	238-248	RRPAASKRKEK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IRB3	RNA-binding protein 8A-B	0.974	127-160	PPGGKGGANARGGARAQNRGRGRSRSRSRSRSAE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J380	Uncharacterized protein	0.848	260-275	RGRRGKDKSAPKNRGP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6J6G4	Nitrogen assimilation transcription factor nit-4	0.772	484-490	RKRKSRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JEZ8	Uncharacterized protein	0.999	1140-1178	EKKRKKSKKSKEKLDKTAIKGKRPSERRKEAKRKEKRKS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FNH5	BZIP transcription factor	0.905	21-41	RRAKKRELDRRAQRAARERNR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G379	Uncharacterized protein	1	270-296	RRVKKKERKKGKRARKMRRKLSRQERR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G379	Uncharacterized protein	0.999	357-407	KKRDEKLRKIEEKMEKAEESERKKREKTDKKREKRAKKRGKHHAKDHKKAN
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G8D5	Protein mesA	0.995	186-202	RKAKEARKRRRKRLRNR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G9D7	1-alkyl-2-acetylglycerophosphocholine esterase	0.816	9-23	KDDRRRQSAKKHPPK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIJ3	Ubiquitin-like modifier HUB1	0.993	6-78	RPRSRSPRRDRDRDRDRPKKQGGFRWKDKSRRDDRDDRDDRRGLERGYRNRSRSPRRDRDRDRDRYNDRDRDR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2GIJ3	Ubiquitin-like modifier HUB1	0.82	82-120	YRPRDRDRDRDRDSGPRESKAGSSSSKDTTKPPKREKPA
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IHX2	Sphingoid long-chain base transporter RSB1	0.768	272-285	LRRQPLRSRRRQGG
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IN35	Dehydrocurvularin biosynthesis regulator	0.924	15-24	PRPKKRKIRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6INI2	Ubiquitin-40S ribosomal protein S27a	0.995	93-119	LRGGAKKRKKKVYTTPKKIKHKRKKTK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IPB6	Histone H1	0.999	82-233	KGPSGGTKLAKKAPKKEEKKAAPKKAAEKKEAKEPKEKKAAAPKKAAAKKEAKEPKEKKAAAPKKAAEKETKEKKAAPKKAAVPKKEAKEPKEKKAAAPKKAAAEKKETKKPAAKKADKPAALSKTKTGRVTKTEAKKPAAKKASAKKDEAK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6ISW8	Uncharacterized protein	0.857	657-666	GEKRLKKKRS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6IZB8	Putative transcriptional regulatory protein	0.67	13-24	KQRRVADKERKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFG9	SH3 domain-containing protein	0.973	308-321	AAKKEKKRPPPKKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFG9	SH3 domain-containing protein	0.804	155-183	KPSEPPAAKSPPIAKASPAPSKPGPPPKP
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JFG9	SH3 domain-containing protein	0.757	470-477	PPRKKKVE
UP000011096	Colletotrichum fructicola (strain Nara gc5)	A0A7J6JG94	E3 ubiquitin-protein ligase itt1	0.957	557-593	PAAPIAPAPPARRGGHQPRGGRGRGNRGAMDGRGGRR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FED6	Uncharacterized protein	0.809	360-368	RRQKKKRYL
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FEZ6	Cytochrome p450	0.646	235-238	KKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FMR1	DUF3669 domain-containing protein	0.673	394-397	KKKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FVE0	60s ribosomal protein l19	0.612	15-17	SKR
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWR9	High mobility group-T protein	0.999	52-117	TKTKPKKTTTTAAKKKPVAKKPAAKKPAAKTKKVAAKKPAKTKTGQGRGRPRRAPTPEEKLKVLKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2FWR9	High mobility group-T protein	0.6	215-215	R
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G074	ATP-dependent RNA helicase dbp6	0.996	122-139	PKKSKKEKKEKKEKKNKK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G074	ATP-dependent RNA helicase dbp6	0.985	187-200	LKEKKDKSRKKKRK
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G074	ATP-dependent RNA helicase dbp6	0.983	166-176	EKKKKKKKRDS
UP000011096	Colletotrichum fructicola (strain Nara gc5)	L2G074	ATP-dependent RNA helicase dbp6	0.774	101-107	KKKKSRK