ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGE6	Protein SIP5	0.997	551-579	RKRKAEKEERKEAKRKEKEDKKAAKAAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ45	26S protease regulatory subunit 8	0.747	382-388	GKKRRMR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND24	Mating-type switching protein swi10	0.821	288-299	VKKAGAGRKKGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGF1	Uncharacterized protein	0.901	146-160	KPIRSALKKPKARKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGF1	Uncharacterized protein	0.847	79-106	RSKSKDRHVHFKPRNSEPGNASRRRRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGW7	Rho-GAP domain-containing protein	0.773	93-106	KKKWYSRRRRSSSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGW7	Rho-GAP domain-containing protein	0.716	506-513	RKRRRSSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGW7	Rho-GAP domain-containing protein	0.651	379-384	KDKAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHN6	Uncharacterized protein	0.776	10-29	KRSKSKSSARLSILRRKERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHN6	Uncharacterized protein	0.671	1221-1225	ARRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHN6	Uncharacterized protein	0.652	732-737	KKKAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKW1	Endoglucanase-4	0.688	349-356	REARHRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLF3	Uncharacterized protein	0.996	120-195	EEKSKAKLEKEQAKVAKQAEKAKAEEEKKAKAEEREKEREKKRLEKEQKQQEKERKQQEKEEEQRKAQEAKDKKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPF6	Nitrogen permease regulator 3	0.988	163-177	KKKKKKKDQEPKRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVJ3	DUF3074 domain-containing protein	0.945	591-670	RKLHDRRRRVHEKIAKIQERSSTKRNGDKEKDEREMAKLKEKHEKELARQEEKYQRELRKIEERRQHEERKAEQRRKKQV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVR8	Uncharacterized protein	0.949	149-177	AMREKERKRREEERELEKKRLEEAEKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVR8	Uncharacterized protein	0.917	28-42	RRKPNIKKAGTKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVX2	Uncharacterized protein	0.892	173-196	QKQAKKDQKKGGSSHGKGKETQKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWK8	GTP-binding protein YPTC4	0.846	303-311	RRRRGRGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N034	Uncharacterized protein	0.797	816-825	GRARGPRRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1F8	Uncharacterized protein	0.816	100-122	RHRSRSHGHRHHHHHRHSRSRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6F7	Ribonuclease P/MRP protein subunit RPP1	0.688	270-277	KEKGLKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7R3	Uncharacterized protein	0.949	181-195	KPPKKQKGRKHARQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAC1	Zinc metalloprotease mde10	0.987	747-763	RRKSRRLRKQKKKAAAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAS3	Uncharacterized protein	0.997	84-108	KARGKGAPKKKKGPASASDGPKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF65	Rho GTPase activator Rga	0.899	131-145	RRRKKSKAAAQAKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGZ5	Peptidyl-tRNA hydrolase domain-containing protein	0.973	149-170	HKVKKRASAAKKSARKYRKLEA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH8	Zds_C domain-containing protein	0.957	638-659	RGEDREKKKREKEEQSKKSRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH8	Zds_C domain-containing protein	0.716	706-722	RKKESSRTKSGESKKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH8	Zds_C domain-containing protein	0.675	732-739	GKSKKSDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RC23	Nascent polypeptide-associated complex subunit beta	0.956	35-54	WKTGKGTPRRKMKRAPARSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RJV3	Mitochondrial division protein 1	0.843	139-150	KKHRRRVSRGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RJV3	Mitochondrial division protein 1	0.704	287-296	KSRKPRIVRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKR2	40S ribosomal protein S25	0.928	6-20	GKGKKKWSKGKVKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML50	General transcription and DNA repair factor IIH	0.965	28-50	AAGGGRSGKGGDEGGKRRKKASK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML50	General transcription and DNA repair factor IIH	0.9	419-442	DPGDKHLKVPSKDTNGKKKKPAAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ01	Kelch repeats protein	0.998	3-35	KDKKAKGDKKAKLAEKKAKQEKKAEKKAKAKSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ01	Kelch repeats protein	0.819	550-563	KKSKKFTPSKRGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ01	Kelch repeats protein	0.621	394-396	GKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRD1	Uncharacterized protein	0.616	280-288	RRQQKIGAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTU4	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16	0.958	969-999	GKVKSSVDGAGKKFVTKGSVRKPVMKKRGRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N277	GTP cyclohydrolase 1	0.981	24-56	KRSRKHRDDEPAAGATEHTKKKHKKRKSDHGVN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N277	GTP cyclohydrolase 1	0.924	70-89	NAARDPRDEPPPKPKKKPEA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N277	GTP cyclohydrolase 1	0.619	63-65	QRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N277	GTP cyclohydrolase 1	0.607	60-61	KS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N351	Uncharacterized protein	0.971	1493-1508	SSGEPKKKRTRRKGPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N351	Uncharacterized protein	0.91	1224-1255	SKPRTRARPKTQKAAEAEEEGVLGKRARKKRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N351	Uncharacterized protein	0.785	1410-1418	KRARKKLPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N351	Uncharacterized protein	0.756	1278-1286	KPGRRGRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N351	Uncharacterized protein	0.655	5-11	RGRGRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N351	Uncharacterized protein	0.622	1715-1718	RLKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N351	Uncharacterized protein	0.609	1710-1711	RK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8S0	Uncharacterized protein	0.929	214-229	KVRKPRRTAKSKGKGN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8S0	Uncharacterized protein	0.637	703-706	KRKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFY9	Uncharacterized protein	0.978	482-509	RRIRRKGRGAQGARRSERILARRPRGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RDI6	Methionine aminopeptidase 2	1	56-72	GAKKKKKRKPRKKKKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML21	Uncharacterized protein	0.641	111-117	KSKSPPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN04	Signal recognition particle subunit SRP72	0.992	660-671	GAGNKKKKKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN04	Signal recognition particle subunit SRP72	0.952	610-625	RDRSTYRPKGKKGKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN04	Signal recognition particle subunit SRP72	0.848	581-593	AKKQRRSRAKLPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNI2	Origin recognition complex subunit 1	0.827	606-613	AKKKRRGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNI2	Origin recognition complex subunit 1	0.701	60-65	RKRKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNN8	Uncharacterized protein	0.997	87-158	DKKKKEEEEAKKKAEADAAAAAEAEAKKKADAEAAEAKKKKEAEDKKKKDEEEKKKKDEADKKKKEEEEKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNN8	Uncharacterized protein	0.671	488-494	KKIKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV99	Uncharacterized protein	0.911	360-369	RGRRRRRRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVA6	Uncharacterized protein	0.656	80-85	RRSRRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWS5	DNA replication protein 4	0.94	91-122	GGRGGFRGRGGRGGGAGGERRPPPQPNDKPKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWS5	DNA replication protein 4	0.876	501-534	AKEARLKREKAMQDRERVLAEEKRRKERDLARSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0B8	C6 zinc finger domain-containing protein	0.806	68-79	KRGGARVRKKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N324	Endo-chitosanase	0.996	689-784	GKPAAKPEAKPEAKPEQKPEAKPEAKPEQKPEAKPEQKPEAKPEAKPEAKPEQKPEAKPEQKPEAKPEAKPEKKPEPPKDDKKEAEKKNELKQSKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N324	Endo-chitosanase	0.992	359-451	KPKDPPKDDKPKDPPKDDKPKDPPKDDKPKDPPKDDKPKDPPKDDKPKDPPKDDKPKDPPKDDKPKDPPKDDKPKDPPKDDKPKDPPKAEPQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N324	Endo-chitosanase	0.991	624-664	AKPDQPPKKDEPKKDEPKKDEPKKDEPKKDEPKKEEPPKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N324	Endo-chitosanase	0.974	554-593	KKPDDKKPDDKKPDDKKPDDKKPDDKKPDDKKPEDKGKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N324	Endo-chitosanase	0.937	478-514	KKADDKKPDDKKPDDKKPDDKKPDDKKPDDKKPDDKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5E4	DNA ligase	0.961	688-707	EKKEMKIEDRKRRPQKRARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5E4	DNA ligase	0.908	63-86	KNRRGPGGPAGRKGGPRLSPHEQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8G8	Git3 domain-containing protein	0.832	62-74	RRRRRSEKQRIKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC21	BUD22 domain-containing protein	0.957	327-408	PRKNRRGQKARQALAEKKYGDKAKHLGKQKEAGWDSKRGAVDAGDGKPWKRGVRNPLQQKKDGEGSRGPKQEETKKPEKKTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC21	BUD22 domain-containing protein	0.895	279-292	PPPKKAKNEKKAKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC21	BUD22 domain-containing protein	0.866	149-176	SKAKGESNSSKKDFKGDAKPKEETRKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDR9	Uncharacterized protein	0.688	152-158	LRKNRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI18	Uncharacterized protein	0.868	263-274	RHRKGKKPDKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI18	Uncharacterized protein	0.634	340-342	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIE9	Uncharacterized protein	0.853	258-269	RKNKKARKAREA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNY6	Uncharacterized protein	0.842	434-462	KRPKQQQQPSKKGQKKASEVPERFKSVKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPP6	Uncharacterized protein	0.785	159-172	KQAAKKTTKKKTTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTR1	DOM34-interacting protein 2	0.996	312-332	AEVKKALARKRKRRREKQGAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYP6	Protein-lysine N-methyltransferase EFM6	0.95	69-88	DKLKAKIRRRKFTPRSRGQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3J9	HEAT repeat protein	0.715	311-320	NKKSRSKSAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7H6	Zn(2)-C6 fungal-type domain-containing protein	0.848	58-67	KKAKARARKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8I4	Zinc finger transcription factor 1	0.758	858-870	KPQPAKRKSIAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ2	40S ribosomal protein S23	0.762	4-20	GKPRGLNAARKLRNNRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ2	40S ribosomal protein S23	0.674	138-144	EKKEKPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE11	FHA domain-containing protein	0.997	104-142	GKRKDRKTRRRSRSRGDTARSSKRDSDRKKRDGSRSRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE11	FHA domain-containing protein	0.995	24-93	RDRHRSRRQKTRHDDSDREIDRRGGSRERKRHDHHRRSRSPEDRGHRRRSRDRDSRRTYDDKERRSRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJE7	Uncharacterized protein	0.974	1108-1121	GPKKGKNKKKNKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJE7	Uncharacterized protein	0.974	1427-1441	KKFQKKKKPAKKPQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJE7	Uncharacterized protein	0.852	1164-1177	KKSWKKNKRNHPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI12	Uncharacterized protein	0.949	81-152	RKSKASGTKRAFQQVPRDMRRRTASHNPKRVPGRLRARARVEMASDNTPAKSKKKPRDPVERALNKVEKARL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI12	Uncharacterized protein	0.766	273-290	ALAKTKKLNKNLAKVKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI12	Uncharacterized protein	0.737	30-39	GRPNKRAKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI12	Uncharacterized protein	0.723	730-742	LKKEWESRPKGKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q51ZN8	Autophagy-related protein 2	0.88	1660-1675	PSRPKGKRLKLTRSKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML92	Uncharacterized protein	0.966	405-442	RGRGDREGGNWRGRGNYRGNRGFRGDGRGRGRGRGRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML92	Uncharacterized protein	0.817	17-24	SAKKKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRF1	Nulp1-pending protein	0.999	118-134	DKKKSKKKKKKKKNTRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV49	cAMP-independent regulatory protein pac2	0.938	98-113	GEKKRARKPNNKKQGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWH1	Uncharacterized protein	0.975	189-205	KDTKKKKPKLQGKKHRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWH1	Uncharacterized protein	0.62	328-332	RSRAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA1	DUF4048 domain-containing protein	0.919	42-63	KSRSRRSNSAPSSPPGKGKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N540	ATP-dependent DNA helicase PIF1	0.74	441-451	KIRRNPKAKNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N720	Transcription initiation factor TFIID subunit 2	0.72	683-692	KRLKRTRRQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W3	Ribosome biogenesis protein MAK21	0.965	47-66	RPGKRKRQDDHEKRAKPKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W3	Ribosome biogenesis protein MAK21	0.895	552-561	PKKGRGKKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W3	Ribosome biogenesis protein MAK21	0.854	1006-1019	KRLRNKASREKKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W3	Ribosome biogenesis protein MAK21	0.745	6-14	KSKAGKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N964	Uncharacterized protein	0.99	164-196	RKARKKRDEYYREKRARMQRGREKGARRRAAKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N964	Uncharacterized protein	0.825	341-348	QPRKKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDP6	Exosome complex exonuclease Rrp	0.997	705-750	RLKAEKQQRKQERRALKQKLKEEKAAKKAEEKAARKAEKKALKAAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEF1	CUE domain-containing protein	0.895	141-168	SRGGRDGGRDGGRGRGRATERGGRSTRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEF1	CUE domain-containing protein	0.742	13-25	RGRGGGRGGRGGQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	P0CT13	Histone H2B	0.985	5-45	AADKKPASKAPATASKAPEKKDAGKKTAASGDKKKRTKTRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKY8	Ankyrin repeat domain-containing protein 29	0.915	1340-1394	KTAVRNLKRHARHNRKRASLTNGARQGALQRRYNWGQEKNRWKRIKTRRVFRRGF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML40	Uncharacterized protein	0.869	258-307	HTPKPPPSHSPKPPPPPPSHTPPPPPPPSHTPKPPPPPSHTPSPPPPPPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR62	Mannosyltransferase	0.801	577-594	RMRPRLHILKRIKGAKPM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTS7	Cytoplasmic dynein 1 intermediate chain 2	0.798	11-25	KKAKLAELKEKRKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUT1	Retinol dehydrogenase 13	0.997	397-462	KKGRSKEKEKEREKDKDRSKEKSKDKQKDKDRSKERTKDKSKDKEKEKDKEKDKSKSKSKSSRKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVT0	Non-specific serine/threonine protein kinase	0.609	822-824	RNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVT0	Non-specific serine/threonine protein kinase	0.605	827-827	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY43	Nuclear localization sequence binding protein	0.98	430-477	GGRGGGRGGFGGRGGGRGGGGFGGRGGGGRGGGRGGGRGGFGGSRGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY43	Nuclear localization sequence binding protein	0.959	8-52	KKATKAAPAVKSAGVTKPSQTSSAKSKKIAKDVAVKASKKDKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY43	Nuclear localization sequence binding protein	0.68	214-218	SKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY43	Nuclear localization sequence binding protein	0.618	91-94	KAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ91	Uncharacterized protein	0.706	111-117	KKARRRQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZP7	Phosphatidylserine decarboxylase proenzyme 2	0.99	277-292	KRKRRLRIKGLKRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N008	Translocation protein SEC62	0.952	318-327	KKKKKKSKAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N008	Translocation protein SEC62	0.653	191-195	KKGKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N186	Ubiquitinyl hydrolase 1	0.645	1105-1114	KRLEKRTAIR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N586	Zn(2)-C6 fungal-type domain-containing protein	0.74	166-172	KAPRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6D5	Uncharacterized protein	0.828	288-303	RKTLRKKPPPPASRHG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6D5	Uncharacterized protein	0.781	397-410	PKKPAAPPPRRGGH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6D5	Uncharacterized protein	0.613	564-566	RPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND86	G-patch domain-containing protein	0.97	313-324	KKRKAARKKKAL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND86	G-patch domain-containing protein	0.709	53-58	RKRRRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND86	G-patch domain-containing protein	0.663	85-90	KHKKLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIT5	Uncharacterized protein	0.757	280-288	AAAKSRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH22	Uncharacterized protein	0.995	199-232	EKKARDLRRRERERRHRERGDRDSKSKPRPSNRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH22	Uncharacterized protein	0.953	104-153	KKPPPPPGSRPQMGRPGPPRGENVPPPGGRRPPPSHRPTRSQEEAMRARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH22	Uncharacterized protein	0.701	170-180	PHRRSERRLRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RBW8	Pre-rRNA-processing protein IPI1	0.983	6-28	RKKKEKKKDFQKTKLKVGKAKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKQ2	Uncharacterized protein	0.994	929-956	EKRKKEEDAKKRKAQKKASGAKSDKPVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSY6	Uncharacterized protein	0.817	234-248	SPPQRRHRSRRGSSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSY6	Uncharacterized protein	0.771	125-143	RGHSHHRHSSRHHSRRRGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSY6	Uncharacterized protein	0.649	256-261	ESRRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSY6	Uncharacterized protein	0.61	252-253	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT59	Nucleolar GTP-binding protein 1	0.798	507-525	AKMKKSLKNRAIIPRKATK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT59	Nucleolar GTP-binding protein 1	0.693	582-592	PRERLRSKSRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWX2	MICOS complex subunit MIC60	0.608	108-109	RK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1H8	Mitochondrial chaperone BCS1	0.798	245-268	KSRRYRGKPCAKVPTKCRKKMKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAN8	C2H2-type domain-containing protein	0.641	172-176	KLRKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDQ6	DNA replication regulator SLD2	0.989	502-573	RKQSQGKKGRGKAKAKTAGPGKEDNEGKEGGTVKRAIKKVSAVAHQNFRRLKLRNNGAKGGPGFNSKFRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDQ6	DNA replication regulator SLD2	0.954	421-446	LRVFKKKGQKRTTRRANMRPVRSKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEA6	EngB-type G domain-containing protein	0.89	473-483	KGRNKKKKPIA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGW2	Uncharacterized protein	0.983	355-379	SSRPSSRARSRVPTGRPRGRPKKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGW2	Uncharacterized protein	0.897	980-1000	PRRKRDKSASSGNGRSKKART
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGW2	Uncharacterized protein	0.694	469-476	RKVKQRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJX6	Uncharacterized protein	0.996	230-258	KRSPEPKKKNRNKNRNKNRNKNKNKNKNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJX6	Uncharacterized protein	0.995	111-139	SKRSPEPKKKNRNKNRNKNRNKNKNKNKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH08	Response regulatory domain-containing protein	0.839	597-606	RPAARPRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH08	Response regulatory domain-containing protein	0.715	805-815	KAAAAKAKTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R962	Clustered mitochondria protein homolog	0.989	663-685	KKPKKKSVPKKAAKKEEVKEEKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R962	Clustered mitochondria protein homolog	0.985	1284-1305	KQKKPAAKKRTGRANPKRRGAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R962	Clustered mitochondria protein homolog	0.965	942-952	SKKNKKKKKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKB5	Coiled-coil domain-containing protein 25	0.865	162-178	ERKKEEARIARERKEKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKG8	MFS domain-containing protein	0.708	47-56	KKLMHKKTRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKH6	Lipase_3 domain-containing protein	0.631	275-287	RPSSKSGDKASKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKH6	Lipase_3 domain-containing protein	0.615	577-579	EKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWE9	Uncharacterized protein	0.667	213-221	KRAKWGSRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWE9	Uncharacterized protein	0.634	61-65	KRKYK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXU5	Uncharacterized protein	0.788	457-470	SQRKLKGIRRIGRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYK0	Uncharacterized protein	0.998	739-753	KAGKKKNKRKKKGKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ07	Uncharacterized protein	0.999	909-972	RPKGLPDRRVSSKIRTKTRPKKNLSGPVKKPKPKKNRSVPVDKPEPESKPKLGPKPGPKPKKIH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0P0	Uncharacterized protein	0.707	52-58	RKRRFRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4Y1	KRR1 small subunit processome component	0.946	275-320	AKKRAAETERQEQAKVKKEERKREREKDFVPPEEPGTQTKKRKTKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5I1	G-patch domain-containing protein	0.994	219-248	GKKEKKPEPKPRRLDAGKVRKKAEEDRKKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7F3	Protein SQS1	0.965	481-498	RLKKKERKREREELRAKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7F3	Protein SQS1	0.908	7-23	GRGRGRGRGGRPPGAGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7F3	Protein SQS1	0.89	404-418	TRRPRRNKARTPKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7F3	Protein SQS1	0.716	598-612	RHFPRLDKRSRGGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7F3	Protein SQS1	0.712	450-456	RKKPKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9L4	Fungal cellulose binding domain-containing protein	0.858	353-368	GGHRGRRHRFRGPFRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAF2	GYF domain-containing protein	0.884	313-332	RIRTKTGVKTKRIPKWKLKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBX8	U4/U6 small nuclear ribonucleoprotein Prp3	0.853	243-261	QKKLRRQRRAADLKEKQAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBZ2	Uncharacterized protein	0.722	150-163	KKEKEREEKEKEGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBZ2	Uncharacterized protein	0.699	56-65	KKDPAKQKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBZ8	Uncharacterized protein	0.773	500-509	ARRARRHARP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBZ8	Uncharacterized protein	0.721	524-532	KGDKRRARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND66	Plus3 domain-containing protein	0.939	195-218	KRARAEKNERTRRREEDKERRKDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND66	Plus3 domain-containing protein	0.926	28-51	SRSPAPGKAKNGAAKKTAAKKPQG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLK8	Uncharacterized protein	0.952	1603-1621	KADKKADKKMEKKAEKKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH31	Transcription factor IWS1	0.983	63-87	LKASKRKRGEGEAPPKRKTQLKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH31	Transcription factor IWS1	0.938	145-168	RRKRALLKAMDAAAKGRSSRRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH31	Transcription factor IWS1	0.891	110-130	RRQRKSRMAGDSRRAKAKEKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH31	Transcription factor IWS1	0.696	418-422	KGKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI54	DUF2439 domain-containing protein	0.779	474-482	KKQRGKKPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI54	DUF2439 domain-containing protein	0.773	185-195	RPAKRPRREPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI54	DUF2439 domain-containing protein	0.743	414-421	RIKSRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI54	DUF2439 domain-containing protein	0.647	631-634	KGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKC2	DUF2293 domain-containing protein	0.891	4-34	KKKKSQKQKTATGTGTAGKSIQKRKKAVSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKK5	Uncharacterized protein	0.996	1005-1045	SKKKEKASLEKEKEKEKEKEKEKEKEKEPVKEKKEAPAPPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKK5	Uncharacterized protein	0.817	798-810	GRKSKKEAKEAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKK5	Uncharacterized protein	0.681	1136-1144	KKKTEKDRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKK5	Uncharacterized protein	0.615	627-630	KAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLK2	Ubiquitin-activating enzyme E1-like	0.712	600-607	PKKPAKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLK2	Ubiquitin-activating enzyme E1-like	0.699	652-659	GREPKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLK2	Ubiquitin-activating enzyme E1-like	0.627	638-641	KRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNF4	Uncharacterized protein	0.65	26-30	KRIKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR46	Restriction of telomere capping protein 4	0.975	188-214	QIKNRKMETKAIRVPKKRGRPRTPDAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX62	Uncharacterized protein	0.71	143-154	EIKKRLAEHKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX62	Uncharacterized protein	0.614	134-137	KKIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXP7	Uncharacterized protein	0.612	583-585	RAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXP7	Uncharacterized protein	0.604	580-580	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1Y8	Beta-xylanase	0.782	348-357	SKRKRSRIER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5C7	60S ribosomal protein L7	0.926	19-55	KKRKSQEKARAERLAEQEKTKKANKDKRQVIFKRAEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8L9	Uncharacterized protein	0.918	506-528	PGKPKGRGSSPSSHKGPHGRKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBY2	Uncharacterized protein	0.992	115-131	SKPKPKKIKKKSKGSKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBY2	Uncharacterized protein	0.813	342-351	GRRKRNRNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIS4	Histone acetyltransferase	0.873	92-130	DKPKEKATKKIAGAAAQSKKTAQTKRAAAAAAAAAQKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RK80	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.962	11-41	KKHKAAKAEAAKPRFIPRGQRKKMEEEKKLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR05	Zn(2)-C6 fungal-type domain-containing protein	0.706	227-233	KPKKRPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS45	WSC domain-containing protein	0.695	375-381	ARRKVKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU40	Glycylpeptide N-tetradecanoyltransferase	0.99	50-63	SKKKKKKSKRQKIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYR2	Sterol regulatory element-binding protein cleavage-activating protein	0.863	1105-1124	RRRKPGPSSARHHRGAIARG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYR2	Sterol regulatory element-binding protein cleavage-activating protein	0.797	984-1008	QKRPRKSTPPPEPPVHTNGKLRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZY4	Uncharacterized protein (Fragment)	0.601	55-56	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1Q3	H/ACA ribonucleoprotein complex subunit CBF5	0.999	446-477	KKRKSKHEGETAEEKAERKRRKKEKKEKRASK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1Q3	H/ACA ribonucleoprotein complex subunit CBF5	0.62	376-377	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6Q2	Spc7 domain-containing protein	0.762	138-149	EIKDRREARRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6Q2	Spc7 domain-containing protein	0.618	811-814	RGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB6	54S ribosomal protein L16	0.756	64-71	RRKKKMKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDJ4	Uncharacterized protein	0.995	15-80	IAKENNKPIAKRKAARKKAQKGPLVEETPAKKKAAGKAAQSAAGTKTTAGRATKKKAAGSAAEKQA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDJ4	Uncharacterized protein	0.906	93-156	AAVKAKSTPKPAQAVKGNPTAEKLVAPKKPATEKPVLAKKPAVETAKPGPQPAKRRVAANPAPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDZ7	Uncharacterized protein	0.992	61-94	RKPRPPKKSREQLKAEKKAAKAAAAAKAKAPPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDZ7	Uncharacterized protein	0.797	9-23	SRGRGGKFKKFTRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDZ7	Uncharacterized protein	0.603	136-136	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR33	Manganese resistance protein MNR2	0.998	13-30	GRRKRTHRGGKKKKKSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR33	Manganese resistance protein MNR2	0.923	289-298	RSKGRRRKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRM6	Homeobox domain-containing protein	0.935	62-76	RERHPKGRRKRTNAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVK2	Uncharacterized protein	0.97	348-385	PQPPRPPVGRPGPAGRPPAGRPPVGRPRPANQGRDGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVK2	Uncharacterized protein	0.942	233-243	VKKKKKKMEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVK2	Uncharacterized protein	0.935	433-444	RRRKRQKSPKKY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N433	AAA domain-containing protein	0.965	541-561	GRGKGGLKGIDAGQKKRKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N433	AAA domain-containing protein	0.963	81-104	KRQKRKSEATEGTTGKKRRGRPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N849	Curved DNA-binding protein	0.998	385-402	GNKKKKPKKKTKKPATKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8Y6	Uncharacterized protein	0.867	212-223	KKIPKKPKGGKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCE0	Uncharacterized protein	0.804	456-471	PSQRKLKGIRRIGRAN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND22	Lipase/esterase	0.672	577-583	KKVQKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDW1	Uncharacterized protein	0.885	66-77	SRRSRRRRNRNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHP8	Glutamate decarboxylase	0.7	542-553	QAKKERDDRHKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R0T9	Protein PXR1	0.999	247-274	REKRRKKEKKERKERRREKREKKLKKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R0T9	Protein PXR1	0.997	214-232	KSKSKKSHKSKKEKKRRKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R0T9	Protein PXR1	0.959	180-197	AQSKEERRRAKKQKKSMK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R0T9	Protein PXR1	0.905	165-176	KKEKKRKAGRDD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RMV8	ATP-dependent RNA helicase ROK1	0.988	144-162	APAKVEKSSAKKKKKKDKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RMV8	ATP-dependent RNA helicase ROK1	0.985	703-756	KKDKKELREKGVESRRSVAASKGKARITSKSAWERRKENNRKGAIEGSKRRKIA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RMV8	ATP-dependent RNA helicase ROK1	0.977	49-60	PPKGKKRKRKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML72	Uncharacterized protein	0.738	132-137	RRRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML72	Uncharacterized protein	0.709	177-184	KKRAKNRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLG4	Protein kinase domain-containing protein	0.978	487-514	RRIRRKGRGAQGARRSERILARRPRGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ49	Zn(2)-C6 fungal-type domain-containing protein	0.857	13-25	RPMKKRRTHRKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRJ7	Lipid A export ATP-binding/permease msbA	0.988	502-518	NDKKKKKDGKDGKPKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU35	Ribosomal protein	0.852	104-112	RRKRGKRHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVN2	UDP-glucose,sterol transferase	0.999	815-845	AKSSNKRRERKEKKEKRRARREAREKAKEGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVN2	UDP-glucose,sterol transferase	0.982	1202-1233	ARRESDGRSKVERRVKREKKKQVAEHAGEKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVN2	UDP-glucose,sterol transferase	0.886	177-190	KKQKRVKKKLQKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVN2	UDP-glucose,sterol transferase	0.759	1158-1170	GGIRGRLSARRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXQ8	R3H-assoc domain-containing protein	0.863	100-128	PPRRPPSRRDSQRRRELVAKGNEGSRQRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXQ8	R3H-assoc domain-containing protein	0.761	257-268	KERKRLEKEKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYM5	Uncharacterized protein	0.829	184-192	RKKKQRKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ61	U4/U6.U5 tri-snRNP-associated protein 2	0.917	552-563	RKRDPKRKGKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZB0	Uncharacterized protein	0.721	1108-1115	SERRREKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZB0	Uncharacterized protein	0.638	1080-1083	PRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZS1	Protection of telomeres protein 1	0.813	595-606	SESRHDAKRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N254	Uncharacterized protein	0.699	17-24	PPKRRAPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N447	Uncharacterized protein	0.631	19-24	KPPVKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5I7	Uncharacterized protein	0.612	390-393	RARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.945	32-54	EKPRRVTKRSRSTKARSSGRRRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.877	447-469	RAARRRRRSPSIAYEEPRTKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.871	136-164	PKRNKKVAEKSKPSKIVTLKVPSGRGKVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.818	1306-1318	RRAKEAEEKRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.628	414-416	GKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.604	354-354	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.603	351-351	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L8	ATPase family AAA domain-containing protein 2	0.602	410-410	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N811	ATP-dependent DNA helicase CHL1	0.964	95-132	KREELSKRWQEREERLKQIREKEQRDEKRAAKRRRLLE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9S9	RPA43_OB domain-containing protein	0.99	153-164	EKKKKKRSRRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9S9	RPA43_OB domain-containing protein	0.982	13-28	KADKKSKKNKEKKRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9S9	RPA43_OB domain-containing protein	0.98	91-104	RAKKEKKQKKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9S9	RPA43_OB domain-containing protein	0.953	62-73	EKKKHKKSRKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAC6	RCM-1	0.611	523-532	PPGPGPEPPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGK6	Uncharacterized protein	0.834	19-36	APKSPPAHPRSAIRRRRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJT2	AAA domain-containing protein	0.998	83-105	RKKSNSKRSKKSKKSKKKLAPRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJT2	AAA domain-containing protein	0.659	28-35	RKVGGKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN80	Uncharacterized protein	0.838	428-436	RPPRRKRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ06	DNA-(Apurinic or apyrimidinic site) lyase 1	0.995	444-470	EQVDKKAEKDAKKAAPKGKAVKGRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ06	DNA-(Apurinic or apyrimidinic site) lyase 1	0.624	439-442	RKRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYP5	Uncharacterized protein	0.654	98-103	KRRNKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZF1	G-patch domain-containing protein	0.752	41-57	RQRERREAAERARHKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZS0	Importin subunit alpha	0.785	25-49	LRRRREEQQVEIRKAKREENLAKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4W3	Uncharacterized protein	0.77	719-728	RYKKKRQAHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAC7	U6 snRNA-associated Sm-like protein LSm1	0.784	145-160	ARKAEDKAKEKSRLKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBT6	Uncharacterized protein	0.991	518-530	GKAKRKRGGKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBT6	Uncharacterized protein	0.717	205-225	KIKKKGQFATKPVVPGGKRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBT6	Uncharacterized protein	0.614	239-241	AKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDQ2	Histone acetyltransferase	0.875	369-387	GSRTIPVPAPSKPGRKRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDQ2	Histone acetyltransferase	0.837	301-319	KGKNSAGKDGKGGKGKGQQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NG64	Tyrocidine synthetase 1	0.614	3342-3344	KRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QTR1	ATP-dependent RNA helicase DBP9	0.994	596-636	RKSSDRQKKGRFFKKGGARSFKAGGRKPDPLKTFKAKRKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QTR1	ATP-dependent RNA helicase DBP9	0.991	389-406	KAAPRPKKKRKMDRKRDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR28	Kinase	0.798	1338-1346	RKSRKRNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR28	Kinase	0.65	1032-1035	KRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR28	Kinase	0.616	1042-1044	RRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRA2	Uncharacterized protein	0.999	215-256	ERRRHRHHHRRENETEEERRQRRRERHRRRRARERREARPTP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1N4	ATP-dependent RNA helicase DHX8	0.993	21-71	KVKKSSKDRRDKKKESSSSRHSRSHRRSRSRSPARESSSKHYRSRAKDSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1N4	ATP-dependent RNA helicase DHX8	0.799	1008-1016	KKLPKDRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7G9	Forkhead transcription factor G	0.856	622-645	RKRSIMDSSPLKRPAKRQGIPRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7G9	Forkhead transcription factor G	0.724	466-473	RTKRKGGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB35	Uncharacterized protein	0.662	133-138	GRRRQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.998	274-317	KKSKKDKKKSKKKGAEEPPPPPPPAPVEEVKSSKKDKKKKSKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.997	749-762	PKKDKKKKKKKGKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.996	1447-1475	KKKSKSKDKDKDQEKDKKGKKDKKSKAGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.993	1060-1082	KQEPEPAPPASSKKDKKKKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.99	960-972	SKKDKKKKKKGKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.99	1324-1336	KDKKKKKKKDKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.972	148-182	PKSKKKSKGKKDAEISEDEGDKKGKKSKSKKTDPE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.966	79-93	KKAAKKAAKKAAKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.963	193-205	SSKSKKKKSKKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.954	1410-1421	SSKKDKKKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.929	119-128	GKKKKSKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.929	1216-1225	KKDKKKKKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.832	1255-1263	RDKKKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.819	2891-2920	PREDRTPREERTPRDENGDEKKHHRRSRPD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.797	1288-1297	KKDKKKNKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.678	2982-2992	RRRAERHAARA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL7	Uncharacterized protein	0.621	3235-3238	KEKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QXP8	Uncharacterized protein	0.79	144-152	RRRTKKKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RLI4	Pescadillo homolog	0.98	659-680	ESEKLREKRRRIERKMAKGKAT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RLI4	Pescadillo homolog	0.962	608-644	PKSKAKQQKRKELQRKAKEEAEDLERAKGMLSKKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKC4	Uncharacterized protein	0.893	529-578	SRFPGPRGGPRRPHAGSIGGMSLPGHRGPPRRPGSANSNGRWGPSPRPGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKJ6	Uncharacterized protein	0.949	824-859	AKLRAEHKKERKGAMRELRKDANFMAREKLRIKKVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKJ6	Uncharacterized protein	0.885	888-897	EKAQRKRARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKJ6	Uncharacterized protein	0.661	24-29	SKKQKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKQ5	BTB_2 domain-containing protein	0.657	431-435	RKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP38	DNA helicase	0.922	829-846	RVRKEPPKKDKKAVPKSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP38	DNA helicase	0.915	229-251	TKRSAKKRKSSEMSKVTPAPKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP38	DNA helicase	0.909	1692-1745	KAKSGAGRGGRSNWKGNGGRKTSYGSRRTSGGGGGGVSKRRAATGSGGGGRKGN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP38	DNA helicase	0.831	383-390	RGKRRRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSN5	Golgi apyrase	0.952	538-570	RKRERRMRLFSKVNSMFRRSRKPGSPRKASRGL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT87	tRNA(His) guanylyltransferase	0.688	250-255	KKKRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTW3	Arsenite resistance protein Ars2	0.872	139-159	KDEKERQRTGRRRESERPRGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTW3	Arsenite resistance protein Ars2	0.708	43-53	DRPRRSNRSRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ88	Uncharacterized protein	0.996	202-265	RDRSRNRSRDRSRDRSRERRRAASRAASRNPSGRNSSRERSRERSRERQRARSRAPSPVISRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ88	Uncharacterized protein	0.983	404-477	YGGGSPPRSDRRSSPTRSERSVRSERSDRRRSPPSRRYSERERDRERDRDRDRDRERERERVRDRENRNRDRTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ88	Uncharacterized protein	0.616	184-187	RLRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ88	Uncharacterized protein	0.616	399-402	GRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ88	Uncharacterized protein	0.6	396-396	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0R9	Zn(2)-C6 fungal-type domain-containing protein	0.669	106-111	RGPKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAN0	Uncharacterized protein	0.788	457-470	SQRKLKGIRRIGRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEZ8	OTU domain-containing protein	0.824	20-35	GRITSKKKNATKKTRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEZ8	OTU domain-containing protein	0.77	110-121	KKRNRQKERLAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF95	DnaJ domain-containing protein	0.965	200-216	KKSGESSKKKKKLKPIG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ72	Uncharacterized protein	0.721	201-209	KKNAKKHGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKP0	GRIP domain-containing protein	0.945	607-616	KKKNKKKKGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI02	Transcriptional activator hac1	0.948	89-143	KKTKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.973	422-435	RLRKPERKRKPKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.899	767-778	KRPRGRPKKNAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.888	121-138	ERRKARKTANGVTKKKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.832	723-748	GPRGKTSTAAAAAKSPTKRPVGRPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.801	367-375	KSKAPKKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.696	89-97	RAKTKAKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.688	214-225	RKTSSAASRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1T1	Structure-specific endonuclease subunit SLX4	0.688	805-809	RRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNA0	Cryptochrome-1	0.884	645-660	PGRATRASKREKKPAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPG0	Verprolin	0.73	151-159	RKSSRRKSI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRK2	Serine/threonine-protein phosphatase 2A activator	0.692	43-48	EPRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU62	Uncharacterized protein	0.941	230-255	GPNRPRKQSITKRGRESHHKKQRSRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVD8	Cell division control protein 50	0.786	25-34	KQDKKKSKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYT7	Uncharacterized protein	0.899	260-268	PKKKKRTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N228	Uncharacterized protein	0.658	197-206	KYKQRAERKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N542	Enhancer of mRNA-decapping protein 3	0.965	172-187	TKKKGRRARAAKAGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCF8	Uncharacterized protein	0.993	280-295	KVKKPKKKKSKSTRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCF8	Uncharacterized protein	0.858	109-133	KSQKKRQKKIDQLRKAEEEKDRKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCF8	Uncharacterized protein	0.817	352-360	ALKKRKRMR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCF8	Uncharacterized protein	0.798	64-78	AKRKREERAAAVKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCF8	Uncharacterized protein	0.626	595-604	KGKTDKLLKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE19	Exonuclease 1	0.631	94-97	KRRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKC2	Major facilitator superfamily transporter	0.604	554-554	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R2Z0	Uncharacterized protein	0.889	171-187	KKKDKGSSSKHGSKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM08	Disulfide-isomerase A6 precurso	0.98	250-267	PAPKKKADKKSKKAGTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNL3	HMG box domain-containing protein	0.992	110-131	GRVTKPKPKKKRPRSEAVPKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPB0	Uncharacterized protein	0.712	160-168	GKGQKKEKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR26	Leucine-rich repeat-containing protein 23	0.782	682-698	KRPRASPTKDPTPKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRQ1	Uncharacterized protein	0.864	916-930	KQKREKKRSLWKSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWS1	Uncharacterized protein	0.663	1075-1082	RNAGKREK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY77	Nucleolar protein NOP2	0.982	42-101	TSKKRRTSKKGEQSPKTPAKGKINAKNAGSTPAAKKPNGAKVASPASTKTAKKSGKSKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY77	Nucleolar protein NOP2	0.981	653-678	RAKRNAMRRRGLDPKALDRPKKAKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4F8	DUF5672 domain-containing protein	0.937	332-377	EDKEKEKKAKEEQEKKAKELADRLEDEKKRKDAEAKQEDKDKHKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E1	Chromo domain-containing protein	0.997	273-321	TKKSEEPVAKKPRGRKPDAIARTAKTPGRKPGASKPGPSKTGRKPGRKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E1	Chromo domain-containing protein	0.981	88-209	KKRGRPSLPRPLSRNGTPAKTPTKPGRPSKTPRTEKASKGAKTAVLTGSARKRNADAATNDAPPAKRARGGKPLKAERTPERIQSRRGAAEAAKATFSTALKRAKIVESSDPAPKKRGRKVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E1	Chromo domain-containing protein	0.965	338-352	APKKPGRKPRAAHGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N927	Uncharacterized protein	0.877	108-118	RKIRKGRKDRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9K7	Lipid phosphate phosphatase 1	0.968	347-368	RKAGWGRRTKAKGMRFGKKKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCV5	ISWI chromatin-remodeling complex ATPase ISW2	0.963	1117-1128	PPAKSKAKGKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCV5	ISWI chromatin-remodeling complex ATPase ISW2	0.667	1075-1079	KKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHF5	Uncharacterized protein	0.734	63-75	KWRKMGARLRRNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R0R0	DNA mismatch repair protein MSH3	0.928	212-225	PPPKGKKKGAKSGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R713	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	0.933	74-94	RKILKDQAKASKAQAKGKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML34	Cut12 domain-containing protein	0.898	842-856	ARLEKRRADRRRRGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML39	Uncharacterized protein	0.942	296-325	GRPKPPYGRPRPPIGRPRPPIGHPMPPRPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN21	ULP_PROTEASE domain-containing protein	0.629	101-106	KKRVEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN21	ULP_PROTEASE domain-containing protein	0.617	109-111	HKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRD3	AAA domain-containing protein	0.992	1104-1139	SRPQTRKESGKQRRRSREPEPRGNKGGDRRPGRRGV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRD3	AAA domain-containing protein	0.792	92-111	EKRRKYTARLARPPLKVKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRD3	AAA domain-containing protein	0.776	1175-1184	RRKGSGRNRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSW6	Histone acetyltransferase	0.998	982-1030	LPRPKPKRPAGPRRSAPAKKQKGKSSTTRVRKAGGTGRGPGRWPKGTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSW6	Histone acetyltransferase	0.989	406-442	RRIEARPRQIPKRRGGRTGGRSGGRSGGRFGGRGRTT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTQ8	PKHD-type hydroxylase TPA1	0.997	512-542	KPKGKKNSKGKNKAEAKAKSKKKGSEGKKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTQ8	PKHD-type hydroxylase TPA1	0.917	11-21	AKKPLKKKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV57	Membrane-bound O-acyltransferase domain-containing protein 1	0.936	213-225	KKAPTRKKRKIPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV57	Membrane-bound O-acyltransferase domain-containing protein 1	0.832	477-495	KKMLRKKIEERNAKAAGKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2R3	Calcium-transporting ATPase	0.999	1143-1177	LEKLKKDQEKDAEKAAKKKAKKDAKKAKKRGKKGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3Z7	Uncharacterized protein	0.912	1212-1229	KKPKPKTRAKIEGNSKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5K8	Uncharacterized protein	0.996	220-242	AHPPLPRKEQRKRAKAKAKRKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N606	Zn(2)-C6 fungal-type domain-containing protein	0.725	111-117	PRRKRGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N975	Uncharacterized protein	0.996	200-226	PKPKPKPKATKPRKRATAVASKKKGKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N975	Uncharacterized protein	0.991	321-347	PRRKKGKSKVPAEPKAKKAARGSSSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N975	Uncharacterized protein	0.985	84-131	ARAKPKAQTKRSKTTLKRESSGSEEPPATKRRKREAAPVATKKKAIKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N975	Uncharacterized protein	0.772	153-169	KNKRATKKASTKMTKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCS3	SP-RING-type domain-containing protein	0.782	398-410	NKGRPIKREVKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF37	Uncharacterized protein	0.778	64-77	PRRSSRPSRPRRVR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK26	Uncharacterized protein	0.623	508-510	KKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS6	Uncharacterized protein	0.76	138-155	RRRAMRQRQLQRRKSSGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM16	Git3 domain-containing protein	0.821	447-478	RKPGRSRTRAAEAVAGARSLSRGRYGARKGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR23	40S ribosomal protein S30	0.97	15-37	KSQTPKVEPQEKPKRPKGRAHKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSU5	DNA-directed DNA polymerase	0.778	478-489	KKQKAAPKPKPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSU5	DNA-directed DNA polymerase	0.637	187-191	KTKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTN7	Uncharacterized protein	0.858	119-127	RKKKRALKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUD8	tRNA-dihydrouridine synthase 3	0.845	375-390	KPVAPLEKKKKQKQNN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUD8	tRNA-dihydrouridine synthase 3	0.682	402-412	KARDASAKPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWL4	Uncharacterized protein	0.947	40-63	KRKELRSRTGREATEKGKRRWRRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWL4	Uncharacterized protein	0.735	181-190	KRPSKRPPLI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXF6	Uncharacterized protein	0.947	553-570	REKALRARETKARKRKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYM1	Transcriptional regulator Ngg1	0.915	136-149	RRATKKRRKDKDSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYM1	Transcriptional regulator Ngg1	0.802	648-657	MGKGKAKKNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5W7	CAMK protein kinase (Fragment)	0.755	441-452	NRRSSSKRKLSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAJ9	Uncharacterized protein	0.845	790-797	PKPKRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAJ9	Uncharacterized protein	0.845	1049-1066	KREEEKKKKTSTRSRIGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAJ9	Uncharacterized protein	0.776	412-419	KKHRGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAJ9	Uncharacterized protein	0.763	993-1016	SRLPPPTPIKKPTGTAAGKVKKPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAJ9	Uncharacterized protein	0.603	1077-1078	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAX9	Uncharacterized protein	0.764	50-57	KGDKKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAX9	Uncharacterized protein	0.642	434-443	KRRFGSLRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCQ7	Splicing factor U2AF 50 kDa subunit	0.994	100-167	RYGGARDRRDRDWDRDRGGPSRRREDGDRRGGGDRDRGDPHDRRAGGGRRGGEREERRRSASPQPKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCQ7	Splicing factor U2AF 50 kDa subunit	0.985	32-77	DDRHRDRDRDRGDRDRERDRDRDRDRDRPRRRSRSPEYRGSRSSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCQ7	Splicing factor U2AF 50 kDa subunit	0.685	237-254	RDGHRGRDGRDGGRDGRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDT3	Phosphoinositide phospholipase C	0.65	457-461	PRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGP9	Uncharacterized protein	0.935	1687-1706	MRRARRQTAEEERRARRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGP9	Uncharacterized protein	0.853	1588-1600	QRDRRRRARLKDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGP9	Uncharacterized protein	0.795	1063-1095	PPPPPPPPPLPGKGMPAPPPPPPPPPPPLPGMK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH02	Uncharacterized protein	0.857	40-52	KEKKGTRIRRKIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI20	Uncharacterized protein	0.857	364-378	GSRRSTGRSKRKSRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI20	Uncharacterized protein	0.765	177-183	RPKRRKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI20	Uncharacterized protein	0.645	401-408	REPGPAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJG4	Uncharacterized protein	0.999	1114-1165	RPAKKRKSKIQAKAKKSDGASKKKKRAKEEVKPHQLAELRKDAKRNKASRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI00	EAF domain-containing protein	0.994	150-183	GKAAGKAKPNTALRAPKKQAPKKKEVAKKPPQKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNA9	Uncharacterized protein	0.997	99-143	IKRKKKDKKEKVKASKEPKNTNDSGITKRKKKDKKDKGKASKEPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ69	Uncharacterized protein	0.96	229-241	LPPRKKKSRKDKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV65	Uncharacterized protein	0.958	795-817	ERIAKKQKRRKEKEDLLPGVRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW61	WEE protein kinase	0.816	119-141	LRNRPKAASAKPPTRSRLQPRSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXA0	Uncharacterized protein	0.824	30-41	RRSRKRKHEGSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZZ7	DNA topoisomerase 2	0.996	25-65	PKPKAKPAAKPAAKKAAAAKPKAAPKKLTQTKLTATKKRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZZ7	DNA topoisomerase 2	0.981	1558-1611	AKKTRGRPAGAKNKSKGDEPAAAPKTKTKAAAKAKPVALSPAAKAYAAKLKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZZ7	DNA topoisomerase 2	0.979	1295-1346	RRMGRRVSRKIGAGKSGGRKAKADDDYAPTKAKAPAKAKPKAEAKKVPETKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZZ7	DNA topoisomerase 2	0.891	1636-1654	PKARGRPARAAAAAPKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZZ7	DNA topoisomerase 2	0.602	92-94	KAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0L7	CwfJ domain-containing protein	0.761	286-297	RNNKRRRNDRNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4C0	50S ribosomal protein L1	0.979	45-59	KDPKKKEKKKKELKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N681	BRCT domain-containing protein	0.863	118-129	APRRGRPPKKIA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N681	BRCT domain-containing protein	0.719	143-154	ARKPVRGARTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7J8	DNA polymerase	0.796	92-104	ARKKTSKAAKRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7J8	DNA polymerase	0.707	169-178	KTLERRKARA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEE6	Uncharacterized protein	0.926	388-415	APRASKRAAFDKKKLLSRGRVEVRKKGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEE6	Uncharacterized protein	0.834	343-360	VRKPKKIKFETAERRAAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGS8	MMtag domain-containing protein	0.999	231-278	NGRDRGAISRRSRSRERHRPRSKERRRSRSPRGEKSREDRHQRGRDGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGS8	MMtag domain-containing protein	0.998	144-223	SRRKDDREKRRHRDSDRHHGRRHHHRERSRSRDQSRERHSRRRDESTERSSRREHHRRRHRSRSRRRDHGRDGDAGARRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q2KEJ1	Uncharacterized protein	0.632	1554-1557	GKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM77	Uncharacterized protein	0.869	49-59	RRQAKRPRKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMV0	Uncharacterized protein	0.978	89-116	KVRTRRKTYAAQREKVPGAKRQKKKKQS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNY0	Uncharacterized protein	0.989	66-89	EQKKKKDTKKPAAGKPGAKPPAAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPT0	SAP domain-containing protein	0.984	248-284	DGRRNNNRDGGRRDRRRGRPNGGGGGGGGGARNGGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPT0	SAP domain-containing protein	0.659	184-191	RRKAERAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR96	Uncharacterized protein	0.964	276-291	KKKRKKDGKSRATSPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR96	Uncharacterized protein	0.78	7-12	KKKKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRT6	TPR domain-containing protein	0.717	8-17	NKKARSRQKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT05	Bystin	0.624	33-35	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM4	Uncharacterized protein	0.845	62-80	ERPFAPPSPVAGRRRRGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM4	Uncharacterized protein	0.811	709-721	PRPPRRPPPVKRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVQ7	Uncharacterized protein	0.947	91-103	PARKRRRSRKGLD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZB2	Uncharacterized protein	0.698	99-110	RSRSPRKTSRVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N372	S1-like domain-containing protein	0.939	3-16	KNKGKGGKNRRRGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8U8	Uncharacterized protein	0.979	296-322	RSEGQPRRRRRSKDKNGGRDGAKSPQS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8U8	Uncharacterized protein	0.923	326-351	APGPSSTFRNAKSPSKPKRRPDPLRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8U8	Uncharacterized protein	0.669	265-273	RAKSPPKGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEX9	Microfibril-associated protein	0.992	416-487	RDDSRDRDRKSYRTRSRSRSPRRQDRRDYDRDRHTSRSPRRDRRDYSRERRKRSTSRGGRDGDHGDKRRRID
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHG2	Uncharacterized protein	0.946	285-314	KRRQQLAEYKKREEREARARRTLRRRTSPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJA4	Uncharacterized protein	0.785	299-311	PRLRSRRVRRMAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.99	148-168	QKPKGKAAASKKGAKGGRKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.986	349-385	PEPAKRGRKPKAVAAAAAPKKTATKEKTDGRRRSGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.953	205-219	PPKKKGRGRKSNASV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.858	183-194	GAPKKGRGHKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.85	313-325	PAPVKKARGRPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.767	122-137	KGIRGRAKVTKLKAKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.746	293-299	AKRKRGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX2	PARP-type domain-containing protein	0.634	235-238	TKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNJ0	Uncharacterized protein	0.965	237-301	ERRREKETREEEELRRAKKELDEIKRREEKEAEEERLAREYEIKRLEKEKKAAEEKAKREKADKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNJ0	Uncharacterized protein	0.929	347-368	KAIIKKEKIPEEKPEKPKGKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNJ0	Uncharacterized protein	0.651	465-469	KKKRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNJ0	Uncharacterized protein	0.617	315-318	RKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSH8	N2,N2-dimethylguanosine tRNA methyltransferase	0.948	111-129	ADKKRKRQEKREHREEGER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV70	Eukaryotic translation initiation factor 5	0.979	144-163	VPKKTKKDKAERKAARKAKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0B2	Uncharacterized protein	0.999	70-105	RRSPKQKQKQKQKPKAKPKAKPKPKQKSKPKPKPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2Q0	GTP-binding protein	0.759	26-32	QKLKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3G9	VHS domain-containing protein	0.938	197-211	KDKRKKDKAKHGKSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3G9	VHS domain-containing protein	0.616	368-371	KPPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB70	SRP40_C domain-containing protein	0.923	395-410	KGFTKEKNKKKKGSYR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB70	SRP40_C domain-containing protein	0.788	149-158	AKQKRPLKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB70	SRP40_C domain-containing protein	0.787	342-359	RKKSGPAEPKKPNEPFSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB70	SRP40_C domain-containing protein	0.695	36-45	KKVSKSGKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB70	SRP40_C domain-containing protein	0.632	298-301	KKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH4	PAPA-1 domain-containing protein	0.872	168-189	VRKAPQSKPTQKQARKPPAPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH4	PAPA-1 domain-containing protein	0.773	89-99	RGKRASRGGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH4	PAPA-1 domain-containing protein	0.636	318-321	RRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH4	PAPA-1 domain-containing protein	0.62	341-346	KKQVRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCK6	tRNA(Ile)-2-lysyl-cytidine synthase	0.988	737-768	KRRKRVVRPRRKDAVTRARKPPIVRGVAAPGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLL1	Lipase_3 domain-containing protein	0.939	514-565	KRQRAPLKPKSSVARNEPPPKPKQQQPLPPPPPPPPKKTTSFRAALKKGPAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLS2	1-acyl-sn-glycerol-3-phosphate acyltransferase 2	0.607	39-40	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM53	Elongator complex protein 3	0.794	57-68	RGKFSRKHKLKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP44	HTH La-type RNA-binding domain-containing protein	0.964	117-130	SETRRPRKGKKGKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP44	HTH La-type RNA-binding domain-containing protein	0.681	305-314	RPRGGARGGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP44	HTH La-type RNA-binding domain-containing protein	0.619	460-463	RGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZE0	Zn(2)-C6 fungal-type domain-containing protein	0.721	93-99	RRKRPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0B3	Palmitoyltransferase	0.84	654-660	NKKKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3W4	Uncharacterized protein	0.999	142-381	PASRIPSPEPEKPASRTPTPEPAKPASRVPSPEPEKPASRTPSPEPEKPASRTPTPEPEKPASRVPSPEPEKPASRTPTPEPEKPASRTPTPEPEKPASRTPSPEPEKPASRVPSPEPKKPASRAPSPEPEKPASRVPSPEPEKPASPAPSPKGKKPASPAPSPKGKKPASPAPSPKGKKPASPAPSPKGKKPASPALSPKGKKPASRVPSPELKKEASRAPSPEPEPKPEEPKPEEPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3W4	Uncharacterized protein	0.987	57-97	FGKKHEKYGKEHKKLGKEHKELSKKYKELGKKSQRSSRSAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4Y0	Uncharacterized protein	0.702	14-21	RSRRIKRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N657	Uncharacterized protein	0.625	47-50	NRKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N983	Anaphase-promoting complex subunit 1	0.92	569-585	RKKKSRPKSAIKFGAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N983	Anaphase-promoting complex subunit 1	0.802	323-335	RRAKPKPSGGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N983	Anaphase-promoting complex subunit 1	0.694	668-673	KRKGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9L2	Uncharacterized protein	0.767	112-118	AKKRRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9W0	Peptidyl-prolyl isomerase CWC27	0.955	215-227	PAPAKKPKKRKVG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBH7	Uncharacterized protein	0.656	52-56	RARRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDQ4	Modification methylase DdeI	0.828	726-735	QGRRKSKPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL3	Uncharacterized protein	0.942	108-136	ISRGGSNARNPQRRHRRDDERGGRSRRPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHG6	C6 transcription factor	0.789	621-633	HNRRHEKAKLRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKV1	Uncharacterized protein	0.958	674-716	RDRARERRKAFGPSTKAKSGQNQPKKDGGKKEEAAPKEKQPSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKV1	Uncharacterized protein	0.906	453-466	KRGKKSKDKEKEKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKN4	Chromo domain-containing protein	0.93	211-224	KKTRERRKAPRRHT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTB7	Zn(2)-C6 fungal-type domain-containing protein	0.793	316-330	TIRKVKGGARVEKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5I6	Uncharacterized protein	0.918	619-649	HGARGRFAEIGAERRRQEKRKLGSEKEAERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6R9	Uncharacterized protein	0.795	390-430	AKRRRAAPPATSPAVQKQPANKALKPATKQMSGPGRSKSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N782	Zn(2)-C6 fungal-type domain-containing protein	0.612	79-80	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7N7	60S ribosomal protein L36	0.972	70-92	NGKDKRARKLAKKRLGTFGRAKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8J2	Uncharacterized protein	0.759	27-35	PKKKSRVKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8R2	Uncharacterized protein	0.929	211-226	KVRKPRRTAKSKGKGN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8R2	Uncharacterized protein	0.637	700-703	KRKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAF6	Uncharacterized protein	0.776	122-130	PTKRPRRGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAF6	Uncharacterized protein	0.754	11-28	RAPPRLAKERPSEAPRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAF6	Uncharacterized protein	0.743	619-630	KARMKEKEKRGL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAF6	Uncharacterized protein	0.673	102-108	RKRGRPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBF4	Uncharacterized protein	0.92	50-77	PRSRRRDGFVSWSRARLRRLRRSIKRHP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDS4	DASH complex subunit DAM1	0.68	203-216	TRGARPSGLPRGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH56	FRQ-interacting RNA helicase	0.995	27-48	KTKKTKKSKRDKSKDKSKKRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH56	FRQ-interacting RNA helicase	0.79	400-409	QKGKGKNKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIH7	Sulfate transporter 4.1	0.742	144-154	RKLARRIRSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJD7	Zn(2)-C6 fungal-type domain-containing protein	0.645	477-482	RLNKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHA2	Uncharacterized protein	0.848	460-472	PKPAKLKKPKQTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHA2	Uncharacterized protein	0.722	26-32	RRKEKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKI7	DDHD domain-containing protein	0.936	211-235	PKRKPKFLRSKKPIEDPKPPPVPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKI7	DDHD domain-containing protein	0.624	654-658	KREKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRZ6	Uncharacterized protein	0.884	785-800	RKGRARGPQRRAPAKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRZ6	Uncharacterized protein	0.627	492-498	RKAEERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTU7	Uncharacterized protein	0.698	239-248	SPSRGRLRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTU7	Uncharacterized protein	0.696	160-174	GKQQKRLQPRPRQVS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTU7	Uncharacterized protein	0.621	179-183	PQRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N119	F-box domain-containing protein	0.82	106-121	RTDRKQKKNQKRLQKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3B9	Serine/threonine-protein kinase RIO1	0.999	508-558	KGKPRGKRFEDKDEKKEHKQAVKEAKREKRKDKMPKHLKKKLVNSSTRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6W1	Zn(2)-C6 fungal-type domain-containing protein	0.975	51-69	KKKYDPKDPHRPRRKKARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBA9	BZIP domain-containing protein	0.8	102-112	QRNYRKKLKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC27	Uncharacterized protein	0.993	675-703	ERRRSKKIKKKVVKEEVKVEAKSRKARHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC27	Uncharacterized protein	0.885	53-64	SSIHHRRRRRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH1	HUN domain-containing protein	0.988	631-689	SEGPAKRGRGGGRGSRGGGRGGATRGGTTTGRGRGGGPGSRGGQIRKPRATKAEKEQAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH1	HUN domain-containing protein	0.963	101-124	PAKQRRPRKPKDPSAPTVQRKRKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH1	HUN domain-containing protein	0.961	70-88	PRKKPGRKPGAAAAAKKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH1	HUN domain-containing protein	0.693	575-581	KKQRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	P0C148	Glycosylphosphatidylinositol anchor biosynthesis protein 11	0.878	107-120	KQWRKPRPGEKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q2KEQ5	Zn(2)-C6 fungal-type domain-containing protein	0.662	42-47	KPAKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MK85	DNA replication ATP-dependent helicase/nuclease	0.761	1644-1668	SKAGGKENVPPGRRQPTKQAKIGAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MK85	DNA replication ATP-dependent helicase/nuclease	0.65	1623-1628	RKPPNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MK85	DNA replication ATP-dependent helicase/nuclease	0.649	176-179	GRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNH0	Ribosomal protein L38e	0.684	24-30	RIKKNKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRG0	Biogenesis of lysosome-related organelles complex 1 subunit KXD1	0.728	198-209	SKKHPKQYKKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUA1	Uncharacterized protein	0.994	9-39	KEKHRQANHSKKSKLKAQGWRKERRYRRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYK9	Uncharacterized protein	0.942	554-571	SKKNKKRDRKSSHATAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZC6	HMG box domain-containing protein	0.998	59-119	AGKAKAAPKKKAAAKPKAKNTQAKPKAVKKKAVKVSRPPQSPERIEAQKLAAKKKAMREKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZL0	Protein SSH4	0.87	86-101	REKRTKKESLKKRESK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0I9	Uncharacterized protein	0.961	349-386	PPRRSSRSKASSKSPAKRKPAGSSSNTTSSSSRSKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0I9	Uncharacterized protein	0.755	85-95	RKRREAERRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2N9	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.993	491-519	RKQQKRDMLEAKRKKKSANKERKGEKGNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2N9	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.903	81-92	RGRKPQQKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2P8	Structure-specific endonuclease subunit SLX1	0.963	331-344	KILKPKRKPRKPAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2W2	Calcium-transporting ATPase	0.9	1127-1142	WSKRKRSHLERRRSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI67	Uncharacterized protein	0.988	135-151	DRKEEKRRRERKRRGAI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKA6	Elongation factor Tu GTP binding domain-containing protein	0.891	91-113	KKAKKATNNPEAGKPKATAKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKI9	FK506-binding protein	0.857	142-151	KSKKSKKGKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKI9	FK506-binding protein	0.852	285-296	KAKDSKKSKKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKI9	FK506-binding protein	0.704	319-329	KKQQKKLKNNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLW0	HNHc domain-containing protein	0.727	535-541	RLRKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV8	Tyrosine--tRNA ligase	0.981	352-369	EKKKKEKKVKNKGTRHPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUD7	Uncharacterized protein	0.859	28-41	GRDRRGRRITRAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVE4	Uncharacterized protein	0.809	846-856	KKERERSKRRQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVE4	Uncharacterized protein	0.727	268-276	KPKKWPRAD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVE4	Uncharacterized protein	0.613	282-284	LKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVE4	Uncharacterized protein	0.602	279-279	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N038	UDENN domain-containing protein	0.874	202-215	KDARKRRRQFRRDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0I1	Uncharacterized protein	0.797	358-367	RARKRRERLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2R4	Uncharacterized protein	0.606	584-584	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3J4	60S ribosomal protein L39	0.716	40-47	KRRHWRKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4U2	Endonuclease III homolog	0.856	72-85	RRATAQAPRKRKRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4U2	Endonuclease III homolog	0.762	108-117	KPRRERKPAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N526	Uncharacterized protein	0.927	475-490	RDRRGEEGKKVRKKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCC6	Uncharacterized protein	0.911	79-95	KRKRSSKRELARARKAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDI5	TFIIIC_sub6 domain-containing protein	0.994	392-439	EKKERKKLDGQARLMRKKMDPQTKGPGRGVGYKPRIRRNKAGARRRKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDI5	TFIIIC_sub6 domain-containing protein	0.979	181-194	ISRPAKRKKKTKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGY8	Uncharacterized protein	1	65-110	RGKKKKKGKKGKKGKKGKKGKKGKKGKKGKKGKKGKKGKKGKKFPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH67	tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase	0.771	21-28	PPRPKKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH67	tRNA(Phe) (4-demethylwyosine(37)-C(7)) aminocarboxypropyltransferase	0.736	267-282	RGARRNGWKIKVVRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RBZ3	Ubiquinone biosynthesis protein COQ4, mitochondrial	0.917	274-287	DARKRERDARRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLC7	Uncharacterized protein	0.978	226-243	EPKPKSPKAKKPKEPKEP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP02	Ubiquitinyl hydrolase 1	0.982	998-1030	KKRMSQPQKVGGRRQNRKGQRTYGKKGKKMPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP02	Ubiquitinyl hydrolase 1	0.629	1110-1116	KKQRAQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPP4	Uncharacterized protein	0.753	439-452	KAIRGKIFRKSRNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQZ9	Hormone-sensitive lipase	0.766	739-749	GKRRRGNGAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.996	65-92	AREPHHAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.994	114-136	HAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.994	374-396	HAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.993	158-180	HAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.993	201-223	HAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.993	245-267	HAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.993	288-310	HAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR9	Uncharacterized protein	0.993	331-353	HAGKGTGKKKGGKKNGGKKNGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV85	Uncharacterized protein	0.836	246-257	AGRRRKDHKRNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVD5	Uncharacterized protein	0.96	112-155	RRGDRGRSRVRGHERNLDQTGERSRSRSPRIRVRKGRTLSRRRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVM6	Mitochondrial DNA polymerase catalytic subunit	0.947	475-493	VKGKKKGDPPRPAARQKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA6	Mannose-1-phosphate guanylyltransferase	0.611	270-272	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYV4	Exonuclease domain-containing protein	0.941	65-76	PAKRRKKIPKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYV4	Exonuclease domain-containing protein	0.696	224-231	DDKPRKGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ86	60S ribosomal protein L4-A	0.983	184-208	KVKKSRAMRAGKGKLRGRRYRQRRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZS3	C6 finger domain-containing protein	0.869	696-702	KNKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZS3	C6 finger domain-containing protein	0.829	535-553	APSAKPKAPKAIKTSKSSN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N944	zf-C2H2_3 domain-containing protein	0.763	23-39	RRRPLRTYGKRKAVIER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N944	zf-C2H2_3 domain-containing protein	0.602	43-43	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND10	Uncharacterized protein	0.926	477-487	APKRRRRGRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEZ5	Uncharacterized protein	0.967	278-314	RSLLWKRLKRWGKRVRVRLDSSRSRRASKLWGKGQAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF01	Uncharacterized protein	0.966	115-136	KPYKPSKKKGAKPPVKTARDRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF01	Uncharacterized protein	0.904	4-25	RKRKAPATPKRPEPVSSSRRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF01	Uncharacterized protein	0.716	306-313	RPRRWKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF01	Uncharacterized protein	0.631	326-330	PKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQI1	Non-specific serine/threonine protein kinase	0.722	410-416	KKNKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQQ9	Uncharacterized protein	0.6	287-287	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS03	NAD-dependent histone deacetylase SIR2	0.66	383-387	KSRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS84	Uncharacterized protein	0.859	550-557	PKKKKRKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS84	Uncharacterized protein	0.808	309-327	KAPVAAKAKGKAQPGQKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS84	Uncharacterized protein	0.8	346-355	KRSKKPLKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS84	Uncharacterized protein	0.724	447-456	QPKSRGRPKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTA5	RING-type domain-containing protein	0.722	350-354	KKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTP5	Uncharacterized protein	0.793	937-951	RKKRAIMAAIRPKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTP5	Uncharacterized protein	0.726	123-132	PEKRTKRGGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTP5	Uncharacterized protein	0.64	502-507	KSGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUJ9	Mcp5_PH domain-containing protein	0.94	1396-1414	RARRRSKEMRRRASRSRQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUJ9	Mcp5_PH domain-containing protein	0.921	873-905	RSPTRRHSKQRPSSIRKIKSAAALPPRQRRNGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUJ9	Mcp5_PH domain-containing protein	0.666	36-42	SRKSRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWK0	Uncharacterized protein	0.897	1337-1349	LRRRRRRFRWVRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYH3	C2H2-type domain-containing protein	0.978	170-196	RKEEEEKEREEKRRKRHELAERKRAEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3S2	PH domain-containing protein	0.703	1378-1385	KKRAEGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3S2	PH domain-containing protein	0.621	1294-1297	GKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N533	Uncharacterized protein	0.731	362-375	RLKKAMQLREKKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N533	Uncharacterized protein	0.649	1110-1114	KKEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7T8	Uncharacterized protein	0.917	22-40	FGRERDKKKRDSRRVGSLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9K0	Calpain-9	0.998	569-605	EKKKLEEEKRKTKEKEAKEKRRTKEKEAREQRRKQKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB96	Hsk1-interacting molecule 1	0.747	594-600	PKPKKRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEG6	Phospholipid-transporting ATPase	0.871	1396-1406	LRKRQRKAKRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGV6	C2H2-type domain-containing protein	0.923	8-30	GQRRPNRCWGPRGRARAEKKSKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKG5	Uncharacterized protein	0.824	165-186	PALPKASRSEYKRNRDGKQRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKG5	Uncharacterized protein	0.674	143-150	SARRRMSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKM5	Valyl-tRNA synthetase	0.987	59-107	KVKTAKELEKERKKAEKQAKFEQKKAAAASKAAPAAGADKPKKEKAKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN66	Uncharacterized protein	0.999	69-130	KRKLNGAVLKGVKIRIEKARQSKEDIIMARRKEEERSGDKDKKTKKEKAPKEKKDRSKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN66	Uncharacterized protein	0.997	144-184	RKVKRGWTVSPKEAQEAKSKDKSKKKDKDKDKSKDKKKRKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN66	Uncharacterized protein	0.986	539-564	RSWKKRRKLAGKEKRYRENRSRASRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN66	Uncharacterized protein	0.845	214-221	KKRKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP21	Zn(2)-C6 fungal-type domain-containing protein	0.694	797-807	RGRGKIRGTGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQP6	STE/STE20/YSK protein kinase	0.776	410-418	KTKGRRRPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTD4	Chitooligosaccharide deacetylase	0.849	13-22	KLRRRARRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUH9	U3 small nucleolar ribonucleoprotein protein MPP10	0.997	680-714	EEKIRRRRREKERIRKSGGGSEGKKPVGKKAQERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUH9	U3 small nucleolar ribonucleoprotein protein MPP10	0.952	298-318	KPKSKADKKEKPSSKSRKSHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUH9	U3 small nucleolar ribonucleoprotein protein MPP10	0.891	383-400	AKKAKKGDNRRNKDYRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUH9	U3 small nucleolar ribonucleoprotein protein MPP10	0.613	91-93	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVK7	Tudor domain-containing protein	0.848	56-91	PKKTQAPPPPPPKAASPPPQPEKWRKEDHPAFKKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVK7	Tudor domain-containing protein	0.846	251-269	KPVKKFKKIKATKELEAGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWT8	Uncharacterized protein (Fragment)	0.982	249-280	EGRKSGKKGAKKDAKKENNGQDGTSKSRKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0K5	Uncharacterized protein	0.65	89-101	KPRIPSSRRAFHA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0K5	Uncharacterized protein	0.606	103-105	PPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N437	Chromo domain-containing protein	0.894	393-404	AKGRRGRPSKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9E0	Uncharacterized protein	0.912	182-200	RSERGGDKSRKRDKSKHGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9E0	Uncharacterized protein	0.876	287-294	KQRKGKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9E0	Uncharacterized protein	0.768	73-81	PEKRKPRNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9V2	40S ribosomal protein S8	0.85	8-42	RHKRSATGAKRAHYRQKRAWEAGRQPASTKIGAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9V2	40S ribosomal protein S8	0.795	123-147	RRRQAKQAKEGEEVKKSKSVEKKQA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH9	Ribosome biogenesis protein BRX1	0.702	208-216	KKEKKSSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGF5	Uncharacterized protein	0.967	384-398	VRKQGKRGRPRKARP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIU0	3-oxoacyl-[acyl-carrier-protein] reductase	0.833	588-600	KGMNKRPKPAKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSY7	Uncharacterized protein	0.918	951-973	RKERKDKKKDDQDKKDKKTSGIR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTT4	Uncharacterized protein	0.72	120-136	KRKARSHLPEERPPRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUK6	Elongation of fatty acids protein	0.684	286-295	KERKPPTARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVJ0	GH16 domain-containing protein	0.977	171-190	PPKKNEPKRKAEKNKSPKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVJ0	GH16 domain-containing protein	0.946	233-261	EEKKEPAAKKTKNGGGNPSKNKQAKKVKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVJ0	GH16 domain-containing protein	0.776	130-140	GRRRARRLARL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYR4	Myb-like domain-containing protein	0.946	389-408	KKQKQKKKPKLPEQVKKIMK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYR4	Myb-like domain-containing protein	0.912	129-141	ALPKKCKKKQKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6H6	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C	0.951	60-73	RSRSRRRGKRAWKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6H6	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C	0.761	185-197	SPRKQRSRSRGPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L2	SWR1-complex protein 5	0.873	82-93	KAKTKRQKKARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L2	SWR1-complex protein 5	0.63	239-242	RRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8F4	Uncharacterized protein	0.954	187-201	RRARKKRAKAAAREA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NA99	Transcription factor MBP1	0.907	127-151	APRHTSKPKQPKKPAVPRFNNKARA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDM5	Uncharacterized protein	0.902	51-62	KNRRKKLRRNNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE20	Uncharacterized protein	0.999	452-553	AARRRAEGEKIRDDETLLRKAVKRKEQAKKKSEREWGERKAGVEKAIRERQKKREDNLRKRRDEKAAGKMGKKKGGPTRPGGGGKKNRPGFEGAGFGGSKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE20	Uncharacterized protein	0.982	153-177	QKKLLKKQKKLEKLEKKAAKTKKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE20	Uncharacterized protein	0.922	40-56	KRKKHTKAEKKAAKLGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE20	Uncharacterized protein	0.861	324-352	IESRRQKQAQRKAHKQEVRRLAKEEADRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE20	Uncharacterized protein	0.839	411-435	KKKKGPSDPKTALAKLEAQKKRMAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE20	Uncharacterized protein	0.767	302-318	ELRKARKADGAEGKPAM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE20	Uncharacterized protein	0.633	440-442	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH22	60S ribosomal protein L26	0.608	15-17	KSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIY6	Uncharacterized protein	0.989	1039-1049	DKKKKKKSKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIY6	Uncharacterized protein	0.787	171-192	KKNKKFSFKAVLARKPARESKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NL14	Photolyase/cryptochrome alpha/beta domain-containing protein	0.883	637-650	GKPPSKRPWKKKDS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A0A151V4I4	Antiviral helicase SKI2	0.97	557-600	QRGGRGGRGGPQGQQRGGRGGPRGGGGGGRGGSGPPRASHAPGH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QS18	Flap endonuclease 1	0.998	359-394	KAHKRKLEVKAEEAKKKLKAEKKEKAKAKARPRGTA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML84	60S ribosomal protein L28	0.978	7-33	KTRKHRGHVSAGKGRVGKHRKHPGGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQV6	Uncharacterized protein	0.908	64-93	KPYKPYKPYKPYKPYKPYKPKKYKPYKPYK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQV6	Uncharacterized protein	0.731	138-153	QPKPQPKPQPKPIPPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV7	Uncharacterized protein	0.995	222-238	GKKKKKKGKRARLLGEA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV7	Uncharacterized protein	0.784	93-99	PSKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV7	Uncharacterized protein	0.771	52-59	STKRKRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV7	Uncharacterized protein	0.686	250-254	KKKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSB8	Splicing factor U2AF-associated protein 2	0.972	96-115	RRKKKRKAGDDDGGKAKRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT55	Ribosomal RNA-processing protein 8	0.98	61-88	EKAKGATSSKPKDSKRQKAKKGDRPPGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT55	Ribosomal RNA-processing protein 8	0.89	379-390	HSVGKRRKKSAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT55	Ribosomal RNA-processing protein 8	0.874	30-38	PSRKRKRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT55	Ribosomal RNA-processing protein 8	0.782	238-249	FHNKNGRRPPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT55	Ribosomal RNA-processing protein 8	0.755	116-126	EKKSKNRNNKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT55	Ribosomal RNA-processing protein 8	0.671	368-374	RNKKGGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTU0	Uncharacterized protein	0.999	232-288	AKKKKKNYGPKGPNPLAAKKKKKKPQPGSGTKPKEADSSASSEQPAKKKRKRRPKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVN3	Uncharacterized protein	0.989	866-877	KKKKKKKHKAQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1N6	Thioredoxin peroxidase	0.997	6-76	RKRKAPAQPAPPPPAKKKTSPKPKAAEATKAKKAITPPKETKPAEATKAKKAITPPKETKPAKSKSSVNGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1N6	Thioredoxin peroxidase	0.924	271-310	KKDKEEKEAEKEKEAEKKEAEKEEKEAEKKIEKETEKEAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2B7	tRNA dimethylallyltransferase	0.643	473-477	RHKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4L7	Uncharacterized protein	0.69	1278-1285	RKPKPAGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N648	tRNA (Uracil-5-)-methyltransferase TRM9	0.979	264-278	HGREKKKKGGKKGPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6X7	WD repeat-containing protein	0.956	444-482	MKRVKEKVEKERASRIRGNKKVKVNQKLVDKLLKKQEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6X7	WD repeat-containing protein	0.934	606-627	SKKKKKEEPVAIRPKPSNARRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7I4	Uncharacterized protein	0.902	47-57	KKKGKKPIPKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F6	IBR domain-containing protein	0.977	541-594	RPRSPRSRRDSRRHGRDHDSRHRSSRSGRDDERRHRHGRPSELDDIRPHRRRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NA84	Uncharacterized protein	0.8	171-180	SKKAKKNRTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF74	Uncharacterized protein	0.993	173-227	HKRAAAEREAQAKAREEERARKTAERDRLRKAMAKARKPSGMPGRHGGRVKLGRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF74	Uncharacterized protein	0.785	43-69	WKRKLTKVKKELFHQKKVEKQYAKVKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF74	Uncharacterized protein	0.706	145-160	KPRAAPTDSRQRRGKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRC0	Ssgprc1	0.728	44-49	PRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUX8	CMGC/CDK/CRK7 protein kinase	1	251-343	GPGREERPQRPFSPGRPRSRSPGYGRDFDRREKRKKKKKKNKNRRDRSRSPNRDRDEFGGPAPSGRKPLPQPGRESGGRRRSRSPLAPDRPRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUX8	CMGC/CDK/CRK7 protein kinase	0.997	121-156	RQGPRQNRRSRHRSRDRPRRPSRHRSPPRPPQEPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUX8	CMGC/CDK/CRK7 protein kinase	0.984	394-419	ATPPPPEASRSRKKGRGREERHSRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUX8	CMGC/CDK/CRK7 protein kinase	0.971	1130-1163	LRRKNEAKEKEARRAARAEKEKEAAGAGGSEKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUX8	CMGC/CDK/CRK7 protein kinase	0.663	789-797	VKKTMRRPI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV90	Adenylyl cyclase-associated protein	0.983	355-378	RGKSPAPGKKPKPESMRVKKPPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4Y6	Uncharacterized protein	0.967	335-362	KKEKEKAEKQKGKKGTKGQEGDAAAAKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N734	Uncharacterized protein	0.685	728-732	LKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAR4	Uncharacterized protein	0.947	244-268	AKPKGKSGKRPAARMLSSPSKRIKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH7	Chromo domain-containing protein	0.923	146-158	DKRLKRNAKRKRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLS1	EST1_DNA_bind domain-containing protein	0.643	86-90	KAKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHP6	26S proteasome regulatory subunit RPN5	0.908	206-229	ARKPKKTPEQLEKEKQEREKKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNH3	L-arabinose-responsive transcription regulator ARA1	0.654	12-16	APKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPI2	Ankyrin repeat protein	0.998	1082-1242	KRKQREERERRGREEEQKRKREAEEAEKRRKAEQEEQERRRKEEEERKRKAEEERKRKEAEAEELRKRKEEEDRRRKEEEEQKRKAEEEAKRIREAEEARQRAEEEERKKREEEERLRKEQLEREAAEAARKKREEEEERKEQERLREAERRRAAREAEAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPI2	Ankyrin repeat protein	0.959	914-990	KRHRSSATPPRASSDKDGGDGPAKRRKLDGEGLKEKKKAASSEDRPNKGTVSKDPSTRIRRDHDNEERRESIKPKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPI2	Ankyrin repeat protein	0.946	740-795	KIHKRKMSSPTGEPKKTPTAKLPNSPKEKRRLESATAHRERDDPLSPKRGPGRPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPI2	Ankyrin repeat protein	0.763	838-857	KPRRKLVSGKDLKGEREKQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPI2	Ankyrin repeat protein	0.627	234-236	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSD2	60S ribosomal protein L35	0.615	93-95	RRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTC2	Ribosomal protein	0.727	94-103	NKNKKLIKKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTD5	Uncharacterized protein	0.746	670-680	EGNRRRSPKPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUQ0	Leucine Rich Repeat domain-containing protein	0.853	681-690	TRRRRAPKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUQ0	Leucine Rich Repeat domain-containing protein	0.669	664-670	KERPRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW39	Uncharacterized protein	0.788	457-470	SQRKLKGIRRIGRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYU1	Uncharacterized protein	0.788	212-220	AKGKERKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYY1	Nucleolar protein 12	0.995	509-548	VKEGKPKDLKFKGSKVKKSKRPVSGNQKRRATRAANWKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYY1	Nucleolar protein 12	0.721	456-483	AGRAGKLLGRSAAARLGGFNKPRFGKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYY1	Nucleolar protein 12	0.669	117-120	KRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYY1	Nucleolar protein 12	0.668	148-153	SKRSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZN8	Uncharacterized protein	0.959	269-311	RVVLPKTRDRDRERSERKHKSKSRTSSTSDKHRDEEKSSRRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZN8	Uncharacterized protein	0.818	486-495	QRKRRRAEAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N276	TAFII28 domain-containing protein	0.979	121-136	LKKKRGRKSKAEKARE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N339	Uncharacterized protein	0.977	264-285	KKTARAKKAPAAIKARKARTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N339	Uncharacterized protein	0.968	517-535	KKGKKAGARKVSKQTKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N339	Uncharacterized protein	0.907	600-611	PPKRGRGRPKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N339	Uncharacterized protein	0.891	207-223	RPPPKKTRAKAARGSKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N339	Uncharacterized protein	0.847	305-316	PPPPKPARGRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBQ5	Uncharacterized protein	0.983	170-199	RRLRREDRSVAPRSRGPEGRSSSKKKRKGE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGI9	AAA domain-containing protein	0.886	264-289	QKSRRHRGKPCAKVPTKCRKKMKRCR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJT6	Uncharacterized protein	0.854	163-183	GRLGRIARERERRRLAQERRF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK43	PHD domain-containing protein	0.953	221-253	ISKEKEKEPPKSPKGRESKSSRAAAAALASHKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK43	PHD domain-containing protein	0.947	358-382	AEKEEREKQKAEAANKRKSRAERRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK43	PHD domain-containing protein	0.927	434-448	SSKSKKSGSRKKGRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKR9	Ubiquitin-like modifier HUB1	0.964	22-86	RRDHDRAGDRDRRGADRDGDRDRNRDRDRRDRDRNRDRDSDRDRGRDRPRQPRGTGGFRWKDKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKR9	Ubiquitin-like modifier HUB1	0.897	96-130	RRGGALERGYRNRSPRRDRDRDRDRQGRDGREDRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNA5	Potassium/sodium efflux P-type ATPase	0.947	247-259	RDKKSKRRPVKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNA5	Potassium/sodium efflux P-type ATPase	0.792	1028-1039	KRVWHRRRSAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU34	Threonine dehydratase	0.748	96-102	KRRKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXK6	RING-8 protein	0.785	122-131	RPHRRRREKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4D0	Uncharacterized protein	0.754	454-464	PKSKASSKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5Y5	Uncharacterized protein	0.89	513-529	SERDTPAKRGRTKRKEP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5Y5	Uncharacterized protein	0.695	499-506	GGRPRKSL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6W7	Transcription initiation factor IIE subunit beta	0.694	281-286	KKNKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N722	Uncharacterized protein	0.613	135-136	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N805	Uncharacterized protein	0.876	333-342	KRKKRRAAYS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAY8	mRNA 3'-end-processing protein yth-1	0.948	248-276	RDGKFGGGGGGGRGGWRGRGGGHRGRGRY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NII3	AAA family ATPase	0.998	130-154	RKRKKRSGTKKRRDNHKSKKKSAGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NII3	AAA family ATPase	0.997	426-457	KRHLKHLRKAKPAKSTKRGRKKEQRRIDEKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NII3	AAA family ATPase	0.886	319-332	KQKQKHRRNKGRPE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIZ8	DNA-binding protein SMUBP-2	0.832	2016-2028	APRPPKQWKKKAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHL4	Uncharacterized protein	0.622	279-281	KRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMB0	CAMK/CAMKL protein kinase	0.96	351-368	RKMLRRERKRKEKEENRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMG6	Kinesin	0.957	694-723	KASPRRRKAGAQRKGVSFTPVKKKSPSRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMG6	Kinesin	0.758	656-664	KRGTPKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV6	C2H2-type domain-containing protein	0.999	806-830	KKKAKKPKKPKNSGKAANGIKRKWK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV6	C2H2-type domain-containing protein	0.88	635-645	ERPKKKGRPSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV6	C2H2-type domain-containing protein	0.763	610-621	KKRSRPLERRPD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRV6	C2H2-type domain-containing protein	0.719	1644-1654	RRVIKKSKPAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY51	RNA-binding protein	0.926	357-384	PDKRHGGRNDKRKGNGGGGGGGGGGGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5M9	Usp domain-containing protein	0.94	187-195	KRKKKKEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8R0	Uncharacterized protein	0.987	373-383	PRRRKPPRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE98	Smr domain-containing protein	0.984	186-199	ARSRKKAKGKKKAT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK57	Uncharacterized protein	0.719	675-690	PARSSPGPDSRPKRQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKN7	Uncharacterized protein	0.896	151-164	KKGKWKRTRRNLKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHL8	Uncharacterized protein	0.946	7-26	PKKKGARGNKTLQKGKRRGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHL8	Uncharacterized protein	0.812	35-60	RPSKLQKKLAARRSGINPDGSRGRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHM5	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.749	27-38	KVAQKPKNKPKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R2R1	Stress response protein NST1	0.998	623-784	KRKAKKQKEAQKRRDKALQKKQAQAEEKARKDAEKAAEEAERLAEEQRRQEEQRQKNEERKKKKEAQRKAEEEERQRKEAERLRRAQEQKERQAEQDRKAREAKEKEKKAKEEAKQREKAARELKEREARERKEKADKERLEKEAKIKAEKEAREAQRKAER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R2R1	Stress response protein NST1	0.941	94-106	RKKAKRRAKLAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R2R1	Stress response protein NST1	0.741	164-171	KSKKGRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMD0	SWIB domain-containing protein	0.996	160-182	TRGGRDKKAAPKKKVTKKKSKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR11	Uncharacterized protein	0.981	124-141	KEKKIKKHEEKKTKKRGE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV37	Nucleolar protein 4	0.997	688-722	KPSKSAGKKLAMRQQIIGRKRMMRKKKAEVRKGKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV37	Nucleolar protein 4	0.959	523-552	GKRQPLSKEESRRAAKTGKEAEHKRKLKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV37	Nucleolar protein 4	0.601	109-109	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWJ9	C2H2-type domain-containing protein	0.959	364-402	SRKRSRGRPRSTKPIVPPKFMQPERPEQGNKRRVGRPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWJ9	C2H2-type domain-containing protein	0.958	788-809	KRRDKGELVGTGRRGRSRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWJ9	C2H2-type domain-containing protein	0.838	594-601	GRRKRKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWJ9	C2H2-type domain-containing protein	0.706	450-459	KKPSKPKSSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2E5	Nucleolar protein 58	0.999	467-489	PKEKKEKKDKKEKKDKKDKKRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2E5	Nucleolar protein 58	0.987	501-511	GEKKKKKKRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7N1	Phospholipid:diacylglycerol acyltransferase	0.749	43-52	HHKPRTRKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC57	DUF4604 domain-containing protein	0.703	189-195	GQKKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC57	DUF4604 domain-containing protein	0.664	114-117	RKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC84	Uncharacterized protein	0.988	703-729	PEPKKGRPHKSMIGDKKRKKAAARALK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK31	Uncharacterized protein	0.944	78-114	KKRRSVSVKTKKSKVRIHLSPSSKRPSPERSILKKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK31	Uncharacterized protein	0.742	469-477	RRRRGPRPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLC9	Uncharacterized protein	0.995	173-250	HRERRRDRDRKSRADDSLRSSSKRDRDSHRDKERTRHRRSQSPESNERRHRRSRRDRSPLRSPKDDDRSRRKGTSGKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLC9	Uncharacterized protein	0.919	109-159	LGGKRKRGGDGGSSSERRHGDERRTDERKSSKSHRSANKTSEDRERYKRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLC9	Uncharacterized protein	0.614	89-90	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLK8	Uncharacterized protein	0.944	16-34	ERKQRKAAEGKTRKKEEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMN1	Uncharacterized protein	0.825	455-472	RPSQRKLKGIRRIGRANR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N158	AB hydrolase-1 domain-containing protein	0.998	544-621	KRLDKEHKQAFKKYEQDVKARIKAIKERDKAIEKERSKREKEKQKREKEEQKRLQQEEKKREKEAKEKAKQKEKDEKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N158	AB hydrolase-1 domain-containing protein	0.832	691-700	KEKKPKKLRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2G2	40S ribosomal protein S26	0.951	3-19	KKRKNNGRNKKGRGHVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2G2	40S ribosomal protein S26	0.907	85-109	RVRSREGRRNRAPPPRVRYNKDGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3L0	Uncharacterized protein	0.716	249-258	KLPPKPSKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3L0	Uncharacterized protein	0.684	701-710	RKEERAAKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5S6	CMGC/CLK protein kinase	0.81	115-122	PRKRRRSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7V7	Uncharacterized protein	0.998	335-368	PPKEPGKRPRGRPKGSKATKVRKDKGMRKVLAKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7V7	Uncharacterized protein	0.983	419-437	PKKRGRPKGSKNRPKERTG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7V7	Uncharacterized protein	0.817	450-459	SKMKKPKKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9R6	Uncharacterized protein	0.911	692-712	KAKTRSRNARRRALKQALKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9R6	Uncharacterized protein	0.831	818-825	RGGKRKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB5	Replication factor C subunit 1	0.993	1024-1051	KDKYIKQPKAKPAKKAAPAKKKTAAAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB5	Replication factor C subunit 1	0.979	1067-1084	KPAAKGRGRPTKAGKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB5	Replication factor C subunit 1	0.952	265-280	KPRKKPAAKPRATKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB5	Replication factor C subunit 1	0.842	455-472	KAKRLAAEKARKAAGAKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB5	Replication factor C subunit 1	0.747	214-224	RLASRGRPRRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB5	Replication factor C subunit 1	0.69	17-32	PAKPAASKKENEPVKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAB5	Replication factor C subunit 1	0.655	247-250	RKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDT9	Calponin-homology (CH) domain-containing protein	0.722	336-343	EKRRKEEE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDT9	Calponin-homology (CH) domain-containing protein	0.639	501-508	PPPNKLRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDT9	Calponin-homology (CH) domain-containing protein	0.612	346-348	ERR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFF6	Uncharacterized protein	0.998	4-348	RPPPNRPPPPGKPPPSKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFGKPPAPDSPPPNRPLPPVRPPADNPPPPGKPPPNKLEGFGKPPAPASPPPGKPPPNKLEGFGKPPAPASPPPNRPPPPVRPPADNPPPPGKPPPNKLEGFGRPPAPDSPPPNRPPPPVRPPGLGRPPPNKPPPPVEPPAPERAPAPGKPPPSKPPPPARPPGRPPASKPPPPGRPPPSRLAGSGRPPPNKLAGSGSPSPNKLAGSGSPPPSKLAGSGKAPAPGRPPPNKPPPPDRPPPSRLAGSGKPPPSKLAGSGKPPPNKPPPGGRPPPSNPPPPVRPPPPGE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFF6	Uncharacterized protein	0.638	377-387	ARPPPPDRPPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKV6	Uncharacterized protein	0.751	18-29	RKPKKSHATNRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKV6	Uncharacterized protein	0.733	978-993	SSRRSRKASAMGAAGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKV6	Uncharacterized protein	0.647	266-272	KARAEKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQP9	Peroxin-1	0.896	222-265	KERSKPSRPGKSSSKGGRSVDGASGKSSSSTVRRNRRSKSEERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQP9	Peroxin-1	0.724	1154-1164	LAKKAAKASKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSM6	Uncharacterized protein	0.841	8-24	KKPATNAKGQNGRRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUS3	Uncharacterized protein	0.682	196-201	KARKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVM9	Uncharacterized protein	0.932	663-686	KHKRRLDRRWNKRAYHKRAARGVA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8N3	Uncharacterized protein	0.865	57-65	RKKNRRPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8N3	Uncharacterized protein	0.648	829-832	KKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI58	Integral membrane protein	0.673	442-456	RNSRGKQPERTGRTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIT2	Uncharacterized protein	1	340-384	KPKNPKKRKQGSKSQAPKSKKAPGPPAKKRKTTRPKPKRSKKQRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIT2	Uncharacterized protein	0.995	1288-1317	KRPLGPGADTRKGIKRRRVPSKRRPESKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIT2	Uncharacterized protein	0.947	1013-1024	GNRRKKARAKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJA2	Uncharacterized protein	0.939	991-1088	KARDRDRRRDDEKDRERDRDRDRDRDREGDDERRRTRRREKDEDSDDREPDRKDRTRDRDDDRERDRDRDRRERDRDRDRDRNRDRDRDDERRRPSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJA2	Uncharacterized protein	0.914	790-828	PPPKEMPVRREPSPERRRTSARDISAERRRPRENSPARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJA2	Uncharacterized protein	0.905	448-465	RRRERRERRKLYHGEPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJV8	Prion formation protein 1	0.998	1072-1096	KFKAKKKKKKTKKELKEQEVRRRLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGY7	Uncharacterized protein	0.877	89-118	RESKKRQEKAEKERQEERQRAEKAEKERQE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKW7	Uncharacterized protein	0.981	479-542	GGRKPRPLPARAPAPEGPKRARGRPAMETSSTESKPRGRPSKVVASNGVEKPKSPPARHGRKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKW7	Uncharacterized protein	0.923	379-410	PKKRQRKSTGTKQEGQGSTEKRRGRPPKSANR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKW7	Uncharacterized protein	0.744	563-571	GRGRPRKSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKW7	Uncharacterized protein	0.671	147-155	LRRKIIARH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLQ1	Uncharacterized protein	0.998	214-456	PPPPPPPPPKEEPKPEPKPEPKPEPKPEPKPEPKPEPKPEAKPQPKPEPKPEPKPEAKPEPKAEPKPDYKSAWERAREETRKREEERKKKEEEQKKREAIAARLKQLREKEARERAEREREKAEKEAREKAEREKKERELREALEKKEQELRELREKEQRERELRELRAKELAERLAKERLEKEKLEKEKAERDRLEKERLEKERLEKERLEKERVEKERLEKERLEKERLEKEKEAQEPRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN17	Transcription elongation factor 1 homolog	0.942	3-16	KRKSSSKPPPKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRH5	Kinesin motor domain-containing protein	0.678	1757-1762	KKNKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSP0	tRNA-splicing endonuclease subunit Sen34	0.973	87-111	KAVKEARESGALAGKGKKGKRRAET
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVS7	Required for respiratory growth protein 9, mitochondrial	0.991	20-64	RKKRRLETANAKDKKDSKIDKHKGKEADRKKQTRASAEEPKPKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVS7	Required for respiratory growth protein 9, mitochondrial	0.859	159-192	QGTKPPKKWREEGVKPNWDAKREFVKRKMEFRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWM8	Fungal specific transcription factor domain-containing protein	0.806	113-123	RAPRRPRPKDP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXW1	CCHC-type domain-containing protein (Fragment)	0.925	345-362	REERKQKSRGKDRKEKYP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4G6	Uncharacterized protein	0.94	334-345	IRKRAKRGKKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB61	Uncharacterized protein	0.999	71-199	KKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKPGKPEKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGG0	Uncharacterized protein	0.76	58-68	GRRLKAPKKDS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ84	Uncharacterized protein	0.937	53-79	QTPKKSPMKQPPPATPRLRKKVPWKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJC8	Uncharacterized protein	0.665	113-123	KDRNRRSIFRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNR5	Uncharacterized protein	0.818	320-351	VRGSKSKTSPPKTAKGQKNMGFTRRRSIKMQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPA7	DNA repair protein RAD16	0.839	259-280	PRKQAHRVDRRASQPIPKRRKI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS54	Uncharacterized protein	0.971	378-396	AQIKERKEKLKKQKKAAKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS54	Uncharacterized protein	0.933	356-368	KPAKKKNKKAKVD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS54	Uncharacterized protein	0.814	322-334	KKEKANVGKKRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS54	Uncharacterized protein	0.777	178-204	KRPVPVKLHRPDKKADGVKSTPGQKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUU4	CCHC-type domain-containing protein	0.949	267-306	SRPRGGSNNRDRDRHRDRDRDRERHRGRDRDRNFGSKNQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUU4	CCHC-type domain-containing protein	0.896	687-698	PEKKAAKPKRRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUU4	CCHC-type domain-containing protein	0.816	618-639	RSRPQSRSRSRSRSSSRQRGRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV75	Uncharacterized protein	0.821	340-349	RPKIKRRKMK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW77	Transcription initiation factor IIF subunit alpha	0.972	488-539	AKEKEAKEKEAKEKEAKEAKEKEKLAVGASAKGSGTSPSKNKQGKSLKRPGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW77	Transcription initiation factor IIF subunit alpha	0.755	444-455	EGKRVRKALARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW77	Transcription initiation factor IIF subunit alpha	0.733	551-557	SRKKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW77	Transcription initiation factor IIF subunit alpha	0.63	20-25	RPYRKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXS4	Transcription elongation factor SPT5	0.779	91-99	HRRKRQKDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXS4	Transcription elongation factor SPT5	0.723	356-366	KRKRFAPGPRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6D6	Histone H1	0.999	84-218	GPSGGTKLAKKAPPKKEAAPKKVAKKDDAKAAPKKAAPKKAAAPKEKEKDAAEKPAAPKKAAPKKPAAPKKDAAPKEKKEPKEKKPAADKALSKTKTGRVSKTAAPAKPAAAKKAAPKKATAPKKATPKKTEKAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7L9	Midasin	0.623	611-618	RRSGRVAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8V3	Uncharacterized protein	0.951	275-289	RRRKADRKRARAARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCF3	Uncharacterized protein	0.959	200-259	KTTKATQTKKTKTKPAAKGTVPARGATAAGAAPAAKTRIKAGRVDKAARRAAIGRAAEGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCW9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.994	430-465	RRRERELKSREQARAARIKKIKSKAYRRVHRKEKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCW9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.949	829-864	RKNQKKFLTKVEGVKKKNRKDAKLERVIISEKRIKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCW9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.869	699-714	GASKKAEGKSDKRRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCW9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.853	162-171	KKPAKRKSKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCW9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.836	16-25	KGKGKGKKPQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCW9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.685	100-105	RKRAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEZ3	MAS3 protein	0.668	302-311	AKNKNNKNRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF40	Non-reducing end alpha-L-arabinofuranosidase	0.651	400-406	KWKHSKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGD9	Proteasome activator subunit 4	0.779	1111-1128	IKKRHKFILERRAKVEAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGS7	Mediator of RNA polymerase II transcription subunit 6	0.99	302-324	KSEKTGKTGGPPKPKRRKSKGGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RLF4	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.618	121-124	RKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPY5	Mago-bind domain-containing protein	0.949	94-108	KNAKRREARKKAKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPY5	Mago-bind domain-containing protein	0.926	140-157	KEKKIRNLKKKLKQAKEL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQA3	Uncharacterized protein	0.846	93-102	KAENKKKKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQA3	Uncharacterized protein	0.837	299-308	RPKKKSRSRQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRZ8	Ribonuclease H2 subunit B	0.928	405-446	EKRRKMEEEDKRKKMNESRGVKQLKKVNVSGMKKLSEFFKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYG3	Uncharacterized protein	0.62	25-30	PSPSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYG3	Uncharacterized protein	0.606	23-23	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0K6	U3 small nucleolar RNA-associated protein 20	0.999	2634-2678	KQKREERGKKRKIEAVTNRDKYHAEKRKKFEKKKERRKAKGQEHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N939	Oxidoreductase-like domain-containing protein	0.722	274-282	KKLKEKHKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCU4	Uncharacterized protein	0.986	310-348	ERVRAEREEKLRARREDAERRRREIEERRREVGEKRAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND35	RING-15 protein	0.913	649-658	GGAKKKKKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND35	RING-15 protein	0.848	47-64	AAPRKGQGHKKQHRNSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND35	RING-15 protein	0.739	486-493	RRRKRNRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDJ5	Uncharacterized protein	0.695	133-138	RKNRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NG23	Uncharacterized protein	0.613	208-209	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NG56	Uncharacterized protein	0.932	220-237	ERGGLKRKRLKSQRWRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH57	Uncharacterized protein	0.909	1098-1109	RKPRRKKSVEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH57	Uncharacterized protein	0.72	1680-1685	KTKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHE1	Ubiquitinyl hydrolase 1	0.847	686-700	NKRKGEQSAKKGKKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHX3	Uncharacterized protein	0.911	21-61	KRPRPTKPPTPPPGPRPGPLAPIPPGNPTPPPSPRRRASHK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R4R3	Topoisomerase 1-associated factor 1	0.984	557-570	RSRKRTRKKKKAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R4R3	Topoisomerase 1-associated factor 1	0.961	954-971	RKSDVRPKKKLTRRKRSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R4R3	Topoisomerase 1-associated factor 1	0.844	1075-1082	RSKRRKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R4R3	Topoisomerase 1-associated factor 1	0.767	1116-1123	PLPKRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R4R3	Topoisomerase 1-associated factor 1	0.67	985-998	RLRREKDLEKQRKI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R4R3	Topoisomerase 1-associated factor 1	0.617	341-343	RRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMK0	Uncharacterized protein	0.996	118-169	KPEAKAGKSKKDKGKKPEEQPKEQPKEEPKAKEEPKAKEEPKKNAKDNKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMK0	Uncharacterized protein	0.925	250-269	RKQKSSDQKKQLEKRKKKSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNE9	40S ribosomal protein S9	0.918	289-307	ERKKPGHVKARKMPAWVKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPH4	MFS domain-containing protein	0.99	624-644	KEKMGEIKAKRLRRKSRRRGE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR27	Uncharacterized protein	0.88	203-225	KKRLKQLAADWLRRPGPVKKRKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR98	Uncharacterized protein	0.927	607-622	KAAPKKKDTKAKDKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N150	Anaphase-promoting complex subunit cut9	0.965	631-654	GAAGRPVRDKGKGKERAGTRHRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N493	Uncharacterized protein	0.872	509-538	RTHKSHKSRKHRDEDVPERKSSRSKDKDKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N493	Uncharacterized protein	0.763	543-554	ESGRSRRHHKHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N493	Uncharacterized protein	0.762	632-641	KSLFKKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N774	Uncharacterized protein	0.944	360-378	GKDVRPKSRKRGRSPDEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N774	Uncharacterized protein	0.683	735-740	PGRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N774	Uncharacterized protein	0.61	354-355	RK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N864	DNA polymerase epsilon subunit C	0.986	376-390	EPKKKGRGGRKKKVT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8F3	RING finger domain-containing protein	0.805	339-357	RRRQRERAQRNRTERRRDT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8F3	RING finger domain-containing protein	0.606	257-258	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC86	Ubiquitin-protein ligase E3A	0.753	245-251	KKKKRSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC86	Ubiquitin-protein ligase E3A	0.656	835-842	KKQKEKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEA8	DNA-binding protein RAP1	0.918	571-592	RHLGKRHRTTEAVNGRRKRKRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGC4	Uncharacterized protein	0.994	297-319	PKRKRKASGSSGKESRKKKSKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGC4	Uncharacterized protein	0.919	180-194	AERKALRKARKEARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGC4	Uncharacterized protein	0.871	130-141	SSKKSKKSRKLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGC4	Uncharacterized protein	0.687	958-962	KRKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGC4	Uncharacterized protein	0.666	1154-1158	RKRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGC4	Uncharacterized protein	0.64	1168-1172	RKTRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK15	Uncharacterized protein	0.922	239-249	RRRRPRRPWRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NL37	DNA polymerase	0.98	1663-1679	GPRPPPQPAPKKKKKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NL37	DNA polymerase	0.661	517-523	SKRPRIR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLU6	Uncharacterized protein	0.991	158-183	DKKTQQRKNRKTGARGKKGQKKNKED
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM94	Uncharacterized protein	0.851	476-487	GKGKGGRHGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRQ4	Phosphatidylinositol 4-kinase	0.808	1578-1591	KPLIKKSKEEKKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS37	Amidohydrolase	0.69	37-47	FRHRRGGNGFR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSR9	Uncharacterized protein	0.858	226-235	RDKGKRRHRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA8	SWR1-complex protein 4	0.88	626-656	PGSRGSRPGSRNKRSASVLSAGSDKGKRQKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA8	SWR1-complex protein 4	0.694	61-69	KRRQASRKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0S0	GATA-type domain-containing protein	0.833	180-187	KPRKKKSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1V1	Uncharacterized protein	0.989	12-33	KGLRLKGAKVKKNKKKKTEGSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N215	Uncharacterized protein	0.894	16-43	SRARAKGGGGRPDAAKVSKRTPGGDRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3I0	Lysine--tRNA ligase	0.993	32-64	LKRRQKARQKADEKAKKAAAAPPKPAAAKKAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N871	Uncharacterized protein	0.889	35-50	APKGKPKAGPRRTIAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8I1	Uncharacterized protein	0.668	164-170	PKSKRQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N997	Uncharacterized protein	0.999	165-202	GGKIKKDKKDKKDKKDKKEKKDKKDKVKKVKDKHKRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAH0	Uncharacterized protein	0.999	31-101	KEKKAKDKKAKDKKAKGKPAKGKPAKGRPAKGKPAKGKPAKPKPAPKPAPKPAPKPAPKPAPKPAPKPAPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAZ3	Uncharacterized protein	0.999	52-76	PAKPKRSKSKKKSKKEAKPPPGKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHU5	Elongation factor 3	0.997	1022-1046	KKAKKLTSAEARKKKKERMARRKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLZ8	4-coumarate-CoA ligase 2	0.769	564-587	KILRRLLRDRERTKAGSEGGKKSF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM38	Uncharacterized protein	0.696	127-138	KRYRPAKQRLPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQQ1	Uncharacterized protein	0.996	59-92	APKKRKGNASRKKKTYKPTGKSPLPGERKAFRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTU5	Transmembrane and coiled-coil domain-containing protein 4	0.947	1075-1094	KANKGGWLSFGRKRKAPKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX28	Uncharacterized protein	0.826	455-472	RPSQRKLKGIRRIGRANR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXS6	Calpain catalytic domain-containing protein	0.999	678-708	VREVLTAKKAKAKAKAKRARKRAEEEKKWKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXS6	Calpain catalytic domain-containing protein	0.99	651-676	EVRKKEKAKRKLKKAIMEDRHLRYRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXS6	Calpain catalytic domain-containing protein	0.705	24-30	ARRKGRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYK8	U3 small nucleolar RNA-associated protein 11	0.936	261-279	RGAVTKSGKKIKKVFERKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYK8	U3 small nucleolar RNA-associated protein 11	0.837	221-239	ALKLERLRRNLRNARRKLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYK8	U3 small nucleolar RNA-associated protein 11	0.611	165-167	RRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.997	912-960	KSKDKDKEKKKEKEKEKEPKLSKKEQEKLDKEKEKERKKAEKAEKERAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.994	1112-1164	EAKKKSKSSSKDKEKSSSKSKSKDKDAKSSSKDKDKDKDKKSKDKDKDKEKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.993	1762-1850	DAERAERRRMRRERERQAAAASAPEDGHPEARPERHRRGHESEREDDEERRRRREARRAAREAEAGGGGKSSSRRHRGENPYPREADRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.98	424-474	SKKDKKKKKGAAEEVKEEPPKEPDPPPPPAEDIWGAAASKKDTKKKKGKAS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.98	1684-1749	RRAARRARRAERGGVDPRHADEARVEKDEARRERRRKHEDENAEARRQEEREARRAERRAQRARDE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.974	1312-1326	PAEESGKKKKKSKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.972	1440-1501	KPSKKERAKISREGSASWGMWNAAPRKEEKRPSRSERKESGSSSKTREERPERIKEAPAKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.961	655-672	KKDKDKDKEKDKKKKTKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.937	711-723	SKKDKKKKGKTAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.924	791-801	GKKDKDKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.92	252-260	GKKKKGKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.911	755-764	KKDKKKKGKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.905	614-622	KKDKKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.889	526-534	KKDKKKKKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.882	832-844	KKDKDKDKKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.843	1391-1403	KKSSKKSKSRSKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.835	1881-1893	RREARRAARRRSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.812	390-397	GKKKGKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.809	175-181	KKKKKAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.755	1590-1599	KPSRRRSKRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.747	1914-1924	RRRRHRDEARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.713	1031-1039	KKDKGRPKM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I3	Uncharacterized protein	0.689	348-353	PKPKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7A0	SH3 domain-containing protein	0.995	431-460	KDDKKKKDKKEKEKKPSAIRSFFSRGGKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NG86	Chromo domain-containing protein	0.628	129-131	RRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT47	Uncharacterized protein	0.711	5-22	RRNRDRGHRSDPMGKPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV94	Sister chromatid cohesion protein	0.999	1886-1920	ARGRKRKAPGTPGGRKKRPRSNSQPRKRGRPRKNP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV94	Sister chromatid cohesion protein	0.769	186-191	PKKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWV6	Multidrug resistance-associated protein 2	0.885	335-347	KENKDKKKKGSKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWV6	Multidrug resistance-associated protein 2	0.663	598-603	KEKKPV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZD0	Rho-type GTPase-activating protein 1	0.649	812-818	GKKNVKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1U8	Dolichol kinase	0.976	150-181	RKAPPGPRQDASVRDRRAKAEKTRRKKEIIRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1U8	Dolichol kinase	0.671	557-563	PSGRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N322	Prolyl peptidase	0.971	353-367	DKRGTKRRRLSKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6H8	Annexin ANXC4	0.883	8-27	RRRGRSRSPGGRDRSRSREP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7T6	DUF2040 domain-containing protein	0.67	173-184	DRKIAEDKKMKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCM8	Uncharacterized protein	0.64	95-100	RRGGAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDY7	HMG box-containing protein	0.786	642-653	AKVKPKTKGAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDY7	HMG box-containing protein	0.709	590-605	PRGAAAGGKPGESKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDY7	HMG box-containing protein	0.602	179-179	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEL9	Uncharacterized protein	0.908	847-862	PRKRGRRAEKVASRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEL9	Uncharacterized protein	0.806	490-502	RRRPEPSRSRKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEL9	Uncharacterized protein	0.717	526-538	KPPARVAKKAEPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGJ0	Uncharacterized protein	0.964	296-306	SKSKKKKKKGM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH2	E3 ubiquitin-protein ligase UPL3	0.644	77-81	RPKRQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIX1	Structural maintenance of chromosomes protein 5	0.647	327-337	NKKTEAERKLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q527H0	Pre-mRNA-splicing factor CLF1	0.865	627-635	PRRTKKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMY5	Uncharacterized protein	0.853	339-353	RGRKGRSRGDKLRMK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNJ9	ANK_REP_REGION domain-containing protein	0.871	189-197	RRKKVKRRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS17	Uncharacterized protein	0.997	111-152	KKKEEERKKKDEEERKKDEERKKKEEEERKKKEEDEKNKDNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW88	Inner centromere protein	0.954	981-1012	AAARKKEAEEREAEAKRQAKLEKERKREREQQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW88	Inner centromere protein	0.909	739-779	RANTRKTRASAEREKRELEKEKLEQKQREKAAKEAQRAAKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW88	Inner centromere protein	0.832	829-858	RMEEEARRRPASPVKETPKVTRSSPRKGKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW88	Inner centromere protein	0.666	71-80	RGRTPRTARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW88	Inner centromere protein	0.606	824-825	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXW9	CCHC-type domain-containing protein	0.947	344-372	EREERKQKSRGKDRKEKYPYSPDKNRKSN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N170	Zn(2)-C6 fungal-type domain-containing protein	0.879	18-27	AARKRRRRAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1C0	Uncharacterized protein	0.775	456-466	RKGRRQTKRGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1C0	Uncharacterized protein	0.677	635-642	KGQSKKKW
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N273	UV-damage endonuclease	0.982	612-627	KLSKAKNGRPGKRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2I9	Uncharacterized protein	0.613	86-87	RK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6W3	Glucan 1,3-beta-glucosidase 2	0.996	73-163	RERDRDVARDKERHRQREEEREYERVRVRDHERSRDQRRERDSRARRPERTEYKEVDRLEDAHRPKKDKKRKKRIVSGAALEEGRGKDLRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6W3	Glucan 1,3-beta-glucosidase 2	0.892	12-27	RHREAGSRKHHKRKSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6W3	Glucan 1,3-beta-glucosidase 2	0.645	183-189	KKQPRWK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEI7	Ribosome biogenesis protein SSF1	0.991	373-413	KAMEKKWEQKQREKEARKKVQKENVERKRKEKEEQKKNSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1G4	rRNA biogenesis protein RRP36	0.983	290-313	DKAIEKKRKKVAGKEKKQLPFARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1G4	rRNA biogenesis protein RRP36	0.981	211-274	RKKGVTPADREDAKLKLRKMEDEKRSQDRKDREHELMREHKKKEKELVKQGKKPFFLKKSEQKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1G4	rRNA biogenesis protein RRP36	0.76	6-23	RKRKAAFDPERRVKVRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1G4	rRNA biogenesis protein RRP36	0.67	148-169	SSKRPVSRYREVVKPPPNARPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1G4	rRNA biogenesis protein RRP36	0.669	91-97	KRQKPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R1G4	rRNA biogenesis protein RRP36	0.669	136-144	PGRKTKSAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSP4	Mannan polymerase II complex ANP1 subunit	0.812	490-509	KPAKAKKESEAGKDAKAAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV23	Uncharacterized protein	0.93	418-434	PRPHRKRRSGVAAGKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4Q9	Uncharacterized protein	0.62	14-16	KPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5K4	C-4 methylsterol oxidase	0.963	292-309	ARKRREKKLAALKAKKAQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N791	SNF2 family ATP-dependent chromatin-remodeling factor snf21	0.997	1530-1543	RKAKKKKKKKLKLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N791	SNF2 family ATP-dependent chromatin-remodeling factor snf21	0.905	76-101	KVPHKRFIRQAAEHFRKRSRKYKQKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N791	SNF2 family ATP-dependent chromatin-remodeling factor snf21	0.81	503-511	KKRRVKRDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9M4	Uncharacterized protein	0.992	101-136	KIKAEREAEREAERKAQRKAEREAKRKAQRKAEREA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDL6	40S ribosomal protein S7	0.925	102-125	RRILPRPKRSNRSRNTQKQKRPRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEN5	Uncharacterized protein	0.968	49-87	PRPAPGTKRKPARETLQARRPAQRARNATPKGRAPKRQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NG28	tRNA-binding domain-containing protein	0.939	187-201	QKKKEKKEKAPKQQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NG28	tRNA-binding domain-containing protein	0.663	131-138	KEKLKKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QTC6	ATP-dependent RNA helicase MRH4, mitochondrial	0.698	125-134	GREGGKKLGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QTC6	ATP-dependent RNA helicase MRH4, mitochondrial	0.607	84-86	KPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLY8	Uncharacterized protein	1	79-110	GEGRQKDRRKKKSRAKRRAKRRGDKVSRRPRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPF0	Zinc finger protein	0.823	505-514	PQAKRRKGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRT7	DUF1752 domain-containing protein	0.892	374-387	RRTKIKKKRPVLRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU66	Endopolyphosphatase	0.999	468-491	EKKKKKKGRKDKPKPKDPNLIKPE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU66	Endopolyphosphatase	0.998	638-657	KKGKKNKKDKNKKKHKKHNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU66	Endopolyphosphatase	0.736	540-551	RSGKPGNKPSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU66	Endopolyphosphatase	0.652	389-392	KKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVC9	DNA helicase	0.622	676-678	KKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYL6	Urease	0.825	152-160	KGRRRRRLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ01	SHSP domain-containing protein	0.933	161-198	RGGGRRRHHHHRGSPSPDGGPHRHHQHHHHHRRRQGPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ01	SHSP domain-containing protein	0.628	86-90	RRHGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8S8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.942	407-427	KRQQKMKKKNNRGGARGGRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8S8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.913	495-513	RDRGRGRGRGRGGFRGGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBW6	WD repeat-containing protein 44	0.982	1070-1095	EKIKEASKMSKEKGKEKEKEKERKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	D4NXE7	40S ribosomal protein S1	0.958	5-20	KNKRLSKGKKGLKKKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKU8	Uncharacterized protein	0.997	173-198	IREKKKDKKKKEEEKERRHRRTAGGD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKU8	Uncharacterized protein	0.913	210-225	QKEKHKHKHKHTRPAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC0	Uncharacterized protein	0.999	322-355	EDKKRKKADKDAKEKEKKKNKNKKKDKKAIRSKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNP0	C2 domain-containing protein	0.862	524-549	DKKEKGEGKENEDKKETEEKKPKRSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP47	Uncharacterized protein	0.672	1307-1315	KKVRREIAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRP2	Uncharacterized protein	0.776	84-108	KHKAIARRLKSRLSTWRLVPKLPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1J1	Nonselective cation channel	0.612	626-627	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1P4	Uncharacterized protein	0.987	39-61	RRTKLTPARRRRRSARPNARRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1P4	Uncharacterized protein	0.947	566-580	SNRRKRKREGDRRSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1P4	Uncharacterized protein	0.762	7-14	RNRKKRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7K5	Rho-GAP domain-containing protein	0.9	670-682	KDKKRRWRLSRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKR9	Histidine kinase G7	0.81	497-504	RKRHKKRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	O13353	Chitin synthase 4	0.891	158-197	RKSRKASGRETVAEKSDNTRRRVSTRNSKIVKEGKRKEKI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A0A151V4R1	Uncharacterized protein	0.86	105-114	HDRRRRRSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS7	Uncharacterized protein	0.861	1027-1047	RATSRGRGRDSSKTRKSKSRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS7	Uncharacterized protein	0.787	1246-1268	RQLKKEAAARELEERRKSLARRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS7	Uncharacterized protein	0.784	1129-1152	ANGGSRPSSRGRRTASPERIGRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS7	Uncharacterized protein	0.635	1193-1195	RKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMB5	Uncharacterized protein	0.999	708-806	REKKAAKNRRARQKKKARKQRQREEEERAAAIIAKKGVKDEQKKESKDEQKKSDAKAPATTLPMTKQKTKKNKKQNNTPVAKSPAKVLSGGMDGRKKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMB5	Uncharacterized protein	0.608	402-403	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPG8	SAM_MT_RSMB_NOP domain-containing protein	0.937	354-379	KKSQSNSKGGKRKRQDEQDRKSKKNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRQ9	Uncharacterized protein	0.931	1043-1060	ERRRYRRRLARRGLIKKW
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRQ9	Uncharacterized protein	0.63	745-748	RRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MST3	Uncharacterized protein	0.945	51-104	QSRRDTKKDEKEHSKVKRQRVADSQPEKPKEKPKEKETVAAPIEKEQPKSSKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MST3	Uncharacterized protein	0.904	223-254	KKKTQKAKAPQPVETKKQRQNRKKVEAAKAMR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW87	J domain-containing protein	0.861	584-600	SGSPSRPPMRPPKRRPT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1G2	Uncharacterized protein	0.853	396-413	RKDKSRLISRRRKLEKAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4B2	Uncharacterized protein	0.997	613-672	AKHAQRRSWREERRERRRDRRAEWRERREAKREVRSAKRALKREARDLRWGRRREGGPLG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4B2	Uncharacterized protein	0.713	354-368	RGARHGFGRGRGGGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7G3	Uncharacterized protein	0.998	104-127	KPRDKSKKKAKAKKRKGGAVTGKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NA00	Uncharacterized protein	0.941	196-214	RMRRRDRSRERSRARSRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NA00	Uncharacterized protein	0.775	448-463	RRGVRIEKDKKGPPPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB16	EF hand domain-containing protein	0.913	52-63	AVRRRRPPRRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB16	EF hand domain-containing protein	0.778	594-610	RRTRIVARKKLIERWKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBG8	Uncharacterized protein	0.605	340-341	RK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBS8	Uncharacterized protein	0.968	279-291	DKPKRKPSRRRKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGT5	Uncharacterized protein	0.881	53-73	SKKQKHRKSHMTSKMRRRQEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHE1	Uncharacterized protein	0.969	11-19	KKKKRRKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLI4	BZIP domain-containing protein	0.608	367-368	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML87	CFEM domain-containing protein	0.678	301-305	PRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML87	CFEM domain-containing protein	0.62	284-287	RSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNM7	Uncharacterized protein	0.707	245-270	RGRPWKGALVRIPSKASLKGLKFRSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU50	DNA polymerase kappa	0.983	607-634	RRPKQLPERKRGRTPKNPDPKQKKIRFG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV11	Uncharacterized protein	0.999	128-140	RSKKKKKKKTKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV11	Uncharacterized protein	0.914	7-25	KRQTKLRKSKAKHASRRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWL7	Uncharacterized protein	0.959	607-622	LAKKAAQGPAKKKRKF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWL7	Uncharacterized protein	0.908	476-503	PKPTAKAKKGGLGRIGGLGKAKNTSKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWL7	Uncharacterized protein	0.665	321-329	KRATRDRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX09	Uncharacterized protein	0.617	17-20	PRPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX09	Uncharacterized protein	0.601	22-22	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY44	Uncharacterized protein	0.807	340-357	KRSQKSASGPGRATKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYP7	Uncharacterized protein	0.776	501-510	RRRRQRRSRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYT5	Uncharacterized protein	0.92	18-41	AKRKAPSGASAGASKPAPKKRQSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ37	Tyrosine-protein phosphatase 1	0.961	936-965	KRQRQRAARRLSAAAAAREKRVRREGIKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZE6	Origin recognition complex subunit	0.64	32-35	PKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZS4	Uncharacterized protein	0.786	59-72	KKVRSRKAFHRRTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3B4	tRNA pseudouridine synthase 1	0.991	29-83	RGNRGGRGGGQRNQRGGRGGRGGRRGGWEDNKGKDGWNRKRHRDRDDRPNFPSKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5B1	PHD-type domain-containing protein	0.772	165-173	LKKARKVRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6G1	Histidine--tRNA ligase	0.738	426-433	KKKAPKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6U1	Uncharacterized protein	0.999	211-234	RRKPPPPRRKPKGPGRGRKKGRLP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N725	DUF1708 domain-containing protein	0.982	755-786	KKQQKKLHKEKEKEKGSGGFRKLFGRKKDKEP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N770	Uncharacterized protein	0.995	1285-1357	RKKKRKYDDRSEQQSTAKKARSQVKSNPRESKPKTPRPSARKPAASRSKSAAKSRKTQAASSSPIPEHERRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N770	Uncharacterized protein	0.672	1494-1499	KKKAPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N865	Uncharacterized protein	0.837	652-672	RLKPRKYGGIHKRNSRPGIRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBI6	Peroxisomal biogenesis factor 6	0.938	7-16	RKRRRRRRQD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBI6	Peroxisomal biogenesis factor 6	0.738	1323-1331	KGKGKGKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCI3	DUF4050 domain-containing protein	0.854	506-540	RARRRVEKEREQRRQELMRKEAGAGGGGGGGGGHG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGH0	Uncharacterized protein	0.932	487-515	DKERWARLRRVKSLFDPKGKHKLKRSQSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIJ4	Uncharacterized protein	0.796	423-432	RAWRRRKARE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPE5	Uncharacterized protein	0.953	146-163	EKLAAHRRTRAKLRKKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV2	Chromodomain helicase DNA binding protein	0.994	1398-1449	RGTPRPDKRKHENDHDERGHKHRRVEERHGKDKEKRKKLDPEAIERLKKARE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV2	Chromodomain helicase DNA binding protein	0.915	167-179	ARKGPKKRRVERS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV2	Chromodomain helicase DNA binding protein	0.617	1093-1094	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N162	Fungal specific transcription factor domain-containing protein	0.679	726-730	GRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N446	Kinesin-like protein	0.788	333-340	KKRRKSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6C7	Transporter sec24	0.795	111-117	GKKKKKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6I1	Zn(2)-C6 fungal-type domain-containing protein	0.767	18-39	ASRKTTSGPKPMKAPQRSSKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N730	Uncharacterized protein	0.996	150-186	KKKKKKEKEKEPTTPKLAEDKKTKRRSRLSKLAPRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N730	Uncharacterized protein	0.643	831-835	SRARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9C5	Uncharacterized protein	0.802	121-132	NRTWKGKGKRPE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBA5	Coiled-coil domain-containing protein 130	0.712	300-309	PRREKPRMLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBA5	Coiled-coil domain-containing protein 130	0.651	349-357	RIIPGLKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBA5	Coiled-coil domain-containing protein 130	0.616	289-292	EKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCG9	Ribosome biogenesis protein TSR1	0.876	15-42	GNKPFKSRKATKGAIRTLAKGKVPTEKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE25	Uncharacterized protein	0.899	378-388	KSKKKKNGGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q51MB1	pH-response regulator protein palI/RIM9	0.686	183-188	RKARKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52B63	Pre-mRNA-splicing factor CWC22	0.992	673-907	SPSPRRRSYSRSRSRSVTPRRTNSNGRNNARSPSRSVSRSISRSRSPAPIRGRSYSRSVSRSRSRSYSRSVSRSPTPPRRQAPAQQRGRQRSYTPSDRSRSRSYSRSRSPRGRSYTRSPDRAGPQASTAPRSGGPPRKAGSVDNRSPLSRSPSGSRSPSPRRRRDSPSRSPVRDRESGGRAAAAAPGNSEARRGRSYSRSPSRTRSPSPAPSRRRRRDSSSDASAPRKRRRESSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52B63	Pre-mRNA-splicing factor CWC22	0.991	13-101	SPRPRSPSPAAPSRSWSRSRHESPSRSPAPMRERREEEGNEQRSPRQIAHHPRSPRGSDRRAEPRRRDAGGGGGDKYRPAKARKQRSPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC4	Uncharacterized protein	0.954	463-484	KGNDAKKKKNYYRKRKSNQKKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPK1	Uncharacterized protein	0.983	530-569	RSRKVTSPRRMHSPPPRARGRSPPPRRLFDRHSPPRRMRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPK1	Uncharacterized protein	0.915	632-685	AHKDKRHVRGAIDIVKGLEQRRQRRREKLSRQQCNRARKGLAQEKRPAPGKGAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSA3	60S ribosomal protein L18	0.993	145-184	REAVKHFGFGPHKHKKPYVQSKGRKFEKARGRRRSRGFKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSA5	RRM domain-containing protein	0.994	98-142	RDRGSDRGDRSRRSPRRGRSPSPPRRRDYSPRKDDRRDRDRDRDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTL1	Elongator complex protein 1	0.985	1174-1190	THKNRKREEKKRARGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU13	Uncharacterized protein	0.645	21-25	RRRRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU57	Uncharacterized protein	0.709	160-167	LVKRPRHK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N302	Uncharacterized protein	0.991	292-364	AEKKRLAAEAKARVKAESEAAKQAEEEAAAVRKEEEKARKEEEKKEKARVKEEQKQADRKRKAEERLEKESKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N302	Uncharacterized protein	0.696	228-233	RRKAKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N651	Uncharacterized protein	0.882	41-55	RNRHKRQDRGLGRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBR0	Uncharacterized protein	0.647	150-154	RRRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJN9	Zn(2)-C6 fungal-type domain-containing protein	0.832	30-39	SKPPRKRRPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RMA9	rRNA-processing protein EFG1	0.662	109-114	RKKAQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RMA9	rRNA-processing protein EFG1	0.625	93-99	HRSHKIG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKY0	Chromatin structure-remodeling complex protein RSC7	0.941	134-150	PRRRGRGGWRGRGGRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKY0	Chromatin structure-remodeling complex protein RSC7	0.831	103-114	RRKRLGRPPKNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMH9	Amidohydrolase 3	0.803	266-278	TPRPKPRARPHVP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMH9	Amidohydrolase 3	0.73	572-581	ENRRRVRRQA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMH9	Amidohydrolase 3	0.607	256-258	RWR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTY4	WD_REPEATS_REGION domain-containing protein	0.745	196-203	REPKRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTY4	WD_REPEATS_REGION domain-containing protein	0.668	243-247	RKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZL3	Uncharacterized protein	0.624	328-330	RKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F4	Uncharacterized protein	0.865	76-102	RGEKRYHDAHKNHHHGRGRKTPAQKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F4	Uncharacterized protein	0.679	506-521	KRGKLSDQRPGRARWA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7B6	Transcription elongation factor S-II	0.727	79-85	AEKRKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F9	Protein SDA1	0.986	260-288	IGINKKTKKKEKTLKNAVAKVKKAEKKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F9	Protein SDA1	0.973	656-745	KLRKSTKEERIALAKEGKPDREEHKSTKAIRKSQKEARGGSTTNKDKARKKNFLMTLGKAKHKQKRSLVQTKKVLQAHIERSKGGGRRRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F9	Protein SDA1	0.845	503-513	EEEKKRKRAEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCA1	Small nucleolar ribonucleoprotein complex subunit	0.904	495-515	RMRGKNSALKKYLRKQRKKNV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCA1	Small nucleolar ribonucleoprotein complex subunit	0.725	40-47	KKRRQKQA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCA1	Small nucleolar ribonucleoprotein complex subunit	0.603	65-65	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND64	Phospholipase D	0.987	79-92	AKVKKKRRRMRRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND64	Phospholipase D	0.748	569-581	REIAAKRTKKDKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND64	Phospholipase D	0.678	1580-1585	RRKRGN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFU3	Vacuolar calcium ion transporter	0.998	412-430	RHLKKDRKRRKHHKRRRSN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFU3	Vacuolar calcium ion transporter	0.95	334-351	RSTAKRIKRKIRRATTRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH01	Uncharacterized protein	0.793	125-148	MKERAPRSTAKRGGYRPAYSRPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK40	Uncharacterized protein	0.859	536-550	PPVRRRRRTSGSRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52F10	Pre-mRNA-splicing factor CWC26	0.988	19-35	KPSKKRKRKHGDSKKIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52F10	Pre-mRNA-splicing factor CWC26	0.706	291-299	GGRRVKGRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52F10	Pre-mRNA-splicing factor CWC26	0.627	211-221	RKAEAEKQRAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MME8	Uncharacterized protein	0.737	28-44	RERARLSKREFKPIPDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MME8	Uncharacterized protein	0.648	805-808	KRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMR9	Uncharacterized protein	0.773	213-220	PGPRRKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMT7	Uncharacterized protein	0.839	560-576	PGRGDAKLPAERKKRAM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMT7	Uncharacterized protein	0.736	499-518	REPRARHLRRTQAAREAARE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMT7	Uncharacterized protein	0.624	524-528	LRRSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNZ0	CAMKK/META protein kinase	0.694	154-160	KKRRLGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNZ0	CAMKK/META protein kinase	0.654	676-694	KKAVGKVIHPRGDRPEHSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUJ1	Uncharacterized protein	0.987	416-446	KGKRKRAADDDAGYRPKGGSARPSKKKRKSE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUJ1	Uncharacterized protein	0.763	75-84	WKKKYRKMRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUJ1	Uncharacterized protein	0.731	340-354	SRSRAKFEPAKRGGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVC1	Clr2 domain-containing protein	0.96	155-173	MLGKPKAKESKKPAQKRKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVC1	Clr2 domain-containing protein	0.736	245-257	PAKPPAKPAAKPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVY8	Uncharacterized protein	0.703	437-442	RRRKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZL9	GRAM domain-containing protein YSP2	0.975	1007-1020	VAAKGKKKGRKGRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZL9	GRAM domain-containing protein YSP2	0.934	21-32	RALAEKRRRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZL9	GRAM domain-containing protein YSP2	0.656	184-196	RRSPSPVGRFRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N077	DnaJ domain-containing protein	0.989	413-428	GKSSGNKPGKRKNKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N077	DnaJ domain-containing protein	0.859	84-100	RTRQAKEDKSKKPKPPT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N077	DnaJ domain-containing protein	0.721	240-264	RRMQERETRREASKGAVSRTARRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N814	CDC7 protein kinase	0.802	158-169	SKHRNQPRRKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAE9	Uncharacterized protein	0.885	83-99	KKSATPKTPRDKGKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC04	rRNA-processing protein FCF2	0.754	183-199	GRKGSYKKMMAQRYKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDW6	CP-type G domain-containing protein	0.996	7-50	KPKKPMSKRTPVRLRNKIEKASKAKQRKDRKLAKKNPQWVSKVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHC5	General transcription and DNA repair factor IIH subunit TFB4	0.974	353-364	VPRVRKKKKRKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH0	MFS domain-containing protein	0.834	345-353	RAKAKRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHH0	MFS domain-containing protein	0.775	610-622	AKRARRLARALRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHZ1	Glutamine--tRNA ligase	0.971	26-62	ELKKRMQKRAKKAAQAKAKEAAQATAGDAEKKAPAKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHC8	Uncharacterized protein	0.624	53-55	RRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHE4	Uncharacterized protein	0.61	23-25	KDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMF4	Uncharacterized protein	0.61	19-20	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMF4	Uncharacterized protein	0.602	14-14	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN00	Uncharacterized protein	0.989	241-294	KRKPRSRRSHSRSRSRPRSGGSGSDGSRKPDNSGKELFPDLGKKKERRTGVRNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN00	Uncharacterized protein	0.637	429-433	GRPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTB9	Uncharacterized protein	0.662	434-437	RKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY40	TAFII55_N domain-containing protein	0.858	93-113	KIPVKTKAGRVTKPSAKKRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0E8	GTP binding protein Bms1	0.992	1091-1155	RKDVAEKRRAKKEEHRAAYRKTLAEAEEKKAARERRENKEYWNREGKNMKRKEAGGGGGGGKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0E8	GTP binding protein Bms1	0.983	5-25	KHKPHRKSKEKKKHSGPNPKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0E8	GTP binding protein Bms1	0.766	316-326	KKGRKRLDEKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2B1	Phospholipid-transporting ATPase	0.942	192-210	RLERSKKGKIGVKRPSKRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N471	Potassium/sodium efflux P-type ATPase	0.863	242-259	TRKKPKAGRSMNWRKYGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6U6	Uncharacterized protein	0.936	137-161	GAKATRSKSNESKKKVKDKPAGGRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAK1	Rho guanine nucleotide exchange factor scd1	0.87	487-508	SKDKKDKTKSTGPKIRNKGAKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH3	Uncharacterized protein	0.997	101-197	RRRDDSRGRPRSPLPRRSPPPPRRSPIRRSPLPRYGGSPRRMDGRARSPPRRDYDGPRRRSRSPIDRMRRSRSPVRRSPIPPPPRSYRPPRSRSPPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH3	Uncharacterized protein	0.876	31-84	RSPRRPARSPLMRGDRDRPRSPPADSYVPPPRRHQRSRSPDRFRGGGGGGGGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCH3	Uncharacterized protein	0.74	351-374	APKSPPRGPAALRGAPPTGPRENR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEX0	Uncharacterized protein	0.916	122-133	WKRKHKAAKRKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGG2	Uncharacterized protein	0.949	92-103	AKKPRRGRPRKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGG2	Uncharacterized protein	0.757	131-139	RAGKRRRTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGG2	Uncharacterized protein	0.756	38-46	KAASRRKRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHC1	tRNA (Uracil-5-)-methyltransferase	0.953	72-91	KKGGKQQRWNKKRKERSPVP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHC1	tRNA (Uracil-5-)-methyltransferase	0.81	100-110	SKRERAKLRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMZ9	Uncharacterized protein	0.82	26-39	EHKTRSKSPRKPHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMZ9	Uncharacterized protein	0.606	13-14	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP50	Uncharacterized protein	0.907	196-221	PQPGRRRRATLAPRPGTARSRGKGSF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP50	Uncharacterized protein	0.63	69-73	PHRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPZ5	HeLo domain-containing protein	0.981	325-342	KKRLKLHRDRLRKKSKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPZ5	HeLo domain-containing protein	0.646	584-586	KKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRH6	ERCC4 domain-containing protein	0.917	319-337	SKSPPPRKRPAAARSKSGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRH6	ERCC4 domain-containing protein	0.858	360-393	QEKAAARKAESERKRLEVEQARIGKKLEKERAKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRH6	ERCC4 domain-containing protein	0.775	581-589	RRRKPAKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRW1	rRNA processing protein Ebp2	0.996	19-46	YRKIKEKRKVKANLKEKEKKKAEKAKRY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRW1	rRNA processing protein Ebp2	0.994	418-446	RMKGKGGKGPRSAPRPGKSKRVAMASKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRW1	rRNA processing protein Ebp2	0.971	116-138	IIRPKKSKDKKETKDRTSKKAKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRW1	rRNA processing protein Ebp2	0.951	362-399	KPSGGKRNSAFGDRNRDEPNRKRQKKNDKYGFGGKKKY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRW1	rRNA processing protein Ebp2	0.913	291-336	KKAAAEARKLRDLKKFGKQVQVAKLQERAKAKKDTLEKIKDLKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSS1	Sec1 family superfamily protein	0.988	731-755	APAKPEKEKKKRNIFGIKKDKKEKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUZ6	BZIP domain-containing protein	0.927	128-162	KAPAKRKRENRYKNAPPSVLSRRRAQNRASQRAYR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW58	MRC1 domain-containing protein	0.754	1378-1389	KERRREQRKFKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW58	MRC1 domain-containing protein	0.623	1106-1110	RRMKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N775	Tetratricopeptide repeat protein 1	0.994	1037-1069	KIKRKRKAAGGGGGKSGESRGAKGARSSRKKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N775	Tetratricopeptide repeat protein 1	0.835	977-1004	LKKREEEKQKAAEAERERQEKIRKEREA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N775	Tetratricopeptide repeat protein 1	0.734	1088-1093	PKKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7A4	BRCT domain-containing protein	0.777	86-96	KAKNKGKRGSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N884	Uncharacterized protein	0.968	291-309	RAERRLQRDERKKGKGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCA5	Uncharacterized protein	0.919	145-156	AKKKRKGWTKKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEL4	Reduced viability upon starvation protein 167	0.858	382-395	AKPKPPPPKPKPSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFQ9	Uncharacterized protein	0.938	367-387	PRKISRKGKEKERQLKPMGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGV1	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	0.697	10-22	SRGKDPNKSSKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHG0	DNA ligase	0.842	643-663	KAKGKTKTRADNAEPKRTRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJA9	Serologically defined colon cancer antigen 1	0.926	846-862	KKGQPKRGQRAKAKKIA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJA9	Serologically defined colon cancer antigen 1	0.858	1064-1074	GDRGGKGSKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJA9	Serologically defined colon cancer antigen 1	0.838	893-923	AKAKAEEAAALEAARERRREQHRRQQKEAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH54	Uncharacterized protein	0.755	141-158	RGGPGIAKKSAPPEKPAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH54	Uncharacterized protein	0.667	90-95	RTRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QYM6	ATP-dependent RNA helicase DRS1	0.997	695-790	EKDKKAAREAGRAALNGVREALKKKHGGKNLSNKDKKKLDAMAEAKEARVWKKGAAERAGKGAVLNFKKDKSSKKGPVVGGRVAKKGAPRGKPRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QYM6	ATP-dependent RNA helicase DRS1	0.992	38-57	PPKKKSKTIPKKKQKRSSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QYM6	ATP-dependent RNA helicase DRS1	0.765	132-141	RRRREKKEGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML62	TBC domain-containing protein	0.862	668-687	KKKEWQRAEKWRKMAKINRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMY9	60S ribosomal protein L12	0.815	87-99	EPPRDRKKEKNIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPC0	SANT domain-containing protein	0.999	866-891	KKKELNLKEKLKKQPKKRKKGRGKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPC0	SANT domain-containing protein	0.969	964-981	GTEKPEKKTRKRQPKEKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPC0	SANT domain-containing protein	0.831	306-315	PRPKPRRKPI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPC0	SANT domain-containing protein	0.728	1179-1191	KQRGQKRPPPPTP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM6	Vacuolar transporter chaperone 2	0.787	156-167	KKHDRKRGGRYR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU83	Uncharacterized protein	0.605	116-116	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZQ4	Uncharacterized protein	0.999	277-350	KLSRSNEEAKPKDAKDVDRIAKASEAKDVKKAVASSPPKEPAAAPPKGGADTKKKEKKKRSEEERKARKEKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZQ4	Uncharacterized protein	0.853	940-964	SKKLPRVKKAKDMSKHLLANARKIR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZQ4	Uncharacterized protein	0.741	481-488	RYRKRSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZQ4	Uncharacterized protein	0.702	262-273	SKKKPLTEKGEG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.99	659-736	PPPGPFRPGVRQPGMPPPPMMPGPPRPGGPMPRPGPGPAVVEPRESKKKSSSKSKPPGGILGGLFGAPKPVKKKKKHN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.968	505-561	ARKKLEAEKEAAEKAAKDAEEKKKMEDALKKKYQEEGKLKAEAEEKKKEKPPIKFKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.934	299-348	EAERKREEERRREHEENMKRIEREAREKIERERREDEERREAHARALKQA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.634	365-369	ERKAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.62	371-373	DKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.618	490-492	RKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.612	481-482	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.605	353-353	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N199	Uncharacterized protein	0.604	406-407	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2F8	Uncharacterized protein	0.985	40-67	PNPRKRARKEASKPEDGGDKKRGRGRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N366	Uncharacterized protein	0.723	124-139	RRRKSIWSKRNVARVG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N366	Uncharacterized protein	0.605	142-142	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3T1	Uncharacterized protein	0.73	99-104	PRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4S3	Hydrolase	0.897	441-476	RRRRERSLSVDKRGSRRESTENGRAKRSSSRLRRLS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4S3	Hydrolase	0.861	700-710	KTPRKKRKNGQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGU7	Skeletal muscle and kidney-enriched inositol phosphatase	0.792	174-194	PPPRRSGELKRERDRGPDAKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGU7	Skeletal muscle and kidney-enriched inositol phosphatase	0.678	1179-1190	RKAHRSPSRGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHL1	Ubiquitin carboxyl-terminal hydrolase	0.924	378-387	RSRKRRKKNP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHL1	Ubiquitin carboxyl-terminal hydrolase	0.658	403-406	EKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML01	Poly [ADP-ribose] polymerase	0.97	156-176	KDKGKQPAKKRKAANGKANGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML01	Poly [ADP-ribose] polymerase	0.917	195-208	AKAKPAKGKKAVKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML01	Poly [ADP-ribose] polymerase	0.603	142-143	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN15	WAPL domain-containing protein	0.79	118-133	KRKPTHPPGARLPKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP41	Uncharacterized protein	0.986	442-488	RSRSRSRRPRSRSSSRGGSRSQSRKGVRARSRSVVDGARRRLARIGI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP41	Uncharacterized protein	0.984	266-302	EKDRDRDGRSETRSRAGSRPRGSRSRSRSKSPEKKNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP41	Uncharacterized protein	0.745	526-537	RRRHSRSRSRGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP41	Uncharacterized protein	0.667	504-514	RGSSRGDGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP41	Uncharacterized protein	0.636	562-565	RKRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRX7	Vacuolar amino acid transporter 3	0.987	351-365	GRRKRRRKHRGGSGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV6	Pre-mRNA-processing protein prp40	0.988	691-800	RHRDRDYRARSRDRDRDRARDRDRSRDRERDRERERDRARDRESDRVPRSRRDDDRSRERERDRDRERDRDRDRERARDRDYDRPPRSRRDDGPGHYDRERREREESRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV6	Pre-mRNA-processing protein prp40	0.924	602-648	RRLREKEEDAERDRQRRRERDERASYRDKDRGERSHRHGGRAARSSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV6	Pre-mRNA-processing protein prp40	0.827	847-864	EPDRRDSKRLKRESSREK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV6	Pre-mRNA-processing protein prp40	0.622	532-536	RKEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV6	Pre-mRNA-processing protein prp40	0.614	842-843	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSX4	Uncharacterized protein	0.687	340-348	RRNARRPAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSX4	Uncharacterized protein	0.602	390-390	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUP6	Bromodomain containing 1	0.855	1198-1217	KRSISSVRHRKGVRTSARRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUP6	Bromodomain containing 1	0.783	13-22	PARRRGRPRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUP6	Bromodomain containing 1	0.701	40-45	PPKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXK1	Uncharacterized protein	0.87	296-307	KTKKNKDRRRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY41	Uncharacterized protein	0.726	119-129	SKKQRRLAAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY41	Uncharacterized protein	0.618	186-189	KERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1S3	Ras-like protein 1	0.696	222-234	RGSRKDGEKHRSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH49	Pathway-specific nitrogen regulator	0.629	837-842	RLRQKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPF4	BHLH domain-containing protein	0.837	284-292	KRKRRRESH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTU3	Periodic tryptophan protein 1	0.99	258-268	GKKKKKKKSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUN2	25S rRNA adenine-N(1) methyltransferase	0.781	18-31	PNFHQKPKSIKRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ64	Uncharacterized protein	0.914	120-128	KKKKKPPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N223	Uncharacterized protein	0.994	120-168	ERRRKRLADKRKLKLAARRIDSGIKNRTDKQEKRARRVAGSRKIKTDKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4M3	H/ACA ribonucleoprotein complex subunit 2	0.997	14-48	AARLKKEKKEKKRSEKDGVSKSSKKDKKDKKSKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4M3	H/ACA ribonucleoprotein complex subunit 2	0.899	111-139	KKVLKAIKKATKKHALLRGVKEVNKALRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4M3	H/ACA ribonucleoprotein complex subunit 2	0.641	210-217	KREADKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEE1	DUF1279 domain-containing protein	0.782	85-106	RPAAPRRTFHSSKSRRSNKEKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8V2	Patatin-like phospholipase domain-containing protein MGG_12849	0.988	145-165	RQKKSSRRRKRSKAVAPGRRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MND4	Uncharacterized protein	0.681	21-25	KRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY58	G patch domain-containing protein 1	0.843	258-266	PKKKEKKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY58	G patch domain-containing protein 1	0.729	321-336	KPVFKSRKLGKLGLRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY58	G patch domain-containing protein 1	0.691	300-304	KKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0F6	DNA repair protein RAD14	0.976	331-366	RESDKRRRKESKFKEKLADLKRRTRTDAYRRENTKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5C9	DNA repair and recombination protein RAD26	0.713	249-254	PRKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N836	C2H2 type zinc finger domain-containing protein	0.872	557-568	PSRGRRRRHGPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8C2	Uncharacterized protein	0.712	35-43	KKYASRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIN2	Uncharacterized protein	0.869	360-379	KTKHAIHNRMHRGGGGGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIN2	Uncharacterized protein	0.815	224-260	RGRHRSSSNRGEDERGRRSRSNHESTAGGRSKSRSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIN2	Uncharacterized protein	0.718	44-62	RRRRESSRREPMSSGRRYS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIN2	Uncharacterized protein	0.602	65-65	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIN2	Uncharacterized protein	0.602	69-69	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLU5	Mediator complex subunit 12	0.955	144-175	PRRRNRFPVPDPRRKSAPAPPPPLKKDARPRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHY7	Uncharacterized protein	0.905	429-440	KPRKSRAHRKKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHY7	Uncharacterized protein	0.838	278-288	KTRRRTKPRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHY7	Uncharacterized protein	0.725	451-460	PFKKSHRRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R596	Vacuolar membrane-associated protein IML1	0.73	1364-1379	KEKDKDKEKDKDKEKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML64	DIL and Ankyrin domain-containing protein	0.919	491-518	KRKKEVKEEPLERRYRPPSPKQRAKPAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	1	86-124	RDPRKKKNKKNKKKKGKKGKKKNKKAKAKNAKAAQAGKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	221-243	EPKRRKGGKRKGGKKANGKKNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	260-283	REPKKRKGGKRKGGKKANGKKNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	300-323	REPKKRKGGKRKGGKKANGKKNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	355-377	EPKKRKGGKRKGGKKANGKKNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	409-431	EPKKRKGGKRKGGKKANGKKNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	448-471	REPKKRKGGKRKGGKKANGKKNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	488-511	REPKKRKGGKRKGGKKANGKKNKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX80	Uncharacterized protein	0.999	543-566	EPKKRKGGKRKGGKKANGKKNKRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXG1	Uncharacterized protein	0.955	112-131	RRRQQRRQKRAKQRAGQRRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZL1	Uncharacterized protein	0.79	146-168	KFANRIGRRISVLVRRPGKKQPD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N498	Zn(2)-C6 fungal-type domain-containing protein	0.886	109-122	RRRSGSRSPKRRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6U3	Uncharacterized protein	0.997	210-246	SKEIKDKHLRRLEELRRAQTAHLKSKKKKKSKNRKPD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N753	Uncharacterized protein	0.941	9-18	GDKKPKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N753	Uncharacterized protein	0.809	225-245	RFKPRIKVSKEEKARERISRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCG6	Uncharacterized protein	0.982	308-322	GIKKRTSKKREKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCS1	Mitochondrial Rho GTPase	0.979	413-424	TKPRKRRRKPGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHD6	Nucleolar protein 9	0.999	521-564	EKKDKVKKAEKDQGDKKDKKDKKDKKDKKEKKDRKDKPAVSQEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHD6	Nucleolar protein 9	0.962	735-780	RWAKTPQPRVKEERPGQKGDKKDGRGPNGRQFTDKDGKDKDKKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHD6	Nucleolar protein 9	0.938	3-20	KRKSEQHRGHHGRKRRRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHJ8	Lovastatin nonaketide synthase	0.975	216-232	RRRLRKRGRRGGGHLKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJU7	RRM domain-containing protein	0.995	12-88	RGSRANRHRRSPSRGRSRTPSHSRSPSPRRNGRSRGADSRSRSRSRSRTRSRTRTRSPSAGRSPSRGRDVRMRSRTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJU7	RRM domain-containing protein	0.921	221-295	RGSRGRGGGGGGPPAGPRGGRNNDVYRPSSRSKSPDAGRAGGYRSRSPGSAYSNRSESRSRRRGGGGARRETGGD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJU7	RRM domain-containing protein	0.813	312-330	GGRRSRSRSQSRGRGGRSY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJU7	RRM domain-containing protein	0.675	297-303	YGRRRSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLC0	Uncharacterized protein	0.998	716-767	KLLKKELTGGGSGGKKGGSIGSKSRQGGKKLKNKMKKKLGGGRKFHDGKTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLC0	Uncharacterized protein	0.926	585-617	KGDPGKQGPKGEPGRPGPKGKDGMPGPMGLPGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLC0	Uncharacterized protein	0.84	636-647	KPKDVKKKGGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLC0	Uncharacterized protein	0.786	432-446	KDAKKEEPKKEEPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLL7	Branchpoint-bridging protein	0.982	59-82	AKRGRSPEPRSEADGPKRRKKRNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN58	Replication termination factor 2	0.993	198-225	HNLKKDKSNGKKKKRKAEDGKEDAIKGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN58	Replication termination factor 2	0.682	262-267	KRRKLA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPT8	Uncharacterized protein	0.995	175-211	REARRKKKEARDRERERRREEKAQAKEEKNAAKRGEG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPT8	Uncharacterized protein	0.671	447-456	RRQRRGGGYR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSM4	SCD domain-containing protein	0.992	92-134	PRPRKRNNARSNGKSKKPATKKPKINGSGLSHSASIPSRPKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSM4	SCD domain-containing protein	0.872	1126-1138	KKKSRPKGKQPAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSM4	SCD domain-containing protein	0.679	44-49	AGKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSM4	SCD domain-containing protein	0.63	1092-1095	RLKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2Z9	CAMK protein kinase	0.989	24-44	KPKASKPRKFPKPKGKREQGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4T5	Uncharacterized protein	0.964	350-388	ANGEGPSRKRKSRSITASPAEPPPEPERKLKRPRAHRSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5I2	Uncharacterized protein	0.931	13-28	RRRIQRKEGTRKRKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W5	Uncharacterized protein	0.943	458-471	KAKRPQPKKKSYRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE82	HMG box domain-containing protein	0.781	86-99	PKEKPLRTKRGHRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH92	3-oxo-5-alpha-steroid 4-dehydrogenase 2	0.661	188-194	RREERRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKA8	Uncharacterized protein	0.827	515-524	RRLKRKLRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKA8	Uncharacterized protein	0.674	107-113	RRRRVSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS1	RRM domain-containing protein	0.992	178-214	RGATAGKGAGAGAQANGAKGAKKAAPRKGRNARPAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS1	RRM domain-containing protein	0.91	19-61	RTAGRRGGAARRSTGRPAPAAPVGGIHKNPRAARSAVQKPAPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMM8	Uncharacterized protein	0.881	50-73	GKTRKNKQNAKRVTKRSHTKLRVR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW13	Methyltransf_11 domain-containing protein	0.807	294-305	RKREEEKRRRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N319	Uncharacterized protein	0.994	60-82	RVRREARRAKKAKAKKNESRQKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3D0	Uncharacterized protein	0.96	247-285	RPPNPRRASAPVRPKPVRKEGSARTSPSRSNKESRSRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3D0	Uncharacterized protein	0.955	365-382	KPAPAPKRKTRPPIRRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3S5	Uncharacterized protein	0.972	51-64	PSKGKRTKKKSKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5Z7	Uncharacterized protein	0.948	49-95	RTRGQKRSKAEQREWERAEQERIRKELEKEQNATKARAARERKKAKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCG4	BHLH domain-containing protein	0.966	442-463	KSKGKAKPNARPRPQRKLKTTP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCG4	BHLH domain-containing protein	0.643	505-508	KRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDL5	Dynactin Arp1 p62 subunit RO2	0.711	185-197	GGRPRLSRKEQKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEC4	Uncharacterized protein	0.941	5-14	ARKKKKRGPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52E73	Pre-mRNA-splicing factor SPP2	0.761	238-250	KPRGPKTKDVKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52E73	Pre-mRNA-splicing factor SPP2	0.715	277-297	RSRPKRLNDYKREERERQDKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4REU9	ATP-dependent RNA helicase MAK5	0.976	130-155	KKQQTKQPKSETKEKKEKPAKAKKNE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4REU9	ATP-dependent RNA helicase MAK5	0.975	9-40	KRKLDSKQNTSPKRRKVQANGKAQPKAKKPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4REU9	ATP-dependent RNA helicase MAK5	0.653	606-610	KGKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4REU9	ATP-dependent RNA helicase MAK5	0.624	687-690	RKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKP7	Bromo domain-containing protein	0.873	73-104	RRRQRRLGCLRKPAIRPPTRVFLPTRRVKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML90	WD domain-containing protein	0.859	74-87	PKKKTSHMKKRHRQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQI4	Uncharacterized protein	0.804	456-471	PSQRKLKGIRRIGRAN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU78	Uncharacterized protein	0.881	200-212	PRTRARLGKKRKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3K7	TATA-binding protein-associated factor MOT1	0.907	703-721	RRPSPPESGERSAKRRRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3K7	TATA-binding protein-associated factor MOT1	0.88	222-233	KRKRKREAQKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N597	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	0.679	345-350	KPKKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N744	HDAC_interact domain-containing protein	0.626	567-569	KRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N829	60S ribosomal protein L29	0.941	14-62	RKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTAKAIKEFKEGKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAD3	60S ribosomal protein L3	0.944	18-39	PRKRAARHRGKVKSFPKDDPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAD3	60S ribosomal protein L3	0.72	124-136	KSKKKAFTKYAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAD3	60S ribosomal protein L3	0.675	237-245	KKLPRKTHK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDG5	Uncharacterized protein	0.624	254-257	KKKM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NER0	Polynucleotide adenylyltransferase	0.941	81-113	GGGRSGGRDHRRDRRDNRGYRPSRGGRPQPWRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ89	A to I editase domain-containing protein	0.76	58-64	PKKRKPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHP2	MFS domain-containing protein	0.652	93-100	RFGSRRSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI22	PHD-type domain-containing protein	0.998	117-158	PKRKKKGTATTVKATKKGGPSRAKSKKGGAKKGGATAKKTPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRB5	Ribosomal protein L19	0.964	140-181	EHIHRAKAEKQRERLLKDEMDAKRAKTKAARERKLERQAAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRB5	Ribosomal protein L19	0.898	61-83	ARARELNLARRIGRHRGFGKRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRB5	Ribosomal protein L19	0.611	135-137	KRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N027	G-patch domain-containing protein	0.969	84-97	GKRHRGGRKAKKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N027	G-patch domain-containing protein	0.777	144-160	RRRREQNRIRSRSRGSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2K1	Uncharacterized protein	0.802	349-355	RKRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N462	Non-specific serine/threonine protein kinase	0.771	263-271	RRRRRREEL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N462	Non-specific serine/threonine protein kinase	0.76	41-65	NRGRPSRSPEPGYRSGSPRGSKRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N462	Non-specific serine/threonine protein kinase	0.699	138-149	KRARHRSRSPYR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9W9	40S ribosomal protein S6	0.926	217-239	KRVAEAKATKADARKRRASSMRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9W9	40S ribosomal protein S6	0.919	159-205	RREVQPKGEGKKPYTKAPKIQRLVTPQRLQHKRHRIALKKRQSEKVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9W9	40S ribosomal protein S6	0.727	131-143	KRLGPKRATKIRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC24	BTB domain and ankyrin repeat protein	0.989	1537-1598	SEGARGGRGRRGGRSGGKSRGGSAAAPAGGTSSPAEGPAADQKGPGRRSRGRARGRGDSKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLT2	Uncharacterized protein	0.997	70-87	PSRRRRKGARRRARKPKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MME3	Non-specific serine/threonine protein kinase	0.998	770-792	PEKKKKAHRGRRGGTKHRKKKRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPA4	C2H2-type domain-containing protein	0.995	182-209	APVARGRPRTAAPKGPPKPRGRPPRKPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPA4	C2H2-type domain-containing protein	0.877	139-150	PKKRGRPKGWKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPM9	BTB domain-containing protein	0.926	130-140	KSKKGKKMKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZN0	Uncharacterized protein	0.843	524-560	HRRPKPKAPSSGARHTGPGGSLVSPRKVSSGASPRKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0J6	Uncharacterized protein	0.942	835-851	KHRVKKNNKRKDKKDAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7X8	Zinc finger protein	0.815	69-78	RKGKPHKRRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBP1	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP2	0.842	7-16	KKRKKDKSGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND08	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.9	453-469	NRRGNYHRKRRRWARIR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND08	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.696	629-637	GKFVKKQKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE73	zf-LYAR domain-containing protein	0.99	264-293	KPTKTKKRKHGSPSAKKSSKHKSEHRRSSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE73	zf-LYAR domain-containing protein	0.978	171-183	KDKKKSKDKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEZ2	DNA mismatch repair protein	0.987	199-217	RPKKRKRANTKSGPPRKRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEZ2	DNA mismatch repair protein	0.743	419-428	RGGDKKNKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGF3	Mitochondrial ribosomal protein subunit S4	0.886	75-101	AIRRKMENDLAKKKHVTGRARHSRKAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGF3	Mitochondrial ribosomal protein subunit S4	0.646	624-627	RRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGR5	ASXH domain-containing protein	0.931	131-164	RPKRKRESKVQPSATAPAPAIKKALTPAAKRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R5B8	ATP-dependent RNA helicase DBP10	0.997	835-914	GGRRFNHKREDAPKEADKFRDDYHVRKKRVAEAKEKRIGKFRDGEGSKREIKNNDDIRKARKIKELKMRKNARPARKKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R5B8	ATP-dependent RNA helicase DBP10	0.936	346-362	GSKKRKRGPDRPNAKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMG1	Uncharacterized protein	0.991	85-109	LMKKKAKNKARVKASKHKTRRSTNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRI8	Uncharacterized protein	0.918	342-358	KTRISSKKGKRRAGSSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRI8	Uncharacterized protein	0.675	175-182	RGQKTRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVF5	Uncharacterized protein	0.906	70-90	RLTRISRIGRPKRSNRPNRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY84	Uncharacterized protein	0.737	671-682	RPRPIPRKPEKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY84	Uncharacterized protein	0.642	2030-2039	KTRPSTPPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY84	Uncharacterized protein	0.629	697-700	HKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYY6	Uncharacterized protein	0.661	111-115	KKRTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5M3	Uncharacterized protein	0.903	1085-1114	SRKEANKFRTRSLMARGRSKRGRTSWARTP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5M3	Uncharacterized protein	0.841	126-162	SARTRSPKPGIIRRATGGPPRSELWKHLMKLKDRIKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5M3	Uncharacterized protein	0.678	494-499	RSRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6V6	AGC/YANK protein kinase	0.9	541-559	RKKGRSHSPKPKERGVLGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAY9	Uncharacterized protein	0.766	111-120	KTRRAKRARN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDG7	YagE family protein	0.915	84-103	NKKATNKRTKGRGKNPLRAI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFR2	Clr5 domain-containing protein	0.987	93-119	RKRPVSKSKIDRYVRRSRSRRKKPARP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGW6	Uncharacterized protein	0.876	463-499	KPERGPRGWEAKRQGPKYRHLWKYTHRIATPKRKFVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8B5	ATP-dependent RNA helicase HAS1	0.625	8-10	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8B5	ATP-dependent RNA helicase HAS1	0.609	31-32	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNY4	Regulatory protein Cys-3	0.801	197-215	KRRRNTAASARFRVKKKQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNY4	Regulatory protein Cys-3	0.645	281-287	PKAEKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP99	Uncharacterized protein	0.733	261-280	KGNKDKANKRNLRLLLHRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP99	Uncharacterized protein	0.642	44-47	KKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ87	Integral membrane protein	0.671	144-158	RRERRAAAHTTHRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR54	BAH domain-containing protein	0.897	379-391	QKGGRGRGRRKAD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRT4	PUM-HD domain-containing protein	0.984	693-708	AAARKGRKDKRKGAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRT4	PUM-HD domain-containing protein	0.945	10-41	DKRKSSSSDKPPKSEKPTKKARSDKETSAPAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRT4	PUM-HD domain-containing protein	0.705	134-145	TKKLWERLRRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSK2	THO complex subunit 2	0.983	2341-2390	RSSSRKEHRESRSGRPSRRGSRDRSGDRGDRGDRESREHRESGRDRRSGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSK2	THO complex subunit 2	0.842	2493-2515	RRDGGSSGGRDDRGSRKRRSEDA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSK2	THO complex subunit 2	0.7	2468-2483	PGGGGSRGGRGGGGSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSK2	THO complex subunit 2	0.69	2522-2528	RDKRQRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV4	SLD3 domain-containing protein	0.956	415-428	KVKKKKSKKFKLGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV4	SLD3 domain-containing protein	0.944	597-627	GGPVKQSPRKPKREKPVSSASTKTKISSKPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTT1	Uncharacterized protein	0.705	51-59	GRRSRSKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXR7	Uncharacterized protein	0.827	170-195	YHSHRHSHRRHSSRGHSRHSHHSRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0G9	Uncharacterized protein	0.997	623-722	PKKRGPGRPPKNGIRSKREERLLRKAALEEAKKNAPPPVPGEPPIKRKVGRPRKNPLPEGAEDRPEKRKYKPRKPKNEDGEVSDGEKAAREKRKEKHKTP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0G9	Uncharacterized protein	0.984	367-383	KPPRKRRKRARATGDRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1I4	Uncharacterized protein	0.65	109-120	RHHHHHRHSRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N798	Non-specific serine/threonine protein kinase	0.716	103-109	RKTKRKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N941	Cytochrome b561 domain-containing protein	0.824	290-307	RRQSRAARKEAKRTERMA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND36	AMPK1_CBM domain-containing protein	0.658	499-502	KKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGX6	Uncharacterized protein	0.993	57-79	SAAPRTSNKFTKNKDGKKKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH26	Zuotin	0.995	289-364	ERIKRFRQEANAAKNKKKADKEAAEKKAIEDARLKKEAEEKAAKDAEEKAKADREAGKKAKEAAKNAVKKNKRVLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH26	Zuotin	0.944	258-279	MERKNANARKKKKVEDNARLRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH26	Zuotin	0.891	121-137	KRAHRKKVLKHHPDKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RPY8	Carboxypeptidase Y homolog A	0.606	84-85	PK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMW3	zf-3CxxC domain-containing protein (Fragment)	0.684	78-84	PRREKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPS6	Uncharacterized protein	0.925	561-590	RKTAGDEPSKAPEKATEKKEKPVRKGPAAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPS6	Uncharacterized protein	0.815	790-802	PKKLTKRAKSPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRH3	Uncharacterized protein	0.933	62-74	KEQKKEKPKEKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV06	Uncharacterized protein	0.696	32-37	RRRRHK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N054	Phosphoinositide phospholipase C	0.789	407-413	KKKKKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N057	RNA cytidine acetyltransferase	0.993	1059-1073	KRHKKAKKSKKEKGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N057	RNA cytidine acetyltransferase	0.908	69-84	HRRKRETKIKKEIKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N685	Rif1_N domain-containing protein	0.935	1133-1162	RRSPRKTPSASSGLRKSSVNKRRKTKASPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N685	Rif1_N domain-containing protein	0.811	1506-1519	KHLRRGRGRPSKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDF6	RRM domain-containing protein	0.924	492-514	TQKRNGKERERSPDRNDKNKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDF6	RRM domain-containing protein	0.855	344-355	SKKANGGKKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDF6	RRM domain-containing protein	0.685	554-563	DRGRSRSRSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDI2	Uncharacterized protein	0.745	41-51	RRRGTRRPDKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEF8	Rab-GAP TBC domain-containing protein	0.74	1070-1080	KAKKSSRKMGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEF8	Rab-GAP TBC domain-containing protein	0.726	1230-1236	GRRKHKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFQ7	Zn(2)-C6 fungal-type domain-containing protein	0.738	23-34	KRCRPGARGKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFV9	Uncharacterized protein	0.951	353-363	DKDKKKKKRDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKC5	Uncharacterized protein	0.806	165-174	RKRKARKEAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN22	Uncharacterized protein	0.882	88-101	TRPKRSPKPIRKPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN22	Uncharacterized protein	0.653	54-59	AKARRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPH6	Zn(2)-C6 fungal-type domain-containing protein	0.839	3-17	RPRKPGAPSPKRRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQF8	Uncharacterized protein	0.634	13-17	RARRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRJ6	Chromodomain-helicase-DNA-binding protein 3	0.658	295-302	KPAQPRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVB2	Probable electron transfer flavoprotein subunit beta	0.788	202-212	KAKKKPFEKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX46	Uncharacterized protein	0.872	518-535	KARRWEKRRPWARLFRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXG6	Uncharacterized protein	0.753	358-366	KAKHKGKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ70	U3 small nucleolar RNA-associated protein 13	0.898	173-181	GQKKKKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4L3	mRNA-capping enzyme subunit beta	0.777	174-186	RPPPSARRKMPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N513	Sphingosine N-acyltransferase lac1	0.845	67-76	KRAPRRRKAY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7T7	Uncharacterized protein	0.732	283-289	PTRKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGP3	Protein MAK16	0.986	288-309	SKNKSGDKRKRGRVVRMAKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGP3	Protein MAK16	0.912	140-163	VPKLAPKVRHREAARERKAERAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHB4	Uncharacterized protein	0.987	494-507	AKPKRKRGRPKKSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHB4	Uncharacterized protein	0.913	444-452	KKRGRKKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJG3	Ectonucleotide pyrophosphatase/phosphodiesterase 1	0.992	121-139	EKAADKRKQRKSRRKMKKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHW7	Uncharacterized protein	0.848	86-98	KGVKKKGEKGEKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM55	Ser/Thr protein phosphatase	0.955	300-317	RAKKPSNVKKPSKKAKRM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMF2	Uncharacterized protein	0.816	50-60	EKRKQKQSPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMS4	Uncharacterized protein	0.678	18-24	PRRKGSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN05	Protein transporter sec73	0.641	775-778	KKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPA1	Nucleolar protein 58	0.994	555-597	KKDLKKKRKSMDAGSEMGTPAGGEKRKRDDDEEKPKKKKKKHS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPA1	Nucleolar protein 58	0.819	468-475	KKKSKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPW8	HIT-type domain-containing protein	0.722	160-165	KKKKPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRE4	HIT-type domain-containing protein	0.944	328-336	RRKRRRKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRE4	HIT-type domain-containing protein	0.885	537-557	RGGGDNRQFGRGRGRGRGRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUE0	TRP_N domain-containing protein	0.681	634-638	RKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR1	tRNA-dihydrouridine synthase 3	0.99	382-405	AHKKRRKTHKKKMRAAETGIGKKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVA9	Uncharacterized protein	0.887	568-584	RRSLAGKPKAGLRSKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWQ3	Glycerol-3-phosphate acyltransferase	0.831	809-826	KAALKKTVKMERKRRTLE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N619	Uncharacterized protein	0.789	525-534	RRRRLRRKWA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB85	Uncharacterized protein	0.926	49-63	WRARRKRAKDVKKDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBI7	Sterol esterase 2	0.865	252-269	KRRASVRKELERRWRRRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBI7	Sterol esterase 2	0.662	355-359	KRKLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC78	Pre-rRNA processing protein Rrp12	0.997	1176-1238	KGKRDAGRGRGGGGGRGRGGRPDRGGRGGKGGIAAGRRGLGEGKQRGPAAAGVGKRSPGKGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC78	Pre-rRNA processing protein Rrp12	0.964	990-1006	GIRKTKERSKKKKEAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC78	Pre-rRNA processing protein Rrp12	0.917	1136-1156	KGKDAPKKGLRGKLKWSNKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC78	Pre-rRNA processing protein Rrp12	0.704	1086-1095	LKMRKAGKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEJ4	Uncharacterized protein	0.999	232-282	AKKDCDKKKDGKKPRKDRKGGKKNNGPKRPGKNSTMPMPKPKPATPKGKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEJ4	Uncharacterized protein	0.997	119-175	VKKKGEDAKKKAEDAKKKAEDAKKKSPPKVGVPVGKNNTKPGKPPKKSEPKKATPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEJ4	Uncharacterized protein	0.994	47-99	KRDPKSPGEVKEDLKKKIEADKEKARKKLEEAKKRLPKIPHLNITKPGMPPRQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEJ4	Uncharacterized protein	0.844	195-217	KKELEKLRHKFGKPKNGTAPAAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGU6	Protein FYV4, mitochondrial	0.952	200-225	KRGRKIDGGERRRAEVRFKRRVEERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHC7	HNH domain-containing protein	0.948	35-49	KTKKKRSSKRNSRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIK2	XAP5 domain-containing protein	0.917	81-91	KKSRKKQKRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLD3	Uncharacterized protein	0.829	515-525	AKREKAEGKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLD3	Uncharacterized protein	0.806	341-349	ARRRRRWRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R227	Chromatin-remodeling ATPase INO80	0.996	434-493	EPPIKREKSAKVEKAPRRPRVVEKEKKERVTKAPRKSAGAKGRASEVKAESTPKQSRRSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R227	Chromatin-remodeling ATPase INO80	0.977	725-744	GKGKGKGRAGNRPKKSKEQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R227	Chromatin-remodeling ATPase INO80	0.974	1916-1932	KPGKKKKATGKKAKTTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R227	Chromatin-remodeling ATPase INO80	0.963	1861-1874	VAKKRGGGKRKKVA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R227	Chromatin-remodeling ATPase INO80	0.911	631-645	KERKKDMQRKRRREK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMS1	Uncharacterized protein	0.979	204-228	HPRRRQRSRSRSPLAGKRHHRKLRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMS1	Uncharacterized protein	0.96	156-167	QKKRIRRRRKPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMS1	Uncharacterized protein	0.62	183-185	RRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMV6	JmjC domain-containing protein	0.989	842-865	PKRKYAPEPKRKPSERPRLKGKKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPE9	Ubiquitin carboxyl-terminal hydrolase	0.701	252-256	RRKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVU3	TBP-associated factor 4	0.677	575-579	KKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVU3	TBP-associated factor 4	0.647	495-500	KRQKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVU3	TBP-associated factor 4	0.641	505-508	GKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXX6	Uncharacterized protein	0.653	45-49	KRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXX9	Uncharacterized protein	0.804	456-471	PSQRKLKGIRRIGRAN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1S6	Uncharacterized protein	0.957	32-42	AEGRKKRKKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAA6	DDB1- and CUL4-associated factor 13	0.997	376-441	RRIKNHRHVPKVIKKAGEIKSEELRAIKRREENERKHSSKKFEKRKAEREKMILAKEKKSKKILRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGV0	CID domain-containing protein	0.949	332-393	KKMKARRQGRKPQNPSSRSRSQSSRDSRSLSRGRDRSRSRSSRSRSTSPQNFKRRRVSQSRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGV0	CID domain-containing protein	0.882	395-437	SSRSHSKGGRANRNRDYSSDRSRRRSRSYSPSRSRSRDPRQRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RN08	ATP-dependent DNA helicase MPH1	0.886	685-698	KARSTRGKKASKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RN08	ATP-dependent DNA helicase MPH1	0.863	870-883	ASPPPPGRKRKANT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RN08	ATP-dependent DNA helicase MPH1	0.719	724-733	KAKPNKSPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLV2	26S protease regulatory subunit 4	0.988	18-46	KDKKKDKPKYEPPPRPTTRVGRKKRRGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMV7	Uncharacterized protein	0.805	14-28	KSLNGRVPLRRKGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNF9	Helicase	0.993	56-77	RTEKKQAKGRRSAKKKKSIKSE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNF9	Helicase	0.741	247-257	KRMRKVKRLGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL0	Ulp1 protease	0.686	104-112	GRNRRPARP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWV3	Uncharacterized protein	0.991	96-185	HRRDDSVERKRHRDASERYRNSDRRRHRSHDQPRREHHRHRDEERGRERDRERDRDRDARHRQRPAHRRHSTGGEMRANKSQRRSRSRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXC1	Uncharacterized protein	0.831	540-556	WRKRRQEKAAAEKTGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N559	Uncharacterized protein	0.998	280-302	RSQRRSRRREANRRRRAKRRKDM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6C0	C2H2-type domain-containing protein	0.835	550-559	RPPKKTKPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N777	Uncharacterized protein	0.884	90-112	GKKSKPAKLRKDYWKPMAKIRFP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDE6	Uncharacterized protein	0.847	302-318	ARMIEKKRRHTVKRLTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEM7	Peroxin 24	0.938	502-520	KRGEWRRRRWTRLVRRKKF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHY1	Uncharacterized protein	0.992	282-325	GAAPPPPPPDAKGKDAKGKDAKGKDAKAKDAKAKDAKGKDDAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHY1	Uncharacterized protein	0.845	81-165	AKAGDAKAGDAKAGGDAKAGAKAGDAKAGDAAKAGDAAKAGDAAKAGAKAGDAAKAGDAAKAGDAKAGDAKAGGAAKAGDAAKAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHY1	Uncharacterized protein	0.679	366-375	GAGKGSGKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH39	Uncharacterized protein	0.979	323-342	RSPRRHRSRKKVPKAAAKAL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH39	Uncharacterized protein	0.753	255-264	KKPKGKPNLH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH39	Uncharacterized protein	0.603	266-266	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q2KG01	Protein EFR3	0.63	1133-1137	KSRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q2KG01	Protein EFR3	0.61	1029-1032	SRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q2KG01	Protein EFR3	0.601	1026-1026	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML76	Uncharacterized protein	0.931	80-112	TEPRKRRGRPSRSAGEVNAEVPALSKKRGRPPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML76	Uncharacterized protein	0.739	131-136	KRKRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML76	Uncharacterized protein	0.711	158-164	PAKKRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML76	Uncharacterized protein	0.637	217-221	SRPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQE0	Uncharacterized protein	0.823	113-121	QRRRRKAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQE0	Uncharacterized protein	0.794	194-207	RNKAKKKELGTRGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQQ2	Ribosome biogenesis regulatory protein	0.982	165-193	RGQTRRERVERQKRNERKMRKNERDAAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQQ2	Ribosome biogenesis regulatory protein	0.91	91-118	LPAAKEPTKWERFAAKKGIKPKTREQRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSF8	Uncharacterized protein	0.747	498-517	RRRTIIGNKPPRDLRHSRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUV6	Uncharacterized protein	0.918	1006-1035	SKRRRATVEASPATRVRPSRQAAKKAKPKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUV6	Uncharacterized protein	0.882	228-247	APKTKGKGKGSAKETARPSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N111	Quinic acid utilization activator	0.725	137-145	HKRWRKSRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N280	AAA domain-containing protein	0.655	370-375	RRRKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N767	Uncharacterized protein	0.992	220-252	RKSRNILGSRNKSAEKPGAKTKAKAGAKGTKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N767	Uncharacterized protein	0.848	189-199	RRPKRARRARL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8V4	Structural maintenance of chromosomes protein	0.928	113-126	PKKAAPRKRKSAAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEY6	Uncharacterized protein	0.712	671-680	DSKRGPPPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI26	Uncharacterized protein	0.975	145-177	PRSKPKKFRQSLRKSFLARRSMHKARKKPAIVP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI80	Deacetylase sirtuin-type domain-containing protein	0.985	756-784	KPPPRKKKLPGVQKLKIAATKKAPRPRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI80	Deacetylase sirtuin-type domain-containing protein	0.861	529-553	KGGKGISGRADKGAVDTGKPSKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI80	Deacetylase sirtuin-type domain-containing protein	0.75	849-855	PRKRKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NI80	Deacetylase sirtuin-type domain-containing protein	0.722	694-708	KKRNKPNNTARKPSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLC8	40S ribosomal protein S9	0.904	165-176	GRPGRVRRKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH07	Uncharacterized protein	0.935	113-153	GPGPGRGRPMQGPGGRGGMPPRGPMPPRGGGPGPGPGRGFH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC6	Uncharacterized protein	0.917	34-47	ARIARKRLRHRPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPK7	Uncharacterized protein	0.888	176-198	GPSRPKKSSSGSSERKKTRHSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPK7	Uncharacterized protein	0.839	248-261	AAGRPKSEKKKSSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPK7	Uncharacterized protein	0.721	154-163	KNSKKPRVGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRQ2	Uncharacterized protein	0.712	21-27	KKKEPKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVM7	RelA_SpoT domain-containing protein	0.711	292-297	EKRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW65	Uncharacterized protein	0.77	69-79	RKKRNNKGERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY97	Cell wall biogenesis protein phosphatase Ssd1	0.827	488-498	KREKEEKKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZM2	Uncharacterized protein	0.937	109-141	TPPPATKRPTRRKPSASPAPEPKPLAVAKTRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZM2	Uncharacterized protein	0.936	76-102	KKAAGRPPKKAAPVAIVGGRKRAASPQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZM2	Uncharacterized protein	0.852	200-212	RRPSRGRPPTKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZM2	Uncharacterized protein	0.776	277-297	LRRKGGAGGNGARRSSLGMRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZW7	Uncharacterized protein	0.985	108-137	SRRDRERAERAEREEREAKEERRRRRREDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0G7	Uncharacterized protein	0.878	59-71	PTKAGRRANKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3A4	Cation-transporting ATPase pacS	0.757	211-220	DKAKKHSKNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7U5	F-box domain-containing protein	0.717	1138-1143	NKKKKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N972	Uncharacterized protein	0.733	230-234	KKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9K4	Uncharacterized protein	0.723	134-145	KKGEKTWQKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAU5	Uncharacterized protein	0.94	226-252	RDKKIEREEEWRGRDRRVARRRSRPLP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAU5	Uncharacterized protein	0.786	108-123	RSRSRSRSRSRDRNRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDS7	Uncharacterized protein	0.833	45-60	MKSSRRPRNNNRRPSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGV0	HET domain-containing protein	0.973	547-559	RNRRGPRAKKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGV0	HET domain-containing protein	0.698	633-643	KKKANEPKRSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMS7	Uncharacterized protein	0.654	542-547	RGAKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMS7	Uncharacterized protein	0.611	105-107	KPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS97	Non-histone chromosomal protein 6	0.983	5-26	ATKKSAKPEKRRAKKDPMAPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV71	Nucleolar complex protein 2	0.989	5-47	KKNLKATKKFEKKHLKGVIEKRKAAAKIKQRTQVQAKKQLKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV71	Nucleolar complex protein 2	0.967	95-109	KQGKGRKGKLGKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV71	Nucleolar complex protein 2	0.82	210-217	KKKRKTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV71	Nucleolar complex protein 2	0.659	741-745	DKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW91	Csm1 domain-containing protein	0.986	38-69	KKITAKKMPPKKAAGRPAASKVTKKPAKPTTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW91	Csm1 domain-containing protein	0.909	124-143	AAKGRVARGRPKAAAAAKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW94	Uncharacterized protein	0.911	140-159	GRGTPAKKKETPRKVTPRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZD5	Uncharacterized protein	0.701	332-337	KKPRKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6B6	Uncharacterized protein	0.999	275-337	PAKDAKKKDDKKKAKMEKQAAKKAAKEAKMKEKKEKKAAEKKKKEEEKAAKDKAKAGAAAAGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6B6	Uncharacterized protein	0.875	156-216	KGAGAADNKGAGAKAGDDKKAGDDKKAGAGAADNKGAGAKAGDDKKAGDDKKAGDDKKAGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6B6	Uncharacterized protein	0.827	371-392	GKVTRRSGAGKSRGRLATRARI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6G7	CLAP1	0.78	204-216	GRAQRRSRSRSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N738	DUF1713 domain-containing protein	0.999	320-349	KRQRKLKMKKKKYKKLMKKTRNERRRLHRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N738	DUF1713 domain-containing protein	0.694	85-90	KRRRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9S1	Peptidyl-prolyl cis-trans isomerase	0.997	426-505	QRRDRASDSRRRSRSRSPRRERHRDSRDGRRRDDRDSGSKRGGERSRHDRDRGQERHNRGNDYDRDRRRDRDRRDDYRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9S1	Peptidyl-prolyl cis-trans isomerase	0.664	351-358	RRKQAAKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND44	Mitochondrial import receptor subunit tom-70	0.992	67-85	DSRPSKKERRKRKEAEKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDF5	RF_PROK_I domain-containing protein	0.805	173-188	ASKKHHSAKKNFRRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFS3	MutS protein	0.958	830-852	AKFHRRKQSRKRRANSPENGRDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLS4	Zn(2)-C6 fungal-type domain-containing protein	0.697	117-131	RPPSPTGPGGPRKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKX2	Uncharacterized protein	0.978	129-141	PRKGKRSKRRKGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML45	Uncharacterized protein	0.891	170-180	PKLKRKRRTRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLR9	BAG domain-containing protein	0.991	191-207	SGKKKSRRSRKKHRDPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNT1	Uncharacterized protein	0.622	183-185	KKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQA4	Zn(2)-C6 fungal-type domain-containing protein	0.993	47-66	PPRKPIKKRIRKPRGRGLRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL2	SCY1 protein kinase	0.789	748-787	KKAGGKPLPKGMGKSTGGAGGAATKPSTLATKKKPVVAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY36	Nucleotide-sugar transporter	0.94	160-172	RKHRDRKRDKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA2	BRCT domain-containing protein	0.911	964-972	KKGKKRKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA2	BRCT domain-containing protein	0.729	3-10	KKKAKPKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0C6	Histone-lysine N-methyltransferase SET9	0.868	705-720	EAAKNKKKQPSKVVKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N265	Calpain catalytic domain-containing protein	0.999	644-690	ERKKERKANWERRRLQTVVHKKQRDKNLAKRERRKKERREAAEKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N265	Calpain catalytic domain-containing protein	0.92	39-64	ARKEKPSLGAGGNNGDDKKKKKIKLP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N851	Uncharacterized protein	0.995	101-128	KPPPRKKVKRGPVVRKGPPIKKAPRKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N851	Uncharacterized protein	0.942	568-607	KIVSKPKKYRTGATKRAPTTKAKYRPRRLIGGGSGESARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8P6	Uncharacterized protein	0.922	56-69	RARSKVGIKKKKKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJQ2	CCHC-type domain-containing protein	0.878	709-728	RTPRDKKNKDPRRESSKSKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK05	Uncharacterized protein	0.812	7-18	GRPPRRNNRKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLH6	Uncharacterized protein	0.817	1369-1389	RWRGGRKVRVKNNYGLKKRGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN19	Uncharacterized protein	0.774	161-173	RPEKDKPLRRRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV1	Sir2 family histone deacetylase Hst4	0.96	522-557	NKRTRLPDAPQPSKTTKSKIPVKKAAKKDATKKAVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV1	Sir2 family histone deacetylase Hst4	0.767	98-109	AKRRKVQQKRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX71	Uncharacterized protein	0.73	328-340	RFKVRVAWKHRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3B3	Uncharacterized protein	0.947	333-362	PPPPPPPPPPPPPRPRPPPPKLISSLKRSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3B3	Uncharacterized protein	0.795	225-236	IKKLGRARERRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W7	RING-type domain-containing protein	0.998	769-900	VRPESRSRSASPDESRRSGHRSSRRERDSERRRDKDRDRERDRDRDRDRAKDKDDDEHRRKSSHKSRRDKDHERDKDKGRDRGKDRGKDRDRGKDRERDRDRDRDRERDRDRDRDRQRDRDRDRRRPRDGKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W7	RING-type domain-containing protein	0.987	658-735	SKPRHDKYRDRSRDRDHRKSRDADRPRDRERDHGIDAERDRHRERDNRGRSVSQSSRSPSRERKDGHRRRRHRSESPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W7	RING-type domain-containing protein	0.905	982-994	GESSRRSRRKGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W7	RING-type domain-containing protein	0.74	950-977	REKRNRERLVKEAQKLAGLVGGGKRSRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7W7	RING-type domain-containing protein	0.656	751-757	SRRHSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE13	Eukaryotic translation initiation factor 2A	0.967	525-539	AASKNKKKRANKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH37	Alkyl transferase	0.823	338-351	RERDEKPKRHLKQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKH1	Uncharacterized protein	0.765	241-250	KKRHRQRPRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHY9	Mating-type protein mat a-1	0.755	399-419	RRNTKSRKTPTNGAAKPSKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN87	Uncharacterized protein	0.947	174-194	YRKKRARMQRGREEGARRRAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN87	Uncharacterized protein	0.775	342-348	PRKKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPB1	Uncharacterized protein	0.977	107-141	RTSRLKRARKHGFLVKTRTAKGRKMLARRQAKGRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU5	Uncharacterized protein	0.96	423-454	PLRTKESREDRTRSRSRKPSGERPRRVASARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU5	Uncharacterized protein	0.954	245-266	HWMKRRRRSPPGSRAIRMKAGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU5	Uncharacterized protein	0.878	667-681	AKRRSDAGRRRPKAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU5	Uncharacterized protein	0.871	477-492	RKSTRKSPPRTKKSKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU5	Uncharacterized protein	0.825	194-207	RQQHKHRRKSSAKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU5	Uncharacterized protein	0.769	744-756	PKPAPKKPFREAL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU5	Uncharacterized protein	0.612	238-239	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUA9	DH domain-containing protein	0.849	1620-1641	KKRAKRRLDFERAEQLKKAGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N391	rRNA adenine N(6)-methyltransferase	0.883	222-237	KVAVEAEKVKKAKKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5I3	Uncharacterized protein	0.873	294-305	RRKKKNVRKGPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9J4	mRNA 3'-end-processing protein RNA-14	0.798	71-88	KAKPLKPSPQPAAAKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NA67	Uncharacterized protein	0.972	84-102	GRAPKGKGKGNKAKNARRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB33	YTH domain-containing protein	0.906	391-418	KKSDRGRCARRHRSSSPRGRSGSHKSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC66	Uncharacterized protein	0.841	55-73	AIPKDARDRKERRSEPKHA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NED3	Eukaryotic translation initiation factor 2 beta subunit	0.967	72-80	KKKKKKPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NED3	Eukaryotic translation initiation factor 2 beta subunit	0.93	103-110	KKKKKKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NED3	Eukaryotic translation initiation factor 2 beta subunit	0.637	314-316	RKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLP0	SH3 domain signaling protein	0.943	414-432	AKKKPPPPPPPKPRIPAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLP0	SH3 domain signaling protein	0.662	137-142	KKRENK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHZ9	Cir_N domain-containing protein	0.999	175-296	KKERREKRRHRHRDEDDRDRRHKRRRSHSRHRSPSRERHDDRRRHRSEDRPRDDERRSSRRDDSRERDRPRDDRRYRSTRDDSTERNRPRDKDRHRQGRDDSRERRRHSDRRDTDRTGRDER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLM2	Uncharacterized protein	0.64	65-72	KQPPQKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLM2	Uncharacterized protein	0.603	171-171	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR56	Zn(2)-C6 fungal-type domain-containing protein	0.797	28-40	KRRRPRAQGALKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTH5	SET domain-containing protein	0.984	123-139	KKPKRPPSKSHKKKPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTH5	SET domain-containing protein	0.913	485-497	GKANKKKSRKSKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTH5	SET domain-containing protein	0.715	713-724	HRTRQEDEKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTH5	SET domain-containing protein	0.607	592-593	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYJ9	GTPase binding protein Rid1	0.883	820-838	PKSPPKKRGGGLTPAAKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8A5	Uncharacterized protein	0.994	277-308	LGAKPEDKKDDKKDDKQGKGKGKRKLRFRRDA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9Q8	Uncharacterized protein	0.967	137-146	QNKKKKKKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NA07	Uncharacterized protein	0.995	48-64	PGKNKSGRRPRRKKKPH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NET3	NUC153 domain-containing protein	0.99	493-515	YKRKERERKEMKREKARAKREGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NET3	NUC153 domain-containing protein	0.974	613-630	KASKKKLKGKAAKKQAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NET3	NUC153 domain-containing protein	0.928	554-566	RKEERRKKREARE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NET3	NUC153 domain-containing protein	0.784	722-728	KRKAKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NET3	NUC153 domain-containing protein	0.755	679-689	KLLEKGRNKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML95	Uncharacterized protein	0.831	334-348	RRAPRRASRSPKRTG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC9	RING-type E3 ubiquitin transferase	0.994	29-70	SKGSRGGRGRGGRGRGRGDSKSGRGGGEGQQRGGRGKRGGSN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC9	RING-type E3 ubiquitin transferase	0.785	834-842	GKKKKQGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC9	RING-type E3 ubiquitin transferase	0.61	400-403	REGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQR3	Alpha-1,3-glucosyltransferase	0.904	9-19	PRKPRARKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSP5	Pattern formation protein EMB30	0.843	1379-1390	RRQRKPRPAKSE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSP5	Pattern formation protein EMB30	0.703	703-707	RRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUV4	Uncharacterized protein	0.903	67-79	PKRARQRQKRKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVT2	Uncharacterized protein	0.743	30-39	SGRGRGRRGD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVT2	Uncharacterized protein	0.645	72-77	GKKVKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX00	Transcription initiation factor TFIID subunit 1	0.841	513-523	KRKRKIEKNRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX00	Transcription initiation factor TFIID subunit 1	0.693	1064-1076	KERRLQREKSKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX00	Transcription initiation factor TFIID subunit 1	0.607	233-233	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZZ4	Uncharacterized protein	0.739	388-396	KRRKKLSAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1C3	Tryptophanyl-tRNA synthetase	0.831	471-491	KKLEKQRQIEEKKKQKEAAKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6F0	RNA-binding protein 8A	0.925	140-157	GAPRGRGRGRSRSRSPAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6S3	Uncharacterized protein	0.845	76-96	KASVTKASRKPAKIGRQKLVQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6S3	Uncharacterized protein	0.766	415-424	AEKKRRTPRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAI3	Uncharacterized protein	0.851	86-116	ERVKKEYAEKQKAKAEKDDKGKDKDQKEQDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAI3	Uncharacterized protein	0.73	75-80	AKKKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE81	NF-X1-type zinc finger protein NFXL1	0.937	1117-1153	ARPRTVAPPPAKKPGSVFLALGRKKPAAPEAPKAKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE81	NF-X1-type zinc finger protein NFXL1	0.916	110-140	ASRGGRGARGGRGGRGGQAQSQRGGGGRGGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE81	NF-X1-type zinc finger protein NFXL1	0.903	25-38	SRQRRGPRRGRGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEF9	Transcription initiation factor IIB	0.96	361-371	KLKERRKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEF9	Transcription initiation factor IIB	0.915	583-602	RLAATNPPKPGRGNRAKKPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEF9	Transcription initiation factor IIB	0.761	6-16	KAPRRPKPAAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFR9	Uncharacterized protein	0.993	134-149	RATDKKGKRSKKRKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q2KEK8	Uncharacterized protein	0.635	20-23	GPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKA1	Uncharacterized protein	0.978	675-694	RRNDKRKHRRIGGGEGKKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLT9	PPPDE domain-containing protein	0.852	310-327	KKYRNDDKKSGKEEKEKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQD5	Uncharacterized protein	0.973	211-229	GSKRPRRTSQRPLKRRKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0D9	Uncharacterized protein	0.992	508-591	VAGIVKHLRDKSRARSGGRSRSRSHSRSKSPRHRSRSRLRTGAEIVAAGLAGGAAKKIYDKHQEKKERERSRSVAAGKRRSRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0D9	Uncharacterized protein	0.962	690-788	KKPEKKRSKSRLREMAAAGAGAAAAAIGLKGIQKRREKSKERDEEEERRHEDEMRERDRDRDRDRPRNRSRVGFDDRHMSPERDRNREREERARDRERR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0D9	Uncharacterized protein	0.791	604-617	RRRRSRSHSRSNAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0D9	Uncharacterized protein	0.74	484-504	RSRTRSRSRSRAASVAKAAAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0D9	Uncharacterized protein	0.726	415-426	GRSRSRSRSRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0D9	Uncharacterized protein	0.643	673-678	RRHRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N473	Uncharacterized protein	0.98	211-234	VKRGKSKREKKPAAPVGRTERKTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4T7	Peroxin 26	0.678	356-365	RKSKPQGKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N710	Uncharacterized protein	0.789	58-69	RRWWRRRRQERE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDH3	Component of oligomeric Golgi complex 3	0.967	90-102	PKKSKKRKQKKQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDY1	PX domain-containing protein	0.96	897-916	RRRRAKQRDRLRRRAGEPEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE32	Uncharacterized protein	0.893	498-515	VKKPRREPREPTRRNPVR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE32	Uncharacterized protein	0.807	154-163	PPSKRPRRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE32	Uncharacterized protein	0.625	140-143	SRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLG0	Uncharacterized protein	0.89	69-81	PTRREKSKKKEKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLH2	Uncharacterized protein	0.654	15-19	PSKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLJ4	Uncharacterized protein	0.715	373-377	RKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQQ6	Uncharacterized protein	0.897	292-302	GNRKRKKPARL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQQ6	Uncharacterized protein	0.635	311-315	KRRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS14	Uncharacterized protein	0.995	540-603	RRRHPRRKHRDVADDSDKARERDSEKKKKEKRERDRYEASDRSHGRHRSPSPPEKRTQRKLKRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS14	Uncharacterized protein	0.963	516-527	QKKRIRRRRKPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MST4	Uncharacterized protein	0.906	24-39	RARSKAKARARRERQE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVF1	Uncharacterized protein	0.966	303-338	KRARRRRDHINGSPIKGGGIGGKGLGGGGKRGKRSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWH0	Uncharacterized protein	0.774	270-280	RRGPHRPKKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYG6	Phosphoglycerate mutase	0.653	132-139	PRRSRPVG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3I2	ZT_dimer domain-containing protein	0.897	87-105	SKKQMKIDHPKGNKKKLKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBB0	Uncharacterized protein	0.668	79-83	KGKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEB6	Oxysterol binding protein	0.809	236-242	KRRRKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFJ0	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22	0.959	163-208	RTSYRKRSRSPEAGYGDSRHRRKEQYRSRSRSRSRGKDQYGRRSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFJ0	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22	0.648	358-362	RKHKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHC0	Pre-mRNA-splicing factor CWC24	0.898	12-26	KKRGAKAKANIRKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHC0	Pre-mRNA-splicing factor CWC24	0.749	309-318	KKRERAAKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHC0	Pre-mRNA-splicing factor CWC24	0.722	51-55	KRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP05	Uncharacterized protein	0.944	206-238	KRKRGRSETSARRNSERTKALEFSAKRRKKNVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP05	Uncharacterized protein	0.842	253-267	PSPSSKRRSSGKGGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRF7	Cir_N domain-containing protein	0.999	264-392	GAKRAREVDKERRREREDREKDVDDLIREERRRAKRKRRDEEGRREHRHSGENRRRGDDDEKRERRHRHRDDEHRRSYRREDGHRERKHREGDDRRRRDRSKERRRSRSPRRSPRREMERTRSDRSHRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRF7	Cir_N domain-containing protein	0.832	105-113	RKSRRHRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS98	Uncharacterized protein	0.894	24-40	PHQSKRRARARPHAPGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVM0	RRM domain-containing protein	0.842	141-151	EKGNKKRKPHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW75	Uncharacterized protein	0.783	62-79	VRPRKKHSDYPSRLKKGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW75	Uncharacterized protein	0.753	181-191	GRKARRDLRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N006	Uncharacterized protein	0.897	143-157	VKPRKRLRRAEARTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N554	Hsp88-like protein	0.839	531-543	KPKMRKVKKQVRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5I8	Polynucleotide adenylyltransferase	0.942	1129-1142	PQKQKKGKKGRGAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5L1	Uncharacterized protein	0.772	493-515	QKVGRGKLTKTPQVAKPPKASRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5L1	Uncharacterized protein	0.635	9-17	KGRQAAKEH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N869	Uncharacterized protein	0.959	170-201	QKTRKSSKKHRSSSRTRVRSPIRPPGPTGRMG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCS5	DNA-(apurinic or apyrimidinic site) lyase	0.845	315-329	KKQKAGKIKKADGGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCS5	DNA-(apurinic or apyrimidinic site) lyase	0.832	355-364	KAKARKRKQD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCS5	DNA-(apurinic or apyrimidinic site) lyase	0.718	370-379	DGAPKKAIKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE80	SANT domain-containing protein	0.926	392-404	TRRKSSKKPRKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE80	SANT domain-containing protein	0.768	4-19	KKGAPSFKPKAGIRRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE80	SANT domain-containing protein	0.633	340-343	RKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE80	SANT domain-containing protein	0.603	365-366	PR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEW7	Uncharacterized protein	1	179-255	AKKDKSGDSAKKAPGGDASKKKRRPGKRKRIAIRIKTKKEKENDREKQTKEEHLKAKKKRLNRERQLKRRQKEREKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK41	Uncharacterized protein	0.997	399-433	KKDRQRRKDEAERRRLLEKAKARGRKGKKTVAGKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK41	Uncharacterized protein	0.95	328-347	GPPPGAQPPPPRPRRRRTKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLP6	Uncharacterized protein	0.96	386-410	GRRQRHKISTDGSRPRRKPVPRRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQQ3	Rho-GAP domain-containing protein	0.79	253-272	KKGKPKPFALLGRSRSQRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWF4	Transcription factor BYE1	0.997	135-186	EEASKKPKKGKKAKAAAAAAAAAARRASEAPKEPAAKEERAATPASVKGKPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWF4	Transcription factor BYE1	0.957	30-40	PKKRGRKKKEE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWF4	Transcription factor BYE1	0.763	222-233	PAAGNKRKARDP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWF4	Transcription factor BYE1	0.615	302-304	PRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYW1	Ribosome biogenesis protein NSA2 homolog	0.985	21-69	EERARKKAAREEGHGKSAKAQNLRGLKAKLFAQERRKEKIRMKKAIKQH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYW1	Ribosome biogenesis protein NSA2 homolog	0.634	143-145	KRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2P1	Cysteinyl-tRNA synthetase	0.708	817-828	AKKLKKDWEKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2P1	Cysteinyl-tRNA synthetase	0.604	768-768	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2P1	Cysteinyl-tRNA synthetase	0.6	770-770	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5B3	Uncharacterized protein	0.669	566-571	APKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5I4	F-box domain-containing protein	0.916	891-901	KKGKKSKSKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E2	Mannose-P-dolichol utilization defect 1 protein homolog	0.858	258-269	KKNKKKSQAKKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N702	YL1_C domain-containing protein	0.982	132-159	KIAKEKRAAAKKRKAQQVIPAKFRKRVR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N702	YL1_C domain-containing protein	0.808	189-198	APPPRPKKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N702	YL1_C domain-containing protein	0.786	238-257	RKKQLEQQEKKAKRLEALKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N702	YL1_C domain-containing protein	0.708	339-344	PRRKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFM8	Uncharacterized protein	0.86	479-514	GKAGGKTATVGRRLSISIRGFKKRSSSAPENRKRAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFM8	Uncharacterized protein	0.841	339-352	RAIRKFKAKSRRLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFM8	Uncharacterized protein	0.788	127-155	RPPSRSGSRPPSRSNSRPPSRSNSRPSSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH68	RNA splicing factor Pad-1	0.994	44-160	SSRHDRDRSPRDSSRDRRRRGSRTPKSEADRTPRSDAGSSTHKSRRRSRSRDRDSRRSRRHRGGEGDYYRGARSRSRSPNRYYRPRDNRRDRDDDRRGSHRGRDDDRRRARRGSRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIM5	Uncharacterized protein	0.61	226-227	KA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIP2	FNIP_N domain-containing protein	0.665	373-380	KMKRPQPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIY0	WH1 domain-containing protein	0.767	288-303	RAPPPPPPAPPRRLRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ69	Uncharacterized protein	0.964	10-47	PKPKKRKARPDDDAPAKAANLTVPVGKKRKQNAKKGKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLE5	Uncharacterized protein	0.981	857-896	PKSKKQAKKTATATPASRKKAGKGEGVQRREPSPRTRKPT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLE5	Uncharacterized protein	0.948	665-702	RNDKAAKANGAGKGKNSPPSKKQTMKATVKASKRKLKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLE5	Uncharacterized protein	0.939	716-745	SPAKKRKIKVAVKRSISNAGLKVAKGAKTA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLE5	Uncharacterized protein	0.841	794-831	KKTPTSKKVAKGKAAAVSALVGGKKHTPKLAAKSTTAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHH7	Uncharacterized protein	0.989	172-182	SKKSKKKKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A0A151V4L9	Uncharacterized protein	0.966	216-254	IRGSAGTKKRKAEAVDQDAVKKPKPVRTSKRLRAKKQSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNF1	NIF domain-containing protein	0.994	81-103	VKGRGKGKKKKANQMAKSKAKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNF1	NIF domain-containing protein	0.914	123-138	KSKSKVGKLSKKQRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPE4	Uncharacterized protein	0.868	371-385	RGKTSKHSKERGKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTX7	Uncharacterized protein	0.603	60-60	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUM3	PHD-type domain-containing protein	0.939	256-280	RIKIVKTPKQPKTPKPPKAPKDSKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUM3	PHD-type domain-containing protein	0.929	686-731	RQPGKRIKRPAPGVVSRTNSGGSSAVGRRKAAPKVTKAASKLKKER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUM3	PHD-type domain-containing protein	0.794	474-483	RKYGGRKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV17	5'-3' exoribonuclease 1	0.983	1394-1432	GRGRGRGRGRGARGGPNMGGRGGQSGRGRGGGGSGPPRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4V4	ABC transporter	0.946	53-65	KAKAKKKSKGAKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4V4	ABC transporter	0.758	135-144	IAKAKKAVKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6P8	Uncharacterized protein	0.999	268-293	KTKKKKKKKGGKGKNRRQEVKPDLRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8G7	Forkhead box protein J2	0.781	31-37	PAKKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDB4	Uncharacterized protein	0.82	33-53	GRGQRKGKNASSSSRKPRHVP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDB4	Uncharacterized protein	0.62	58-61	RPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHJ7	RNAse P Rpr2/Rpp21 subunit domain-containing protein	0.738	153-162	APRQKRRPFR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMU4	Uncharacterized protein	0.872	513-521	RKRKRKGDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN36	Uncharacterized protein	0.916	3-16	RPGRRPRRLARRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP79	Helicase swr-1	0.996	1897-1912	KDKKKSKKKGKDTRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP79	Helicase swr-1	0.919	234-290	RPSAAAKPTPPSKPSASKTTGRTSGAHETRTSQRSRRRSPSPPPKLPSRTSARSRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP79	Helicase swr-1	0.645	132-135	KRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP79	Helicase swr-1	0.639	1471-1476	PKPKIP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPW5	Myb-like domain-containing protein	0.983	129-152	PRRRKVVKRAPPPPPPRGANKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVG9	Uncharacterized protein	0.848	381-397	KAKAKGKRQEDRSRHKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1X3	Uncharacterized protein	0.874	110-132	HNRRPKGGVARGGPSQKKPNRLV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1X3	Uncharacterized protein	0.713	159-169	RKPKGGFARGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N756	Uncharacterized protein	0.722	7-24	KRRRIEATKTLRKPFRSP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7Q5	Uncharacterized protein	0.958	946-954	KKKRKRRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F0	Uncharacterized protein	0.894	512-526	KKSKKRKANAEEAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F0	Uncharacterized protein	0.707	145-161	KSAAATKKAISKPEPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F0	Uncharacterized protein	0.669	280-299	AKAIATKKAVNGVAKSKSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9F0	Uncharacterized protein	0.626	231-234	KTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE08	18S rRNA aminocarboxypropyltransferase	0.895	6-29	KDFNSKGKRLHHGPPRGSRPPPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIT0	DNA polymerase delta subunit 3	0.915	375-386	RRRGRKRVMRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIT0	DNA polymerase delta subunit 3	0.705	264-270	KAKPKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52G60	Pre-mRNA-splicing factor CEF1	0.958	174-199	GKKAKRKARERQQEESRRLAALQKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QST9	Increased rDNA silencing protein 4	0.996	270-294	QKPRPKPKPKPKPKPEKIIKTEPRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QST9	Increased rDNA silencing protein 4	0.995	532-561	ARKHKERHRKRGPLGGKKHVHHEGSRRRWR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R9U5	Nucleolar protein 16	0.943	6-26	RQKRKNRSSRPKVKQTNRPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMK9	Uncharacterized protein	0.791	616-632	KPRTKPQRRAPPQPSRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMK9	Uncharacterized protein	0.762	506-518	RKREEKRRETKQQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMK9	Uncharacterized protein	0.717	521-527	QVGKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN99	Uncharacterized protein	0.78	20-27	NRKRKAKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNU3	Uncharacterized protein	0.835	898-909	RRRNRSRRRSPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS64	Phosphoinositide 5-phosphatase	0.689	1331-1347	KPSRKPTMSPEVRPKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT41	Zn(2)-C6 fungal-type domain-containing protein	0.615	265-268	KRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL3	Uncharacterized protein	0.806	633-643	GKRARRKANIR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL3	Uncharacterized protein	0.622	573-575	AKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZM4	BZIP transcription factor	0.834	336-359	RGKPKKGTTAAPAPATNGKRKRSD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZU4	Peptidase U34	0.674	516-521	RRKRNA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1T7	Origin recognition complex subunit	0.983	231-252	RRRPGRPKGSGKNGPARKRSPT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1T7	Origin recognition complex subunit	0.965	39-81	PRKRRKPTRFRESPQDTRKKPATAPKAVVEPKAKEEDGRPPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1T7	Origin recognition complex subunit	0.941	100-116	KRKPGRPKGSKNLPKPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFI8	ATPase synthesis protein 25	0.909	357-366	IKRGKRGRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFI8	ATPase synthesis protein 25	0.855	239-250	KTKMRRRARKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJI4	Uncharacterized protein	0.993	105-156	SHRKRRPKDRDRDRDKERDRSRDRDRDRSRDRERHREKDRDRSRSRSRSRDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJI4	Uncharacterized protein	0.973	26-92	PKRKSSRAERPSGDRDKDRDRDRDRDRDRDRDRDRERERDRDRDKDRDRERDRELRHKSSRSSRHPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJI4	Uncharacterized protein	0.899	955-966	RHRRPKRRNERR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKM6	F-box domain-containing protein	0.998	1160-1194	GRRKSRAERSAARNMSDAKKRGWRRSKSKRGKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKQ8	Cytochrome b5 heme-binding domain-containing protein	0.931	216-258	HKKYRNVGRVKRRLDWLEKEPKKKLCKQAQEGRPKRKIPGDKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS9	tRNA-pseudouridine synthase	0.905	144-156	ATPPPKKKKQKGV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKS9	tRNA-pseudouridine synthase	0.613	253-254	RK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLM8	Heat shock protein 90	0.658	247-252	KPKTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN57	Glucosidase 2 subunit beta	0.967	159-188	RRLLEERKASKDKAVKKRRTLVKEAKELRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQB0	Uncharacterized protein	0.765	965-996	KKKEVLKKESKQGQSGDGRVGRSNSKQKKSGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRE6	Uncharacterized protein	0.717	103-112	PKPEGRKGKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRG4	ATP-dependent rRNA helicase spb-4	0.859	577-588	ERRERKQRKREA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS07	Uncharacterized protein	0.694	15-27	KARLAKLKSLKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUT8	Uncharacterized protein	0.863	799-831	AGRRRKQEKMRERTMQLAQRGRSKSGADKEERR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXG4	Potassium/sodium efflux P-type ATPase	0.847	252-263	GKDSKRRPVKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYX2	54S ribosomal protein L49	0.755	185-196	VKKQRTRRAKTI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0J0	Uncharacterized protein	0.909	19-43	RKHRSSSHKHHKSSSRRDRSRSRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1B0	C3H1-type domain-containing protein	0.836	1019-1031	KEKRLRKEQRRKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N843	Brix domain-containing protein	0.991	43-77	KTGNKLKRQYLNVRNKKDKDARKRAERFKRRKEEN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N843	Brix domain-containing protein	0.817	10-21	AKKKTARPRPVR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9M3	Uncharacterized protein	0.981	394-472	WRPPPPPPPLPKPPLPKIEPKKGGDPPGPTKITGKEGTSKEAPAAIRVSKEVSSSKVAIRPKPVAKAPAPKKPIGKKSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGR2	ClpTM1 domain-containing protein	0.85	200-213	PKKKEKKLKSLLGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGR2	ClpTM1 domain-containing protein	0.647	667-670	TKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGT8	Uncharacterized protein	0.999	185-286	EMKRNLERDIREKEERAAREAREKEREAKRKEREKERERDRSKDRRERRRESRDRSRRGSRDRDRSRSRRRDRSRRRDRSRDGTRDRDRDRHRDSDRRRSTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGT8	Uncharacterized protein	0.999	736-779	RDARGDKRHARDRSRSQRRSRSRRRSRTPIRRDRSTRRRSRSRQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGT8	Uncharacterized protein	0.999	877-1008	RDRSRSRDRDRDRARDRSRDKDRRNDRDRRDDRRDDRRERRRSRSRSRSPRRDRERDSYRDRDRTSRRDRSRSASLMRRRDRSRERDRARNRDRDRERSDRPSRRDRSRSVSVRRRRDRSRSRSRQRSRSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGT8	Uncharacterized protein	0.998	435-649	SKDREQARRPSSVQRSSDRDRDRDRGGRDRERSRDRHTRDRSRARDHSRQSRIDERRRPDRRSRSPRPRRDSRSYRDRSRSRVKTDRRDERSRSRTRVDRRDDRRDRSRSRIRRDDRRDERRDGRKDDRRDNRHDDRRDRRDQSRSRARSPRRARSSSRRATERRGADRGVSPTRSTWRQRSRSRARSPRRDRSRHRDNSRAGRGRDRSPARPSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q51TF7	Pre-mRNA-splicing factor CWC2	0.975	29-44	KKVKKIIRVKKKRPAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML15	tRNA pseudouridine synthase B	0.943	69-84	GKHNRKWKKRKQDPRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML15	tRNA pseudouridine synthase B	0.601	295-296	RP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML15	tRNA pseudouridine synthase B	0.601	298-298	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLR2	Uncharacterized protein	0.696	264-275	RRHRHHHKHHHK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSJ7	Uncharacterized protein	0.736	504-511	RKRKRNHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MST8	Uncharacterized protein	0.948	104-129	VKRRPGRPPKVRPPPGGAANMGNPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MST8	Uncharacterized protein	0.935	50-68	GKKRKHELQSRKPGRPRRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW07	Uncharacterized protein	0.796	256-262	RKRRRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXT5	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.992	882-897	AKSKKKPVKKKKTKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXT5	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.838	561-573	KTERRRSRSKERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXT5	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.761	1132-1138	KKRKKPV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXT5	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.706	721-730	RRRAPRARVR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXT5	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.626	1070-1073	KKAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY62	RING finger protein	0.99	742-752	KRKKGKGKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY90	rRNA processing protein Rrp17	0.999	175-214	DKKPSKDQKPKKKKKKFRYETKFERRLTESKRRAKKFAGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY90	rRNA processing protein Rrp17	0.901	4-19	KPRQKKTLGPPPKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZE5	PWWP domain-containing protein	0.981	420-445	PASEAKPKAAKAKKPAAEKKVEKAEP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZE5	PWWP domain-containing protein	0.948	154-180	SSKSRRKSNATPGDAKRKLNKKGSRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZE5	PWWP domain-containing protein	0.869	371-399	EKKTSKKRKAEEEAATPQRAESVKKPKIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7N2	DUF2013 domain-containing protein	0.722	504-515	KKVPPKAPPPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7N2	DUF2013 domain-containing protein	0.72	450-462	KPKRVRPEVPKHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7P2	DNA repair protein rhp54	0.875	41-54	RRPEADRPARKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAE5	Uncharacterized protein	0.943	154-196	KKKDPNGPGAATPSTPKGKKTAASATGSAAKSTSKRGRKPAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAR2	Uncharacterized protein	0.903	78-88	KKKATPRKRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF58	Signal recognition particle subunit SRP68	0.684	371-376	KRRKPN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGP6	Phospholipid-transporting ATPase	0.866	298-311	GRSRKKLKSAGSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH77	Uncharacterized protein	0.99	45-58	RKKKPRRKSRRSRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH77	Uncharacterized protein	0.989	127-175	DRQHSTRPRRRSTDYGRRHHRNRPSRRRRSSNDDHHLHSRRRHRHRRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML54	60S ribosomal protein L27-A	0.603	63-64	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV35	Uncharacterized protein	0.997	83-118	KAASSKKKRVEKKRGKKSKSAIVFSSYKDRITKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV77	Uncharacterized protein	0.992	48-80	EGRSHRHHHHHHRSHRRKRSRSPERPSSSKRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV77	Uncharacterized protein	0.73	375-391	RKKTEREVRKEAEARAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV77	Uncharacterized protein	0.712	37-41	RRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWQ2	Ribonuclease P protein subunit	0.972	53-87	TTAREARRAARQQKTKDRAKQLRPKPLSARERRRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXN2	Cyclin-K	0.794	57-88	RNSPPRPGMARRGPLAASPLRPPATPAPKPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N196	Uncharacterized protein	0.945	535-581	REREVKELHDKIKGQQKEQEKARKEEIKNEERERKRLEKEAKMEQKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N196	Uncharacterized protein	0.826	632-663	KEKPSRGRSLHLRLPSIPLSSKPKDKGKERER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8A1	Autophagy-related protein 26	0.932	67-79	PKKRIRKLQKKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8A1	Autophagy-related protein 26	0.923	181-215	KKRRKGSGHKLLRSLPQISLPKRLSSLSKKSKSSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAM2	Uncharacterized protein	0.987	256-288	RRRESRDNMRPESRAAVAHRRRQRRRPRARSPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCY9	Uncharacterized protein	0.978	136-154	KKSKPASRAGRKPGRKAKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF70	Uncharacterized protein	0.696	245-250	KRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKC0	Cell division control protein 11	0.606	11-11	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NL74	Uncharacterized protein	0.982	249-280	EGRKSGKKGAKKDAKKENNGQDGTSKSRKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMP6	Uncharacterized protein	0.734	176-192	EERRRREWAEEEERRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMP6	Uncharacterized protein	0.717	156-171	RKRERERLAQERRQRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPD2	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.984	595-622	VKARGRKRKRTGADAEDRPKVKRIRLRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPD2	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.972	227-242	RGRPRGRRGRGGRGKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPD2	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.944	193-215	ARRGERRANAEKPKPAPRSKPAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPW2	Multidrug resistance protein 1	0.993	923-944	KKKPKKKGLKEEGRARGRVKWK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ04	BUB protein kinase	0.918	487-499	KPIPKEGKPRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUS1	Uncharacterized protein	0.954	10-33	ASPAKGRGRGRGRGRGTTGASRGT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUY7	Uncharacterized protein	0.611	50-53	KQRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXL2	Uncharacterized protein	0.676	700-708	KARSKSRTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0U7	60S ribosomal export protein NMD3	0.889	417-434	YQRRRNRNKNRNWKLKRM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2C6	Clr5 domain-containing protein	0.728	65-73	KVRKRIKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBU8	Uncharacterized protein	0.856	6-16	KKKGVKKKGIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND28	Uncharacterized protein	0.993	269-339	NKNKNNGKKNNANARTGKKNNAKANAKGGRKANAAGAQGAKKKANAAGAQGAKKNASGGRAAKKNNKRELF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE62	Uncharacterized protein	0.998	965-1019	NKQRRVANKTPGPKPRGKRGGARPGAGRKPNSAKLALAQAAAAKQKKKPCPKPRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE62	Uncharacterized protein	0.772	1213-1226	RRRRQPPVRYRRGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEH6	Cell cycle control protein cwf19	0.993	24-115	RAERKEKRRHHHRRDRSSDRTGDRERHRDHDRDSDRHRHKHRRHDSRERERDRDEHGHRHKRSRKDEDENDRDKDSSRRRHRHRNGSPSRRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH59	Histone domain-containing protein	0.631	30-34	KKPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRP3	Uncharacterized protein	0.757	69-91	TRRPGQKAAGTRRMRGTDGRGSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXQ4	Bilirubin oxidase	0.882	590-616	SGSGKGSDDKKNKTKRDKGFMARRTAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N376	Uncharacterized protein	0.632	147-150	KKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N441	Tr-type G domain-containing protein	0.644	506-510	KVKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6C3	Phosphatidylinositol-4-phosphate 5-kinase its3 (PtdIns(4)P-5-kinase)	0.64	362-367	RASKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7R2	Chromatin structure-remodeling complex protein rsc1	0.931	351-365	KLRRRRKNRFSRRDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7R2	Chromatin structure-remodeling complex protein rsc1	0.876	950-966	KKKLEEERLRKRKERDE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7R2	Chromatin structure-remodeling complex protein rsc1	0.823	372-380	HKKRGRPPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7R2	Chromatin structure-remodeling complex protein rsc1	0.683	438-443	RRMKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7R2	Chromatin structure-remodeling complex protein rsc1	0.635	976-979	SRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCF4	Uncharacterized protein	0.633	129-132	GKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCG0	Uncharacterized protein	0.812	19-32	RLRKERREAKIKAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND38	Uncharacterized protein	0.997	53-76	PSKRARRALKKGKPLPKPASKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND38	Uncharacterized protein	0.973	343-370	KKTKRRKPAAGSEKTKTRKWWVNKLKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND38	Uncharacterized protein	0.952	385-409	KKRFGKDAPKTGRKGPGAGGRGPPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKP0	Uncharacterized protein	0.994	113-144	RKRAENESKDDEKTRKNREKREKKKAAKLRAI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML29	Ubiquitin C-terminal hydrolase	0.857	758-783	FKPKDKDRERERERDPKEHWERRGSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML29	Ubiquitin C-terminal hydrolase	0.77	863-878	SKDKGRGKHHHHMHRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPU8	DnaJ domain-containing protein	0.933	498-517	KKDKKEKEKDKKDDKTPGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWR0	Uncharacterized protein	0.788	457-470	SQRKLKGIRRIGRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXF3	Uncharacterized protein	0.651	333-337	AAKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZR8	Uncharacterized protein	0.836	412-421	NKRRRGRPSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N032	Uncharacterized protein	0.983	289-303	RRIRRSKKARKSKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N032	Uncharacterized protein	0.901	192-210	RRTRDKQGRRDRSKPRSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N461	Uncharacterized protein	0.965	32-68	LEKKRAEEKAKKEMADKAKGKGPLNTGTQGIKKSGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N461	Uncharacterized protein	0.889	8-22	GGKAKPLKAPKKGNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEB7	Transcription elongation factor Spt6	0.983	80-90	RKRRRKRRRAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGR8	SNRNP27 domain-containing protein	0.992	20-138	RNRHESDGRRDRRDRGDDYRRRDDDRDNRSRRYRSRSRSADRGGSHRDRRRDDRDRSRDRGARDRPRRPQDDNRGDRRRGDERNPTDRERGYNRDHPPRDRDSRRSASPRRRSTSPVRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIP0	Uncharacterized protein	0.948	275-301	AKRRYLKKRIAEEKKGQGDKGRHRPTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMQ7	Uncharacterized protein	0.985	149-163	APRKRGRPGRPPKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMQ7	Uncharacterized protein	0.912	266-282	PASRRGRGPGRPPKVKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ81	Uncharacterized protein	0.97	625-695	RESRNQRRNDGGGGGGGGRSGRNPPLPPGPPPSSLPARPPGGQSGGGSSRGGAGGGRRGRGGFSRVRGGHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ81	Uncharacterized protein	0.832	219-244	SRSRSKSKSRSRSGSEAPDRSTMRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRY6	Uncharacterized protein	0.987	8-42	KAEKLAAAKKRVEALKKQKAKKASGDSSKKADKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRY6	Uncharacterized protein	0.656	516-526	KRIERIKEIKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL9	Ribosome biogenesis protein RLP24	0.909	40-59	FKMKRNPRKLKWTKAFRKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL9	Ribosome biogenesis protein RLP24	0.884	100-125	RARRERVFYKKRMAGKREREVAAARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL9	Ribosome biogenesis protein RLP24	0.664	171-177	SKKAGKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXD6	Uncharacterized protein	0.788	457-470	SQRKLKGIRRIGRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3U9	Chitin deacetylase 1	0.811	291-300	KPKPKPKPGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5E1	60S ribosomal protein L32	0.854	20-48	RHQSDRFKRVDPSWRKPKGIDNRVRRRFR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5E1	60S ribosomal protein L32	0.615	13-16	KRTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N666	Beta-glucosidase 1	0.92	511-528	KSAKSGHLWKRRRRPHPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6P9	CMGC/CK2 protein kinase	0.895	67-77	KPVKKKKIKRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7J6	RRM domain-containing protein	0.835	307-323	RGGSRGNNRGRGKGSGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7Y5	Ubiquitin carboxyl-terminal hydrolase	0.976	247-262	NKRQNKGKSGKRKRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDW4	Uncharacterized protein	0.803	20-27	KKKKLKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU63	Uncharacterized protein	0.936	336-370	RNRRRRPAINQHKRAPKRDESEILKGPKLGGSRNS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU63	Uncharacterized protein	0.843	18-25	RRGKKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU63	Uncharacterized protein	0.731	272-280	GKPAKRNRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUU1	HTH APSES-type domain-containing protein	0.741	406-424	RAKKMKTEAEQKRDRVRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX91	Uncharacterized protein	0.702	134-144	RQRRRLSTKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N207	Zn(2)-C6 fungal-type domain-containing protein	0.915	18-30	RKRIRKPRGRGLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E6	IQ calmodulin-binding domain-containing protein	0.91	245-261	RKAARRRRQESRARMKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E6	IQ calmodulin-binding domain-containing protein	0.614	606-611	RREDKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHD4	Peroxidase	0.883	399-417	RRRVKRKVPSRFSEPKKPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKF3	Uncharacterized protein	0.746	45-52	KYKKGKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MML8	BAR domain-containing protein	0.911	443-463	RKAPPPPPSRSKKPPPPVPAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPX0	WLM domain-containing protein	0.955	174-204	SRRRKRKGPELTYQQKKERRILKKFGKGGVA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPX0	WLM domain-containing protein	0.946	211-238	VKAELEKGKRTAAKPRVAGSKRGRELRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS91	Ubiquitin carboxyl-terminal hydrolase	0.633	204-209	RRAARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV7	Uncharacterized protein	0.999	100-231	GKDAKGKDAKGKDAKGKEAKAKDGKKAKAGAGAANATAPADKKRKKANAKKADLKKGAAKAGAGAANATAPAGKEGKKAKKAGGANLAAGNGTAVDAGKGKKDKDAKGKDAKGKDAKGKDAKGKDAEGKDAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV7	Uncharacterized protein	0.66	66-72	AAEEKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSV7	Uncharacterized protein	0.611	57-58	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTS9	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.986	731-746	RGHKKKRVPKKKGPRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWY7	GPI-anchored wall transfer protein	0.902	104-113	SRRRPKKPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXY6	Uncharacterized protein	0.869	79-90	RWAGIKQKKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1A2	AP-3 complex subunit delta	0.985	980-990	AKPKKKKKKPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1A2	AP-3 complex subunit delta	0.978	1010-1020	AKPKKKKKKPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1A2	AP-3 complex subunit delta	0.947	959-967	KKKKKKKAV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3L4	Nucleolar complex-associated protein 3	0.979	345-365	GKKPKAKREFRTKRERKLLKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3L4	Nucleolar complex-associated protein 3	0.889	48-57	RPRKGKKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7F1	J domain-containing protein	0.964	485-501	PKKMGKAKQKKQKKAAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7F1	J domain-containing protein	0.918	538-548	PKHTKGKKSKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8W2	CUE domain-containing protein	0.987	620-644	GGRGRGRGRGRGGRGSGRGRGGGPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8W2	CUE domain-containing protein	0.942	661-687	ARRRKEANKSSRANHNRRAQRARKMGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8W2	CUE domain-containing protein	0.695	321-332	LRQPARRLQKKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDN2	Uncharacterized protein	0.995	86-108	KEKSNGKTKDKGKKGSKKSKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ61	Exosome complex protein	0.886	136-149	AKEKAKAALKKRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ61	Exosome complex protein	0.855	173-188	KRKKHGSSSKGPKLTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8G3	ATP-dependent RNA helicase DBP8	0.763	567-575	GRRKRQKLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPV8	SMDR1	0.838	220-231	KKNKEKKDKKNA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQK3	Uncharacterized protein	0.874	99-112	RQKPKDKKNKSKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS89	Oligoribonuclease	0.784	178-192	KRWAPKVAKKVPNKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MS89	Oligoribonuclease	0.697	237-246	AKESKKNTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSF2	White collar 2	0.795	530-539	AKKEKKRNPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWA5	Uncharacterized protein	0.666	85-96	KKKADIRVRERR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3C9	Uncharacterized protein	0.929	310-322	MKRKRGRPPKNRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3I6	Uncharacterized protein	0.91	324-336	QRPRKQPKKKLRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N661	Ankyrin repeat protein	0.969	443-455	ERKRAARKKAKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9M5	Monooxygenase	0.676	35-51	RKRTETKMPSTKPHRRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBT7	Uncharacterized protein	0.773	372-378	KKKRLRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCT1	Uncharacterized protein	0.911	255-264	RRARKKKSRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCV9	Uncharacterized protein	0.749	642-649	GKEGRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE68	Uncharacterized protein	0.997	57-193	DGRGGGGGSRGGARVQKPPGTGKIKETKKETKKETKKETKKETKKETKRETKKETKKETKKETKKETKKETKKETKKETKRETKKETKKETKKETKKETKKETKKETKKETKKETKKETKKETKKETKKETKKETKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI11	Uncharacterized protein	0.934	489-513	RLRLRRRRRSTGFPGFHARKTRRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EI11	Uncharacterized protein	0.685	51-57	RPPHRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLU5	Uncharacterized protein	0.79	116-125	AKKPRARTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLU5	Uncharacterized protein	0.692	94-101	KKRKTPVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMK4	MFS domain-containing protein	0.986	549-570	WREGIDAERRRKRSEKSKRRAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSY4	Fungal specific transcription factor domain-containing protein	0.71	35-42	HHRAKRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTT8	PH domain-containing protein	0.833	349-359	RKEGKKQKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVR3	Uncharacterized protein	0.995	439-454	NEKRKGKKKNKRKADR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVR3	Uncharacterized protein	0.657	479-484	GRPHKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWG3	Uncharacterized protein	0.995	180-202	RRQQRKPGKGRRARRGGRTKSGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWJ2	Isoleucyl-tRNA synthetase	0.879	629-640	PRKPGRNKQRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX19	Uncharacterized protein	0.985	215-265	PKGGAAPPKPKEDDKKDDKPKDPPKDNKPKDPPPPPKDDKPKESPKDAPPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N179	FAD-dependent oxidoreductase	0.733	451-460	KGRGRGGRKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N179	FAD-dependent oxidoreductase	0.642	122-128	KTKGAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4C3	Uncharacterized protein	0.78	1397-1414	KRRSKEMGGSRRAIEKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5R9	Uncharacterized protein	0.857	42-59	PAKKSKLPKSSRSARGRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5R9	Uncharacterized protein	0.694	212-221	RKIASAKGKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7K7	Uncharacterized protein	0.823	55-67	ARKKPKLPAKDEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAR9	Uncharacterized protein	0.96	241-257	AKTARRPPVARKPKRKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDZ9	Translation initiation factor IF-2	0.728	519-526	RRKRKEQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDZ9	Translation initiation factor IF-2	0.614	491-493	KPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFQ1	Peptide hydrolase	0.807	452-467	PRKKSSPAKRDARAIR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHC7	Brr6_like_C_C domain-containing protein	0.873	176-192	PRPRDARSHDRVRKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52FM1	pH-response regulator protein palF/RIM8	0.607	214-215	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R2R5	Uncharacterized protein	0.739	78-86	RRRRGSLRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKK1	Uncharacterized protein	0.973	169-202	IQRRRKREKRQFRRGLSERSAATAPTPAGVGKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLV7	Uncharacterized protein	0.972	120-131	PRKGKKQKKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT01	Uncharacterized protein	0.986	200-215	GKKRGGRRRNHRGRPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT01	Uncharacterized protein	0.833	42-59	HHRPRSHHRDPPRGRRAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZQ6	60S ribosomal protein L5	0.907	256-289	KKPEGAEAKKSKEEYKKESLKFKAKKLTLAERKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2F9	Uncharacterized protein	0.639	65-72	RKPPTPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4I8	Histone acetyltransferase	0.998	418-441	ATKEKAKKKKNKKKKLTGPIIARE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N523	DUF4211 domain-containing protein	0.979	486-503	KKVEKRQRLSSKKRRKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N523	DUF4211 domain-containing protein	0.884	149-199	AKRRRLARRQSTPSPPGSPGPSTKGRLRSTPTSRSLKSQRERRMELLRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N523	DUF4211 domain-containing protein	0.796	537-543	GKTKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCR9	Methionyl-tRNA synthetase	0.992	618-645	IEAEKAAAKKLAREKDKEKKRLKKEAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEP5	Uncharacterized protein	0.799	410-418	KERRRRRAL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGE5	Potassium transporter 1	0.836	137-144	RERRRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH71	Protein phosphatase 1K	0.654	692-696	RGRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHT5	HMG box domain-containing protein	0.688	183-191	RRRQRQQKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKJ2	WD repeat containing protein 5	0.993	55-145	PGSRSRSGSPKEDDEARRSREKRSYSRTRSLRSRSRSRPTSRSRSRSHSRSRSTSRSTDRRRSRSRRDSSSRSRSRSRSRSESRSRSRSHT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MM02	T5orf172 domain-containing protein	0.615	327-329	GKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWA2	Uncharacterized protein	0.987	82-101	GRKKSRRKSKRASAPPPGRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWA2	Uncharacterized protein	0.946	324-349	DKRRRQRKQEREQEKVEKRLARRAER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWA2	Uncharacterized protein	0.833	160-172	ARKLSKRRKNSHD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWA2	Uncharacterized protein	0.739	8-14	RRSRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1X8	MFS domain-containing protein	0.984	718-742	KELKKLSKKQRKEAKKAQKAQKGTW
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N582	Uncharacterized protein	0.867	361-369	VKKGKKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N582	Uncharacterized protein	0.854	262-281	KQKARERRKAEDAKRAQEFK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F3	Uncharacterized protein	0.981	94-113	KSKGKEDRAPKKLKGKKSKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F3	Uncharacterized protein	0.957	5-43	KRKDAPGSKPAAKPPAGEPPSKRPRSDSASKSKDKADKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F3	Uncharacterized protein	0.892	1468-1477	KTKKTKKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F3	Uncharacterized protein	0.815	1719-1731	KAKGLKPKQAKKW
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8I5	Ribosome biogenesis protein Kri1	0.997	609-632	RDPEKKRKDKKRLGKKARLRQWRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8I5	Ribosome biogenesis protein Kri1	0.996	664-697	KSHKGKDKGKGKAKAEGEDDEKKSKKRKRSKGTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8I5	Ribosome biogenesis protein Kri1	0.991	341-393	RREETKGRKRQRELEKERKEAEKQERREERARLKRLKLEEAEEKLKKIKKAAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8I5	Ribosome biogenesis protein Kri1	0.922	449-457	KKRKPKKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8I5	Ribosome biogenesis protein Kri1	0.905	512-533	SKKRKTSKDHKKDRIAAQRAAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCV1	Chaperone dnaJ 6	0.972	266-278	AAPKAKKKGKKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCV1	Chaperone dnaJ 6	0.951	220-234	AAGEGKGKGKGKKKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCV1	Chaperone dnaJ 6	0.919	183-197	ESKKKRDKRVKDAKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCV1	Chaperone dnaJ 6	0.87	306-324	KSNGEKAAAGSTKKRTRRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND00	Uncharacterized protein	0.961	7-43	PAGHRGKEARLVNQKRKERAKESQKREADKPELKSLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NID4	Uncharacterized protein	0.784	300-318	PKSKKIKLMPNKSRSAKPH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKE0	GATA-type domain-containing protein	0.944	484-497	GRGERSKKKRRFRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKT1	DNA-directed RNA polymerase III subunit RPC9	0.693	31-38	HKKEHRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML35	Non-specific serine/threonine protein kinase	0.669	228-235	KKLEIRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNB5	Uncharacterized protein	0.996	326-356	SATKKDQPKPTPKTKPRKAAGGRRKLGRRGQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR31	Uncharacterized protein	0.979	299-316	ERRRGKGAGDKSRPKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR31	Uncharacterized protein	0.784	257-266	ERERLRRKKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTK3	Uncharacterized protein	0.937	344-358	RQLKKEKDSKKKRGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTK3	Uncharacterized protein	0.915	221-244	RKGKRTKKASSGEDKADKRERRAH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTK3	Uncharacterized protein	0.674	306-314	KPEKQRRIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZR9	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22	0.765	24-38	KALPAKAPAAAKPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZR9	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22	0.723	593-599	RRKQRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7T4	Vesicular integral-membrane protein VIP36	0.983	265-284	DNKKADKTKGKKAKKVKEHK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAE2	Zn(2)-C6 fungal-type domain-containing protein	0.716	19-26	KRPHRKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDY8	1,3-beta-D-glucan-UDP glucosyltransferase	0.989	290-303	KGKGLKRKNKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHF0	Uncharacterized protein	0.753	136-149	KSRVSKPKAKTTKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8N4	Actin cytoskeleton-regulatory complex protein PAN1	0.991	1108-1145	QGKLKKEEEKRRKKAALAEAKEKEAKLAARRQEIEAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8N4	Actin cytoskeleton-regulatory complex protein PAN1	0.764	1035-1050	EAKPPPPPPSRKAAPD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RA36	60S ribosomal subunit assembly/export protein LOC1	0.881	56-70	GRPSIADLLKKKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RA36	60S ribosomal subunit assembly/export protein LOC1	0.837	92-100	KPKGKKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RA36	60S ribosomal subunit assembly/export protein LOC1	0.793	159-169	TKNSLRKKRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RA36	60S ribosomal subunit assembly/export protein LOC1	0.789	188-195	ATKAKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RA36	60S ribosomal subunit assembly/export protein LOC1	0.608	148-148	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RA36	60S ribosomal subunit assembly/export protein LOC1	0.605	152-152	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RA36	60S ribosomal subunit assembly/export protein LOC1	0.605	154-155	AK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPT9	Uncharacterized protein	0.788	86-105	RRAHRKPDVSRRKSTRDHPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPT9	Uncharacterized protein	0.752	307-316	SSAKAKKREE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWW4	rRNA-processing protein FCF1	0.981	5-39	KKTRKFGAVKRMIGKRDERLKKPKVPEGGSGKAKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYI5	Mitochondrial inner membrane translocase subunit TIM44	0.901	288-300	ERRRRREARLKKN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYI5	Mitochondrial inner membrane translocase subunit TIM44	0.804	138-144	KKKKKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ75	Splicing factor YJU2	0.649	291-296	KKKTDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ75	Splicing factor YJU2	0.627	302-305	IKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZK3	Uncharacterized protein	0.658	128-135	RARRNVRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N509	Uncharacterized protein	0.816	482-490	RRRGRPRKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N509	Uncharacterized protein	0.681	457-463	RKRGRPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N784	Uncharacterized protein (Fragment)	0.907	57-69	RKSTRKREKKEKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAD6	Uncharacterized protein	0.882	600-621	KKVIKSGRSSKPKTARRSRTTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAD6	Uncharacterized protein	0.797	554-570	KRKRKDSSEPKNRLYRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAD6	Uncharacterized protein	0.665	651-659	ARRAPNRGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAD9	1,4-alpha-glucan-branching enzyme	0.602	185-185	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHG7	Uncharacterized protein	0.879	124-136	GKSKKSRRDKRGN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A0A151V4H3	Uncharacterized protein	0.977	39-62	NAAKAQKPKRKTKFWKRSGDKKYK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RM69	Eukaryotic translation initiation factor 3 subunit A	0.991	803-909	FEKRRRDAERELEKQIAQRKKEYREKKLREKRQREEEERQLREAEERAAKEKEEQKRREEARKEELARAKAQREAERQEMAEKAALQARREEEALERRKREKEKLAS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RM69	Eukaryotic translation initiation factor 3 subunit A	0.777	653-661	ERERKRKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RM69	Eukaryotic translation initiation factor 3 subunit A	0.745	590-633	ARAKAGAEKEHREILARKDIIQKRKEEASDLQAKREKENAKIKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNC4	Zn(2)-C6 fungal-type domain-containing protein	0.994	32-67	KKKRKEKQKKKMGESKGDEPGPSGQPQRKRATHKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR6	Uncharacterized protein	0.996	292-305	EPTEKPKKKKKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR6	Uncharacterized protein	0.924	236-250	GRKPPSKKESGKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUR6	Uncharacterized protein	0.835	276-288	EKPRRKSKTARTE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZP1	Uncharacterized protein	0.982	210-233	RKKSKKPNAPPKRRPEKVASLRGD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZP1	Uncharacterized protein	0.964	12-54	KRKRTGAPENPKKRLATSGSRPSKAQPSKSRDKASSAAPAKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4X6	Ubiquitin	0.822	121-128	LRPKKKLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5G9	Chloride channel protein	0.941	76-86	RLRRKARRKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7Z7	Uncharacterized protein	0.905	266-282	KRIPPSKAVNKKSKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE15	Uncharacterized protein	0.654	290-298	RKASPDKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHN3	DUF1308 domain-containing protein	0.88	557-574	GAKGQPRERRKTNGRAKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGU2	ATP-dependent RNA helicase DBP4	0.994	690-707	AKQKKREKKLKRKARERG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGU2	ATP-dependent RNA helicase DBP4	0.94	4-28	KGKAAPAKPPTSHKKEVKSLKRKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGU2	ATP-dependent RNA helicase DBP4	0.909	616-635	KRREKLIKSKKQLAKLKGKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGU2	ATP-dependent RNA helicase DBP4	0.789	531-537	KPRRRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGU2	ATP-dependent RNA helicase DBP4	0.768	753-759	PKKKPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGU2	ATP-dependent RNA helicase DBP4	0.631	413-416	RKKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMR1	Ribosome biogenesis protein SLX9	0.897	104-124	KVRLKSIRSRPGALKRKEKLV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMR1	Ribosome biogenesis protein SLX9	0.875	66-78	SGKITKRRRPSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP25	Uncharacterized protein	0.943	1022-1048	PPPRTKKPSRKKEAADASAAAEKKGKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MP25	Uncharacterized protein	0.893	727-760	RRAQDRAAQRQKKRELEEERKREKEAAAATKAPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT18	Zn(2)-C6 fungal-type domain-containing protein	0.974	258-269	PAKKKKKKSKAG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT18	Zn(2)-C6 fungal-type domain-containing protein	0.952	450-459	KKKKKKSAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MT18	Zn(2)-C6 fungal-type domain-containing protein	0.863	311-320	KKKRTPKPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX17	Multiple RNA-binding domain-containing protein 1 (Fragment)	0.848	145-160	AKPEAESAPKKQKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX17	Multiple RNA-binding domain-containing protein 1 (Fragment)	0.609	734-736	KAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ94	Uncharacterized protein	0.847	314-340	RKRKRTHTATDKPGPYKRPKGSALRFG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0K4	Uncharacterized protein	0.84	135-145	RGGKRRRLRPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N459	Uncharacterized protein	0.975	753-772	VMKKAREKAKAKAKRTTARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N459	Uncharacterized protein	0.923	159-185	KVRWRLPKKKKSQAAYRASLKVVSKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N459	Uncharacterized protein	0.792	98-114	RAKATDKTPKRQRKNAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N459	Uncharacterized protein	0.624	302-304	RKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N887	Uncharacterized protein	0.994	48-78	RPKPKEGKPKEEKPKEEKAKEAKPKEEKSKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8E3	Binuclear zinc transcription factor	0.602	73-73	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8S2	Uncharacterized protein	0.987	658-668	PRRRKPPRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND13	Uncharacterized protein	0.666	26-35	DRKGQRGTPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND13	Uncharacterized protein	0.602	19-19	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND13	Uncharacterized protein	0.601	23-23	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND70	P4Hc domain-containing protein	0.837	102-110	RRVKKKPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLR8	Uncharacterized protein	0.765	56-61	RRKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QT54	Mitochondrial distribution and morphology protein 34	0.696	366-370	RKKKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8D7	mRNA cap guanine-N7 methyltransferase	0.983	52-92	PARKRQRSKSPSGEAAPRKLKRPGARATISEADRKAARERA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R8D7	mRNA cap guanine-N7 methyltransferase	0.833	220-235	RGGRGGRGGRGGGRGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKX7	Mitochondrial import inner membrane translocase subunit TIM54	0.612	236-238	PKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNL4	PHD domain-containing protein	0.997	194-220	PPKPPAPKPKKNSKKARAAARAAKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNL4	PHD domain-containing protein	0.826	369-393	RKIEKERNSRLMSREKRLREREARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNL4	PHD domain-containing protein	0.723	307-317	KRQKKIRERER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ17	Uncharacterized protein	0.958	6-25	KRRGDRARQPNSRKARKARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU14	Signal sequence receptor subunit alpha	0.732	253-266	KRVKSSASAKAKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV83	Zn(2)-C6 fungal-type domain-containing protein	0.802	41-47	NPRKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYL7	High mobility group protein	0.992	284-344	AKTPKSTKKGAVGKRKSAAASEVATPAPEPKKRKRQSKAAEETPAPEPAKKSSRAKKNKSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYL7	High mobility group protein	0.881	119-132	VKKERKKRQHDPNA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N235	Uncharacterized protein	0.929	106-124	KTKTKAKDKDKDKGKGKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAQ8	Uncharacterized protein	0.992	56-75	HRTHRRKHRRHRPAKPHRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE59	DNA-repair protein rad13	0.974	1255-1269	RGGRRKRGRAAQRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NE59	DNA-repair protein rad13	0.872	90-99	GRKRRREGRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGH2	Uncharacterized protein	0.83	180-197	RKGVVKRKPISKAEREKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGH2	Uncharacterized protein	0.814	356-368	KPRPKKNVKSQKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGH2	Uncharacterized protein	0.686	64-70	KRLRRPG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGH2	Uncharacterized protein	0.614	641-643	RPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIR7	Ribosome biogenesis protein NOP53	0.994	291-326	AKSKRPERKTQAQRNRIKRRKEEEQRRKEKASQKLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIR7	Ribosome biogenesis protein NOP53	0.78	21-30	SRKGKKAWRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIR7	Ribosome biogenesis protein NOP53	0.666	418-425	RMKRPFRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIR7	Ribosome biogenesis protein NOP53	0.657	76-82	KHPKHIK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ67	RNA binding protein	0.997	158-176	KSEKKKKKKKSKDGKRSEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ67	RNA binding protein	0.988	36-52	KAEKKRLKKDKKDKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ67	RNA binding protein	0.98	69-83	KKDKKQKKEKKAKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ67	RNA binding protein	0.958	101-120	KKEKKDKNDKKSKKYSKAKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ67	RNA binding protein	0.824	314-334	NEKIRAKNDKLREERARRMKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJ67	RNA binding protein	0.761	133-140	KPKTKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A0A151V4P7	Uncharacterized protein	0.739	38-43	PKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A0A151V4P7	Uncharacterized protein	0.619	74-76	RKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MLJ3	BTB domain-containing protein	0.957	143-153	RKGKKQKKKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR60	Ubiquitin carboxyl-terminal hydrolase	0.981	596-645	PAAEIKPSSKEDKAREKQLQKEKKAAEKEQVKREEKERKERESRQREARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYD3	Uncharacterized protein	0.63	41-44	AKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4R4	Zn(2)-C6 fungal-type domain-containing protein	0.638	337-342	KKEIKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N512	Uncharacterized protein	0.896	402-445	RAAEREKARKAKRDAELNALDAKAQKKYLEKEREKQLRKSNKRM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6D2	Uncharacterized protein	0.999	187-201	GPKKKKKRKREKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6D2	Uncharacterized protein	0.901	68-84	RGNRNKMKIVKGKKKAS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6Q0	Uncharacterized protein	0.858	513-529	KAAGRGRRRGPLILRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9S2	40S ribosomal protein S24	0.992	95-135	RIGKATKVEKASRQQRKQRKNRQKTLRGTAKVKGAKAKKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEV6	SpoU_sub_bind domain-containing protein	0.896	68-100	LGARGRRAKDDHAPSTFKIRKGKKDISQPPKQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFC0	Uncharacterized protein	0.963	143-185	GLKKHGNGKKNGKPEKSATETAASALDPKEKRKAMKKTKRLGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFC0	Uncharacterized protein	0.833	1073-1086	GRPGEWKPKEKKHR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNM1	50S ribosomal protein L2	0.927	334-387	GGGRGKSKGRRHPTSPWGTLAKGGFKTRRTNNPNRWVVVPRERNMGKRRAKKSS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNM1	50S ribosomal protein L2	0.901	91-130	WKGRPHLPLTIPKKGQSKGGRNNTGRITVRHRGGGAKRRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNM1	50S ribosomal protein L2	0.604	83-84	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTQ6	Small nuclear ribonucleoprotein Sm D1	0.997	86-125	KPKNKARKETDRGGRGGGRGRGGRGRGGFGRGRGFGRGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWF8	Zn(2)-C6 fungal-type domain-containing protein	0.659	70-79	KRRATWRREK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4C2	BZIP transcription factor HapX	0.923	119-153	PPRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N503	Uncharacterized protein	0.848	23-35	KAPKRKIKLRGPM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E9	Uncharacterized protein	0.697	1292-1299	RRLSKKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E9	Uncharacterized protein	0.667	353-364	KLRKQPPGERHP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8H8	Uncharacterized protein	0.942	365-378	KKKPPPPPPPKKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCN6	Uncharacterized protein	0.657	7-11	RQKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDR7	tRNA (guanine(9)-N1)-methyltransferase	0.992	84-116	KKLKRQAMWAERKEDRKRQRKDKRHEKQAHKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHZ3	Uncharacterized protein	0.966	212-243	KAKKKTPNPKKRAAATTAPSHTPQRKKAKAKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHZ3	Uncharacterized protein	0.949	397-426	KKVEKKAKWVWKKKQAEAAPSQKKGGKTSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKC1	U2 snRNP component IST3	0.998	191-330	REQKKSSRRKDKDGSRSSRHHHHHRTSRKHREESDDEAGSDRKRRKRRDESRSRERRRRDDYKDKDKHRDSDSRRRDDSKDRRRRERDDDGHHRSKDRGRENSRDRDRDRHDRERHRRRHDSRERHERRKERPRSRSPRD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGY0	Uncharacterized protein	0.773	37-43	RRRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QTA3	Eukaryotic translation initiation factor 3 subunit J	0.978	57-92	EKAKKAAEAKAKAEAEAKANKKTKAARINEHKQRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RE77	Myosin-1	0.956	1133-1161	RPPPPAPPAANGKNKPLPPAKRPAAGKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RE77	Myosin-1	0.916	969-998	TPKGKPVPPRPITRGKLIRPGGPNGRPARG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RE77	Myosin-1	0.7	23-30	GGRARPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML80	MRG domain-containing protein	0.742	73-79	EKRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQD7	Uncharacterized protein	0.664	684-691	RRRISRRW
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRZ2	Uncharacterized protein	0.843	181-196	ERRKHKYERRQRRQEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRZ2	Uncharacterized protein	0.84	379-386	RRRKSRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXP8	Uncharacterized protein	0.973	110-129	PKKGKGRGNRGRGRGNNSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0B1	Uncharacterized protein	0.967	154-175	ERGVKRRQKRLAKTMRAEKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N510	Uncharacterized protein	0.782	86-93	KEKKKSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAA4	Uncharacterized protein	0.981	196-236	RPRPRKSPVKRSKTPARKTAAAPKIDAQETGTAKRRGRPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAA4	Uncharacterized protein	0.92	131-159	PRRRGRPRKSGTPMPSKTGTPMPSTRKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBP6	Vezatin domain-containing protein	0.666	572-580	MKADREKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFK6	Uncharacterized protein	0.752	108-115	RRARRRLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFV1	Methyltransferase	0.989	234-279	RKPKAGRDMRKGGKAWIVKKKEQMERKGKVVKASSKYTGRKRKPAF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGL0	Uncharacterized protein	0.617	103-105	RRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC3	Uncharacterized protein	0.732	453-458	ERKRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC3	Uncharacterized protein	0.722	15-31	PKLRGTPLKLRRDLRRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC3	Uncharacterized protein	0.717	179-188	RKARPRVKLS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC3	Uncharacterized protein	0.646	126-132	TPPPRRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMC3	Uncharacterized protein	0.616	121-124	PRAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR92	Uncharacterized protein	0.925	9-40	KRPVGRPRRDGQPAGSVPKVSSGRPRGRPRKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUS2	DUF2431 domain-containing protein	0.981	3-61	KRRKLQQGRPAKGRAAYKGGKGAPNPHAAGHRQKGPGPGSSPGPGHSATGGPKPKGKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUS2	DUF2431 domain-containing protein	0.84	178-192	KQKQRPPNKRKAGGP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV02	Uncharacterized protein	0.809	746-753	RPKKKNKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV02	Uncharacterized protein	0.614	541-543	KKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWU5	Uncharacterized protein	0.892	80-88	KRVKKRKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA4	Uncharacterized protein	0.673	88-92	KKPKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N093	Zn(2)-C6 fungal-type domain-containing protein	0.897	11-22	PAKKRKAHRKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N097	Uncharacterized protein	0.739	457-468	SQRKLKGIRRGE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5U1	Uncharacterized protein	0.879	245-259	ARRRAKKDRFGRAFR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCT0	RXT2_N domain-containing protein	0.796	41-50	RGRKLKRRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEH3	Histone transcription regulator 3 homolog	0.763	422-429	KRPKRARR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHQ7	SCP domain-containing protein	0.992	44-104	PKPEPGKEDPKPQDEPKQEPPKQEPPKQDPPKEPPKPEPKPEPKPEPKPEPKPEPKPEPPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHS9	RING-9 protein	0.832	576-587	AKLRRRRWRAPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R6R9	60S ribosomal protein L13	0.976	175-202	REARANARHEGKREKRVREKADEEKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R6R9	60S ribosomal protein L13	0.942	30-48	GKKASRRIARRAKAAKVAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R6R9	60S ribosomal protein L13	0.691	127-132	PKKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RGU7	WD repeat-containing protein JIP5	0.878	380-391	AKSNSKRRKGKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKD0	Uncharacterized protein	0.973	106-134	MKRRSPNRGERKIAKPRRSSLGQSPRQKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKD0	Uncharacterized protein	0.933	334-366	REIKNRRNSRGLPGARREARDRKSSAAAPAPAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKD0	Uncharacterized protein	0.648	252-257	KAPRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU00	MBOAT_2 domain-containing protein	0.61	206-207	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUK7	Uncharacterized protein	0.751	27-47	KKRQEKNKILNSKVDRKMRKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWJ3	Uncharacterized protein	0.952	54-71	KLREERERSRKKSTKKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXB9	Uncharacterized protein	0.934	357-367	PDAKKPKKKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N434	Uncharacterized protein	0.998	168-237	PRSRSRPATSRRSRSRSLSSSRSRSRSRDRAGAKPRSSRPGIDSGRSRRRRSRSRSRSRSSSRSDSRSRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N844	Diadenosine tetraphosphate synthetase	0.974	193-208	EDKEEDPKKKKKKLKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9D8	Uncharacterized protein	0.822	4-18	KNRRRRATPPGDRRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAE3	Splicing factor 3B subunit 2	0.941	587-613	RKRQKRDEERRGGGSGGAEKKKEAKYR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAE3	Splicing factor 3B subunit 2	0.92	136-145	SKRKRKKLGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAE3	Splicing factor 3B subunit 2	0.904	12-23	RRAKKKEEKKAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND72	Mannan endo-1,6-alpha-mannosidase	0.908	512-535	KRGAARLPLARGRLKRRAGDDRPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ND72	Mannan endo-1,6-alpha-mannosidase	0.872	473-488	ERRKKAKGVGLLRRLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIQ3	MFS domain-containing protein	0.715	527-537	WREERRLRKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52C47	AdoMet-dependent rRNA methyltransferase SPB1	0.998	736-782	KPITKAAAAAIKEKMRAFNARPIKKVREAKGRKKMKAAQRLEKLKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52C47	AdoMet-dependent rRNA methyltransferase SPB1	0.993	801-865	IAKLLRKATKKKPKQAVKVVVAKGANRGIKGRPQGIKGRYKIVDPRMKKEMRALKRVAQKAKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52C47	AdoMet-dependent rRNA methyltransferase SPB1	0.981	374-393	KERNSTKKKRERRKENERKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52C47	AdoMet-dependent rRNA methyltransferase SPB1	0.977	616-637	SKKTKEKTADKKAAKKAKKAAQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q52C47	AdoMet-dependent rRNA methyltransferase SPB1	0.676	6-23	KHGKGRLDKWYKLAKEKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKJ0	AGC/NDR protein kinase	0.922	924-937	GRKEKKRPRDRLLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQH9	Uncharacterized protein	0.736	3039-3048	KELKARKGRI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUU9	HORMA domain-containing protein	0.941	254-266	KKKPDKKKKGDAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZY0	RING-type domain-containing protein	0.8	507-514	RHRRRRRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N600	Uncharacterized protein	0.602	29-29	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8S5	ATPase family AAA domain-containing protein 1	0.775	826-837	SARAKPKNKWRV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC98	KH domain-containing protein	0.879	20-45	PRRTSRFDRRSRSPPSRKSEPGRDRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHB5	Defect at low temperature protein 1	0.829	367-377	RHRHRRRRQMR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLQ3	Thioredoxin domain-containing protein	0.709	1093-1101	RRTKKGRLP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ28	Uncharacterized protein	0.991	37-58	RGALARKLKSKKAKKGRGFPRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N042	Translocation protein sec63	0.687	666-671	PPPRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4H0	DUF2293 domain-containing protein	0.995	195-292	LKSHAAAARKEKKLARRRGDGRGSGRSGSSPAPGGGGGSKNVARKTRTAEKMNKTNNGKPLPVAKPLPDHVGKNTKLKLALRPIGVARRKPLPQVKRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F5	Uncharacterized protein	0.936	138-149	LRGRSPRRRRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F5	Uncharacterized protein	0.894	96-111	SGKKGRSRGGIRKQRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5F5	Uncharacterized protein	0.785	254-277	PRTRSRTRNRDFSEARKPKHGDKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB98	BHLH domain-containing protein	0.838	104-118	PKPPSREKPERKRSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBV3	Uncharacterized protein	0.95	397-412	KGKRNQKKLDKKKEKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC82	Transmembrane and coiled-coil domain-containing protein 4	0.976	840-858	PKKKQPATRIPGSKKRKRN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC82	Transmembrane and coiled-coil domain-containing protein 4	0.86	19-32	KGNKGSKGKKGNKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC82	Transmembrane and coiled-coil domain-containing protein 4	0.607	104-105	KR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDX6	Uncharacterized protein	0.986	501-534	RKNGKVKKKKVRSWAGSILTKKSKPRHSKKPSKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDX6	Uncharacterized protein	0.697	963-972	KQKNGKSKRF
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEV5	Chromodomain helicase DNA binding protein 1	0.729	385-393	PKKQRGRPS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEW2	RING finger protein	0.932	635-667	PPPAVRPRAGGQQNARRRGGRGGQHAARGGRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEW2	RING finger protein	0.891	322-331	GRAKRKRRQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEW2	RING finger protein	0.848	680-693	NGAPRRGRGGRPRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJK9	Ser/Thr protein phosphatase family protein	0.67	526-540	KKRRSSSSSPKDKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN91	MADS-box domain-containing protein	0.722	22-27	IRKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNE1	CMGC/CDK protein kinase	0.801	499-521	MPPRDERRRREDRDDRRYDRDRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNE1	CMGC/CDK protein kinase	0.768	524-546	DRARSSRTRSRSPIRDRDRDRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ95	Uncharacterized protein	0.945	6-22	RPRGRGRGRGRAARAGA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ95	Uncharacterized protein	0.942	149-165	RLQRARGRGRRARGRGD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ95	Uncharacterized protein	0.75	340-353	KRIKEEEEEKKKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ95	Uncharacterized protein	0.604	120-120	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQ95	Uncharacterized protein	0.604	123-123	R
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU69	Uncharacterized protein	0.781	330-349	EDKKKKTQVVEERRRSSRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW81	XPG_I_2 domain-containing protein	0.987	578-606	PKLQGKSKKKRKRTADASGARASPKMAGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1U7	Uncharacterized protein	0.951	208-234	KKRMERQLDKLKARWGPRKAKARSDRY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2G1	Ubiquitin-40S ribosomal protein S27a	0.995	73-99	LRGGGKKRKKKVYTTPKKIKHKRKKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4C8	Uncharacterized protein	0.993	8-31	KKRSRDEANRQFKGRPRKKPRKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4C8	Uncharacterized protein	0.908	91-109	RRKPTAKPTKTKQKEKSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAU8	Uncharacterized protein	0.619	816-822	RSGGGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDI6	rRNA adenine N(6)-methyltransferase	0.845	333-344	VAKTPSKRKKTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NF09	Zn(2)-C6 fungal-type domain-containing protein	0.889	16-29	AWRKKPRKFAPKSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIU3	SH3 domain-containing protein	0.973	369-382	AAKKEKPKRPAKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NK65	Uncharacterized protein	0.994	88-140	KGKKSTKVAKSTKVAKSTKKGSKQTAKKPIAKPSTTAKGKKSKRPKQHVVTRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKL5	Uncharacterized protein	0.984	145-161	GKRKSKKAAGRGKGKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKL5	Uncharacterized protein	0.676	264-270	RQRRRHE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	Q01168	Nitrogen regulatory protein NUT1	0.645	840-845	KRQRRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MQP1	Vacuolar transporter chaperone 4	0.708	656-664	RFKAPKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU16	Uncharacterized protein	0.722	5-14	RIRKPRTSRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU16	Uncharacterized protein	0.668	255-264	RRAWIRRRVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MX29	GED domain-containing protein	0.807	87-100	RKREELRARAKKLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXI5	WD repeat-containing protein	0.973	3-29	KGKRKRDKAEQVEKKTSKRHRSKSKLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXI5	WD repeat-containing protein	0.75	125-134	AKPLRKRSKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MXI5	WD repeat-containing protein	0.642	452-456	KKRDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ57	Uncharacterized protein	0.944	176-189	AARRRARRTRRKQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZ57	Uncharacterized protein	0.734	9-17	PRLAKKRNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2B9	Uncharacterized protein	0.733	41-48	DRLPKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4R1	NMDA receptor-regulated protein 1	0.988	597-629	KKKAAKKAKKAQEKAEREAQEKAAKENPNKGQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NKK2	Uncharacterized protein	0.737	37-45	NRRRRDKDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML33	Urease accessory protein UreF	0.802	46-59	RRRLGAKRPRAVRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MMU1	Uncharacterized protein	0.814	148-156	HERKRRAKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYK4	Fibronectin type-III domain-containing protein	0.659	349-356	KKKEQKEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N103	Uncharacterized protein	0.907	147-157	RKRRPRRNHRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1Q9	CP-type G domain-containing protein	0.844	626-642	SGKKHFKGGQKPKANRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4A7	Uncharacterized protein	0.99	1452-1481	PARKKARKTPAPKKTAASPKKTPAPAKAAP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4A7	Uncharacterized protein	0.948	1516-1546	PAAKSPAAKSPAAKTPTARPKPTPAKRKPVA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4A7	Uncharacterized protein	0.868	1224-1235	AKRKRAKTKQKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4A7	Uncharacterized protein	0.801	1097-1115	KAPATKPKPTRGPGATPKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4A7	Uncharacterized protein	0.724	27-37	KQEKTKKSPPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDX7	rRNA-processing protein	0.996	30-122	KNGKNWHAPRKPFRPGSGLTAYEKRAKERVTMSAIKAKEKEMKDEKEAERQARIKTIKDRRAAKEEKERYEKMAEKMHKKRVERLKRREKRNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFI2	Uncharacterized protein	0.683	38-51	RRGASTKQNKKAEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGS5	DEAH box polypeptide 37	0.772	62-72	SAKKAKRLEKY
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NLS5	BZIP domain-containing protein	0.825	354-375	RRVRAPRPPGSNRAAAKKCREK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH18	CENP-T_C domain-containing protein	0.801	550-558	RAPLKKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH18	CENP-T_C domain-containing protein	0.641	122-131	RRKTLGANKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR06	Glutamate decarboxylase	0.626	163-168	KRWKNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVP0	Uncharacterized protein	0.988	811-857	ASTPASKPKPAAKAKKAAAAGNALPNKKAAGGNKKASGAGGKKSSKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVP0	Uncharacterized protein	0.955	550-590	SPIHAAPAARRDSKDDDRPKRPIHPPKKELGYDGKGSKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVP0	Uncharacterized protein	0.916	953-972	GRGQKPKKNKPMGKGEQERK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVP0	Uncharacterized protein	0.869	524-548	TQPKPKPAPAPAKPPPPPAPIEKVV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVP0	Uncharacterized protein	0.657	803-807	KKKLA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MZJ4	Xylanolytic transcriptional activator xlnR homolog	0.857	128-138	ERKKRGKASRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N198	LCCL domain-containing protein	0.907	674-697	KMRRRSLTTRSPKRNQGARKAKRT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1Q8	Uncharacterized protein	0.824	298-303	RRKKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1Q8	Uncharacterized protein	0.805	384-394	AAGKRGKKHYK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6E7	SAS4 domain-containing protein	0.983	549-565	RRNARRKRRDKRGVLRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7K9	SNF2 family ATP-dependent chromatin-remodeling factor snf21	0.984	1225-1266	KKRGRKPGSKNVEKRKAEDGDDEPPAKKRRGPQGRPKAVKTG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7K9	SNF2 family ATP-dependent chromatin-remodeling factor snf21	0.755	1181-1195	RKQARKDKRETNRLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7T1	DNA ligase	0.823	135-157	PAKRQRSPWVKKEAKEDKSKLVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7T1	DNA ligase	0.684	101-107	KKARRSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N832	Uncharacterized protein	0.779	297-312	KKDKLPKEIRKAAKDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH83	RRM domain-containing protein	0.983	623-643	KPAGEHKRGGRRRGGRGRGGD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH83	RRM domain-containing protein	0.894	209-252	ANKSKDTSVARSGKHSRHDSQPSKNKGSEDSKRKSREAKTEKST
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH83	RRM domain-containing protein	0.8	404-415	KKGRSRRGAADK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NH83	RRM domain-containing protein	0.755	380-390	GSSRGPRGKRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHS1	Rad21_Rec8_N domain-containing protein	0.872	316-323	RRKGRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A0A151V4H4	CCHC-type domain-containing protein (Fragment)	0.955	70-98	EREERKQKSRGKDKKEKYPYSPDKNRKSN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4QV78	Translation factor GUF1, mitochondrial	0.943	659-683	KLHAADPSRRRKLLEKQKEGRKKLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTG5	DNA replication initiation factor Cdc45	0.998	749-784	DKKKKAEEKRAKAKAREESRKAKERIREEKRAAKRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTG5	DNA replication initiation factor Cdc45	0.825	311-330	PKAPSARKMRRQLLRLRREK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU32	DNA polymerase II subunit 2	0.747	12-19	PRKKRAQK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUI0	Uncharacterized protein	0.764	57-64	RKRPRRGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWB8	Uncharacterized protein	0.827	362-370	KRPRRPRGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWB8	Uncharacterized protein	0.619	65-70	RGGRTR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY59	Non-specific serine/threonine protein kinase	0.749	626-647	PPKKESAAAGLLRRFSTRRRKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MY59	Non-specific serine/threonine protein kinase	0.603	814-815	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1F0	Methyltransferase OMS1	0.763	76-87	PALKHRAGKPKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N590	Uncharacterized protein	0.787	1035-1042	RRPSKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5Q2	C2H2 finger domain transcription factor CON7	0.856	293-309	EIRKEWKARKKEEEAAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N850	Transcription regulatory protein SNF5	0.925	157-180	PKNKPRPGKRTTEPLKWRKKDMRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N850	Transcription regulatory protein SNF5	0.607	469-470	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8C4	Uncharacterized protein	0.998	951-1032	KKKEEDEKDKQCKENRKWRKNCRRKGRGKGHKEGDKKDDEKDRKKGDRKDDKKEDKKDNKKDSKKDEKKDNKDEKKGDDKKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N923	Uncharacterized protein	0.778	56-76	ARPERRPRDACQRRRPPERRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBX9	Uncharacterized protein	0.943	312-324	IRPKKEKKKSARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBX9	Uncharacterized protein	0.941	796-813	KSNPSRPRSSRRKGRGRG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC31	ERF-3	0.864	199-236	PAAAKEPAKKEEDVKKEEAAKKEAQAKPQAGAKAAAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC31	ERF-3	0.601	666-666	K
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NET9	4-coumarate-CoA ligase 2	0.971	533-557	PSGKILRRLLRDREKERRRKQGAKI
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFS9	Uncharacterized protein	0.828	84-97	EEEKQKEGQKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGV4	Mitochondrial chaperone BCS1	0.688	596-602	RRKWPRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NL09	Choline kinase	0.995	158-179	REKEKKESRRKRRMTRHRKSKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NL09	Choline kinase	0.699	379-384	KPKKPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NL09	Choline kinase	0.616	244-246	RRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4R4J0	37S ribosomal protein S25, mitochondrial	0.712	70-76	PKARKPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKP6	Sensor protein zRas	0.857	482-503	GRTRSRSPDGPKKQPQHRRPRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNY3	Uncharacterized protein	0.849	5-18	RNRGRGRGRGRGWS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSQ8	Zn(2)-C6 fungal-type domain-containing protein	0.726	721-729	KRSKGKGKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTB1	Cytochrome b561 domain-containing protein	0.935	280-305	KSKKKSTLGSRSRSRSRSRMRSRSRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTB1	Cytochrome b561 domain-containing protein	0.894	850-860	ERRRRRRLERR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTB1	Cytochrome b561 domain-containing protein	0.637	511-518	KMKDRRDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTB1	Cytochrome b561 domain-containing protein	0.611	364-365	KK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM2	GRIP domain-containing protein	0.985	14-29	KKKNNKKKKAAGKAKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU85	Uncharacterized protein	0.645	1147-1150	KRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.995	2917-2928	KGKKKKKKGKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.993	4970-4982	KSKKDKKKKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.992	2680-2694	TKKGKKAKKSKGKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.989	3181-3196	RSGKKKGKKGSKKKQV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.988	1872-1883	SKKKSKKKKKNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.988	4316-4330	KEPKKKSKKDKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.986	103-114	ARRRKYRKKKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.981	3881-3892	VKKSKKDKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.981	4230-4241	KKSKKDKKKKKQ
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.98	4832-4843	KKSKKDKKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.976	1658-1667	SKKKKKKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.975	1493-1503	GKKKKKKSKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.972	3337-3347	KKSKKDKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.972	5413-5426	SSKKSKKKKKTPDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.97	4632-4644	KKSKKDKKKKNAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.969	990-1000	SGKEKKKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.968	1292-1302	SGKKKKKAKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.965	4759-4771	KKSKKDKKKKSSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.957	4524-4536	KKPKKDKKRKDAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.952	5104-5114	KKSKKSKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.936	4024-4035	TKKSKKSKKQKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.934	1221-1237	RKLSKKERRRLKEAQKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.93	3806-3816	KKSKKDKKKKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.93	4101-4111	AKKGKKGKKNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.927	605-615	RERKRRDKKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.922	3403-3413	KKGNKGKKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.915	2113-2122	KKSKKKSRKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.91	4380-4390	TKKSKKEKRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.905	2053-2061	KKKGKKNKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.901	1421-1428	KKKKKSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.885	1764-1772	KKKGKKSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.865	3664-3672	KKSKKSKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.828	3610-3617	KKGKKGKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.808	772-788	GHRGKGVRKSEPQPKRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.739	479-497	RREREEPRENDARPKRTRS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUB8	Uncharacterized protein	0.719	14-20	RRRRRER
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUL6	ATP-dependent DNA helicase II subunit 2	0.881	558-570	KKVPPKAKGKRQR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUQ8	WW domain-containing protein	0.997	285-317	KAERAGKRLTKGELKHFKEKRKARKEEKRRAWL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV10	GATA-type domain-containing protein	0.602	441-442	RR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWI3	CMGC/CDK protein kinase	0.966	93-117	RPARKPKLTWVAKSRGKKKGPGATP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWI3	CMGC/CDK protein kinase	0.922	689-696	GRKRKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYI2	Ribosome production factor 2 homolog	0.838	6-22	KPRNARSKRILEKKAPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N190	Pre-mRNA-processing protein 45	0.908	383-401	EEARKERRKEEERKLRQSR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N190	Pre-mRNA-processing protein 45	0.901	224-241	PPKFKHKKIPRGPPSPPP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N190	Pre-mRNA-processing protein 45	0.822	344-362	KAREERAGAGSRRRSRSGS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1T3	Uncharacterized protein	0.912	522-541	KPAPKPKPEPKKETEKGDKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3S9	Uncharacterized protein	0.952	138-153	SSTSHRHRHRRRRRDK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3S9	Uncharacterized protein	0.951	239-289	ARERKRRERAERDEERARDRRARDDAGRVDDAVEARLRRGRDRRLRREWRE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3S9	Uncharacterized protein	0.936	80-128	KFRFKDPARKKDRRDRESDHTSDRHHRSRRHRGDEDDERHRSRRHRHDH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7G4	MI domain-containing protein	0.96	29-78	SKGRGRSNRSGGRAFDRRPNRGGDRPKGSSHASHRAVEVTKKPNLKRSKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7G4	MI domain-containing protein	0.628	810-814	KKRTK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NEM6	CMGC/DYRK/DYRK2 protein kinase	0.755	1241-1248	SKGRRRRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGN1	UBA domain-containing protein	0.976	761-780	LAPKPKPKAAPPRPKPKPAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGN1	UBA domain-containing protein	0.835	257-269	AKARAKAKAKAPE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGN1	UBA domain-containing protein	0.648	102-106	RKKEE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NIW6	4-coumarate-CoA ligase 1	0.889	555-577	SGKILRRLLRDREKEKRRSQGSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHR5	Uncharacterized protein	0.98	306-338	PKKKKPKPSPAIAAAVPKKVILKTKGPKKEKVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHR5	Uncharacterized protein	0.842	167-177	GRGKKKKDMEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHR5	Uncharacterized protein	0.74	390-407	KKKLSTTKIPSPAKKLKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MKC3	ATP-dependent RNA helicase DHX8	0.722	160-165	KIRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4ML70	ATP-binding cassette protein	0.948	105-113	GKGKKKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNX1	Ribosomal protein L15	0.944	40-78	SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPVPKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNX1	Ribosomal protein L15	0.858	166-193	ATGKKSRGLNKGHRYNKTTAGRRKTWKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MU18	Pre-mRNA-splicing factor prp1	0.788	110-124	AKRRQKQREAREKAE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV95	Uncharacterized protein	0.895	975-991	PLKKRPSSSSSRRKKPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV95	Uncharacterized protein	0.859	436-451	AKQRRAREAREKRERE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MV95	Uncharacterized protein	0.734	784-790	KRKKKHG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYP3	Intu_longin_1 domain-containing protein	0.822	349-357	RRAKPRKKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N852	Poly(A) polymerase	0.817	579-595	PVKRLVKKKVPVDRKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9G5	Uncharacterized protein	0.906	44-59	SGKREKTLAKKRPLKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9X9	ATP-dependent RNA helicase dbp6	0.945	75-99	RRKRAKIESPSPEDIRQKKKSRKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N9X9	ATP-dependent RNA helicase dbp6	0.927	170-178	KRKKKKRFK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC70	5'-3' exoribonuclease	0.829	999-1020	RDRGPPRGGGGGGGRGRGGYGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC70	5'-3' exoribonuclease	0.7	412-428	KRKEQEDRRDANAKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NC89	Sde2_N_Ubi domain-containing protein	0.923	147-157	EKKEKEKRRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCP2	Sas10 domain-containing protein	0.997	573-605	NKGLAPKRKKDSQNPRVKKRKKFEQSKKKLKSM
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCP2	Sas10 domain-containing protein	0.91	365-380	RKKKALEKKKLANAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCP2	Sas10 domain-containing protein	0.91	394-404	KPKKRSKKEKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCP2	Sas10 domain-containing protein	0.765	24-31	GKKRKASR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCP2	Sas10 domain-containing protein	0.753	115-120	RKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDG2	Bromodomain-containing protein	0.953	1032-1066	KQRRPRPRLGATGKIVSPQKRPPKEQIALAKKKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFD9	CCHC-type domain-containing protein	0.938	345-372	REERKQRSRGKDRKEKYPYSPDKNRKSN
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFZ1	TPR domain-containing protein	0.735	28-41	KGKKPPDSLRRSRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EH81	Sister chromatid cohesion protein Eso1	0.99	638-664	APPAKPRGRGRPPKGAAKPKTDPGQRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EHT0	Uncharacterized protein	0.984	259-280	KPAAESTGNRNKPKKKTKKGKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRA8	Uncharacterized protein	0.62	281-285	KGSKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MRP9	DNA_mis_repair domain-containing protein	0.959	817-832	RNKSRSKSRRRSKRLK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSD6	Uncharacterized protein	0.669	702-706	GRKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MSD6	Uncharacterized protein	0.633	666-669	RRRH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTA3	SCA7 domain-containing protein	0.999	197-252	GGPGGKTTKKAAGKKTAGDDSKGKKRKADGDPDGKGGPKAKKKKDEPKPKTAKPKG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTA3	SCA7 domain-containing protein	0.976	145-170	VKKEKAQRKKEAREARERAKEAAARE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTA3	SCA7 domain-containing protein	0.897	76-91	KKKSKAKEASAKARNK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTA3	SCA7 domain-containing protein	0.805	38-59	ASKKEPRTPANGPAKLKRAIPK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVE7	Uncharacterized protein	0.828	618-624	RRKKRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MVE7	Uncharacterized protein	0.669	127-132	RKRTRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MWG5	Uncharacterized protein	0.981	180-201	KRGTSLARRAPGARKRHRRRSG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N2V3	Kinesin-II 95 kDa subunit	0.909	629-640	ARAPRKKKQPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N397	Retrotrans_gag domain-containing protein (Fragment)	0.928	147-160	KKKIKNKLVKKKRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6L7	Uncharacterized protein	0.998	349-390	EKERLKKEKEEAERKKKEEEKKKSQEKKGKDGKKTESKDKKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAF0	Uncharacterized protein	0.767	84-92	PAKRKAKAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NB28	Uncharacterized protein	0.931	64-106	GEKRTEKHKHDVKPSKRQGVDGKRGAAHGSAGQKMPRRSEPRA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MNL9	Uncharacterized protein	0.705	81-88	SKPKDKRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPT1	Uncharacterized protein	0.927	75-90	EKSNKKRKGFWKSKKD
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM5	MKI67 FHA domain-interacting nucleolar phosphoprotein	0.978	362-378	AKPAKTTKAKKGRKAKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM5	MKI67 FHA domain-interacting nucleolar phosphoprotein	0.961	257-300	ANRRFKKVPWTKMAGKELEKPKGEARWGKAVEKENRRRSGRLEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM5	MKI67 FHA domain-interacting nucleolar phosphoprotein	0.812	33-57	PAKRKAESEASPVVTKKAKAEKNKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTM5	MKI67 FHA domain-interacting nucleolar phosphoprotein	0.646	8-16	KGRATRAKP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N0Q2	Uncharacterized protein	0.998	93-285	KDGAAPPPPPAKDGGDAAPPPPPPPPEGKAKGKDDGKGKKGKGGDEAEGKGKKAKGGDDAQGKGKKGKGGDEAKSKGGDDAEGKGKKAKGGDDGEGKGKKAKGGDDGGGKGKKAKGGDDGGGKGKKAKGGDDAQGKGKKGKGGEAGGEAGGEGGSKGDGAAKGEAPAAAHRRRRLTPRMTKFPGEKKRCARKV
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N3D9	RNA-dependent RNA polymerase	0.781	38-46	RSPKPRKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N555	Eukaryotic translation initiation factor 5B	0.999	124-195	DGGGRVKTKAEKEREKKEREKQRKKEQAAKKKATGPAKAEPAKAAAPEKKEAAPTPAAAPAADAGGKKKKIP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N555	Eukaryotic translation initiation factor 5B	0.976	230-275	ERREAEEAKRREEMKALKKQKEKERIEQLKKEGKFLTKAQKEARAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N555	Eukaryotic translation initiation factor 5B	0.947	302-318	KKEKKTDNKKNKKKAEK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N555	Eukaryotic translation initiation factor 5B	0.91	60-68	RKKKDKRKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N555	Eukaryotic translation initiation factor 5B	0.8	102-117	KKGKGGKDKAAPAPAA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N737	FAD-dependent pyridine nucleotide-disulfide oxidoreductase	0.875	110-137	RRRDRRRAPRPSEEYTRPGNLSPRRPRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAN5	GRF-type domain-containing protein	0.937	63-77	PGPARPKSPRARRRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ0	JmjC domain-containing protein	0.993	1317-1345	PKPVATRGRGRPRGGRAIRGGRGRGRGLR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ0	JmjC domain-containing protein	0.992	564-577	RPVKKKKNRRKKKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ0	JmjC domain-containing protein	0.973	1082-1097	PAPGPRKRGRPRKIRP
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ0	JmjC domain-containing protein	0.962	1011-1033	RAEPSRPRGRPGRPKRQSERLRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ0	JmjC domain-containing protein	0.732	845-851	AKRKAKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ0	JmjC domain-containing protein	0.684	1123-1131	RGKKLKVAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NCJ0	JmjC domain-containing protein	0.606	1044-1046	KPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGX0	Small acidic protein	0.995	26-77	RAAMRKEKKDLKAEVKKERKLKAKQASKSESAEKETKSSKGKKERQMIRLKL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGX0	Small acidic protein	0.989	169-185	SLHGKKKKAKKNKEKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGX0	Small acidic protein	0.918	150-164	QKKSKKSKKSEKSEA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGX0	Small acidic protein	0.88	207-219	AKKARQEVKKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NGX0	Small acidic protein	0.751	236-243	EKKSKKSK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NHP3	Uncharacterized protein	0.988	67-91	KREEGKRQKGKRWNGKRVERGRKGK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJS8	Uncharacterized protein	0.935	192-211	ERPKSRKEDRRLNKLRRRAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G5EGZ5	60S ribosomal protein L14	0.89	123-144	KVMRLKKRARFEERKALAKVKA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN03	Uncharacterized protein	0.726	63-82	KRLKKGDGLSRGVIRKTVKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN03	Uncharacterized protein	0.671	184-192	GSRSRSRPR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MN45	Uncharacterized protein	0.661	25-30	KHRRRL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MND3	Uncharacterized protein	0.687	1108-1113	KKPKRR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MND3	Uncharacterized protein	0.647	917-925	KTARRGYKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MUN6	Uncharacterized protein	0.728	84-98	KARARQALRDAKRKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYA7	Fungal specific transcription factor domain-containing protein	0.75	38-46	RRRIRRRNR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MYT1	Uncharacterized protein	0.999	77-95	QIRARTKKGKKKKKKKVWA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N429	Uncharacterized protein	0.989	756-803	KRRREQQRRERDRDREASRERDRDRDRDRDRERDRERRRRDRDRERDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N429	Uncharacterized protein	0.7	847-853	ARREKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N4P5	Ubiquitin-like domain-containing protein	0.866	14-26	KPKRPLFKKRKVK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N8A2	Mtf2 domain-containing protein	0.925	368-378	KPPPRRRKKPT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAI8	MCU domain-containing protein	0.648	218-223	RHAKKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NBS6	Transcriptional regulatory protein Pro-1	0.817	98-115	RRRHKDDIKTIIKKKKLA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NDB9	Uncharacterized protein	0.984	20-35	RLPKKDKRRKKGKVVL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJF0	Uncharacterized protein	0.797	4-16	RRHRPSKKNRASR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NJH0	Uncharacterized protein	0.829	155-194	VKREQEREPSPVRIVRRGRSPSVERERIRIIERSRSRERL
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RD36	Type 1 phosphatases regulator YPI1	0.993	154-183	GGGARKKKKKRTPSPNAYEKMPKVKPRAPA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	A4RD36	Type 1 phosphatases regulator YPI1	0.97	113-131	RGKGKRKHRSGGGGGGKKH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MPX9	Uncharacterized protein	0.799	284-294	PRGKKKDRHHG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR71	DNA topoisomerase I	0.952	213-237	PLLKSKKSAAKAAPAKGKAAAAKKT
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR71	DNA topoisomerase I	0.894	182-207	KSKAKPAAKRQSNGTAKKANGKAKFE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR71	DNA topoisomerase I	0.829	379-394	KKARSKEEKKAEKEAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MR71	DNA topoisomerase I	0.715	147-167	IEKKAATEAKAIRASEARRKS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTY2	Uncharacterized protein	0.947	1153-1189	PRRPYIRKRTKSIATATIVRATPKRPHKSHRGRAKSA
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MTY2	Uncharacterized protein	0.733	7-14	KRRRPKGR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW95	SAP domain-containing protein	0.927	575-593	APRRGPRGGGGRRNRHGGG
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4MW95	SAP domain-containing protein	0.899	119-132	KKRKRRSASPPPPH
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1L4	[RNA-polymerase]-subunit kinase	0.627	372-374	PKK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N1L4	[RNA-polymerase]-subunit kinase	0.619	367-369	RKE
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N492	Patatin-like phospholipase domain-containing protein	0.643	677-680	RRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N492	Patatin-like phospholipase domain-containing protein	0.611	696-697	RK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5C2	Uncharacterized protein	0.999	607-632	NRHRVIRLKKDKKQRRRRARRKTKAS
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N5C2	Uncharacterized protein	0.866	267-284	KKKLPQKIRRWWSKKAAK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6U7	Uncharacterized protein	0.995	456-532	ERHRRRRRDRERERERERDRDRDRADRDHHRDRDRDRDRDREKGRDDDRERRTPRDRDRDRDRERDRERDRDRERDR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N6U7	Uncharacterized protein	0.622	315-320	RHSPKR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7I0	Cmgc/cdk/pitslre protein kinase	0.951	18-37	AKQEREAKRRAKAAKAAARK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4N7U8	Uncharacterized protein	0.662	47-58	RRALSKHKNNAR
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NAR0	PHD domain-containing protein	0.8	372-378	ERKRRRK
UP000009058	Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)	G4NFJ1	Uncharacterized protein	0.932	161-171	AKKKKNRKRNN