ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0D7	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.987	916-932	RGHKKKKATKKRGPRVL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0D7	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.715	90-101	TRALRRRLSKED
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0D7	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.623	108-111	KTKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2J5	Tr-type G domain-containing protein	0.893	668-681	ERRKARKAEKERQK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2J5	Tr-type G domain-containing protein	0.782	639-649	KQKKSKSQRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3E9	Uncharacterized protein	0.605	445-446	RR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6P4	CUE domain-containing protein	0.916	144-167	RHGRGGRPVDSGRGRGRGGARGKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6P4	CUE domain-containing protein	0.809	10-31	APRGRGSGRGGRGGFASRGSGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6P4	CUE domain-containing protein	0.765	117-128	KPKKDRSRPKNK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6P4	CUE domain-containing protein	0.629	251-254	PKPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S732	Brix domain-containing protein	0.984	371-395	QRRKEKEARKKQQKENVEKKRKAKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S732	Brix domain-containing protein	0.886	231-249	RRLNAAEKMLKSKKGRKAG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S732	Brix domain-containing protein	0.736	471-478	SKRKSMKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S732	Brix domain-containing protein	0.673	4-9	RRHKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I7	SNRNP27 domain-containing protein	0.998	22-127	RDRRRDRDRDRRRDRDDDVDIRRRDRDRSRSRDRGDRSRRYRSRSRSRDRSRDRDRHRDRDRDRHHRRSRSRSRSPRRDRDRRDDRRDRERDEKAHRRRDDERGER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8P0	Uncharacterized protein	0.996	439-490	SYKSRRERKHREEEEREKDKKRRDKERERDGRSEVSVRSSSRRDKDREEKER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8P0	Uncharacterized protein	0.921	574-596	PAPKPKEKKRELIKQLFKMKKEK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAE1	Peptidyl-prolyl cis-trans isomerase	0.999	399-507	RRKGEKERKERSRSRSRSRRERSKERSPPRRRSRTPRRGSRSPRRDRGRDRDRYGRDRDRERDRDNRNPDRDRERDRNHDRDRGYHRRDRSRDRGRDRDRERYRRDDRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAE1	Peptidyl-prolyl cis-trans isomerase	0.935	346-368	NEKRRRAAAKKAGGSGGGWGGIK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAP4	Putative DNA repair protein	0.845	51-62	RPAKRKRPGEGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAP4	Putative DNA repair protein	0.779	185-198	RPERRKRMTREEKQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB17	Vac14_Fig4_bd domain-containing protein	0.997	1037-1069	RGRGIRRGRGRGRGRGRGDAKKEEGRRGSRLRF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB17	Vac14_Fig4_bd domain-containing protein	0.957	268-291	KRIARIKKGIAESKKSKAEERRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB54	Uncharacterized protein	0.957	279-293	RRRSRRRNRKGASRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB54	Uncharacterized protein	0.822	910-918	ERARKRKER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEH8	Uncharacterized protein	0.939	406-418	IRPKKEKRKTRRQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFY3	Uncharacterized protein	0.776	801-819	DKEKKADSTTPPPRREKRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFY3	Uncharacterized protein	0.658	94-98	REKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHX3	ATP dependent RNA helicase-like protein	0.999	149-174	GKKIKKGKKDGKKEKETEKKKKKKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHX3	ATP dependent RNA helicase-like protein	0.996	725-781	KKEERRKLKSAWERRKEHNRRQAIEASKRRKKMQMQREGKKGNDGRDEGEKEKKKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHX3	ATP dependent RNA helicase-like protein	0.885	398-413	NKGDKEKGNKHKGRKN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYZ0	HMG box domain-containing protein	0.714	101-112	KKKHARVPAKIP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYZ0	HMG box domain-containing protein	0.68	187-193	EIRRRAR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S058	5'-3' exoribonuclease	0.884	411-439	RRRREVEERREANAKRRKLNQQGAHAKGA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S058	5'-3' exoribonuclease	0.626	126-134	AKEKEEEKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S058	5'-3' exoribonuclease	0.609	445-446	GK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S058	5'-3' exoribonuclease	0.605	121-121	R
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S058	5'-3' exoribonuclease	0.604	119-119	R
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1D8	Phosphatidylinositol 3-kinase VPS34	0.604	169-170	KR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1M4	Uncharacterized protein	0.917	25-53	RHRERRSRSRSRSGDYSRSRSRSPRARRF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1M4	Uncharacterized protein	0.699	602-610	PVKKTKKEK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S239	tRNA (Uracil-5-)-methyltransferase-like protein	0.961	27-45	PHGKQAQKPSKRQRKKDKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3T1	Rad60-SLD domain-containing protein	0.882	98-137	KGKEVVRSGRSRSPSSPVAKRSAFAAPTPKRAAPEKARRS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4P2	Uncharacterized protein	0.915	114-122	RIRRRRRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4S6	PHD-type domain-containing protein	0.996	393-444	ALRRRNREGVRAASKNKKEKQEKEKQEKERAPKEPKEPKEPKGRPASAPPSS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4S6	PHD-type domain-containing protein	0.797	904-924	RSSKRPRTGLRVKTSPVKKKN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4S6	PHD-type domain-containing protein	0.779	368-381	PSKKDPKPQPPKRS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4S6	PHD-type domain-containing protein	0.729	348-356	PRKREGKKD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4S6	PHD-type domain-containing protein	0.685	535-539	RKRRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4S6	PHD-type domain-containing protein	0.669	689-703	KRRQKQQRSSAPPRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5K4	Uncharacterized protein	0.998	139-161	KVVRRKEKKRSKKRVRRRSGGAR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I8	Small acidic protein	0.999	214-319	KKKEESESKDKKKKDKKKIKKSDEKADKDKTTKEVKEKVERKKDENTKSKKDKKSKEEKQEKNEKTNGNEKEKPKEKKDKKSKKEKKTETKASKEESKDKKSQSKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I8	Small acidic protein	0.988	108-135	RPQKKAKDEHSSKRSEKSDKKKKNSKKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I8	Small acidic protein	0.98	170-188	VKTKSKDKKNKKDKKSKSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I8	Small acidic protein	0.966	69-81	KKSKKEKERKRKH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7I8	Small acidic protein	0.956	27-39	KIAKDKKKRSKKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7M6	Putative rho guanyl-nucleotide exchange factor	0.682	1194-1198	FRRKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7Y1	AB hydrolase-1 domain-containing protein	0.85	360-375	RDSRSEKSKRRHSGRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7Y1	AB hydrolase-1 domain-containing protein	0.746	702-710	QKRTKREKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S899	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.766	892-901	GEKKSRKSGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S899	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.728	1019-1028	KKKLKGLLRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDK3	BZIP domain-containing protein	0.862	40-74	LKRKRENRYKNAPPAVLSRRRAQNRASQRAYRERK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFD6	Protein MAK16	0.999	297-320	KKKKAGDKRKRGKAVKPKARKRKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFD6	Protein MAK16	0.945	135-158	EKLVPKMAPKIKKREEARERKALA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYD3	PSP domain-containing protein	0.944	578-591	RKRLKREEERKGRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYD3	PSP domain-containing protein	0.921	127-137	KLSKKKRKKLN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYD3	PSP domain-containing protein	0.86	11-22	LRRARKKELKKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYH8	Uncharacterized protein	0.849	644-657	KGKKRDDGRRRWKM
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYN2	Nuclease-like protein	0.884	465-483	SKGRAKEDKTAAKAKRKTK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYN2	Nuclease-like protein	0.728	674-681	PPKRQKRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0N5	Clr5 domain-containing protein	0.755	136-146	KPSRPRIGKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J2	Ribosomal_L16 domain-containing protein	0.663	78-84	KMRKGRP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J2	Ribosomal_L16 domain-containing protein	0.615	231-232	RK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S289	Exosome complex exonuclease rrp6-like protein	0.977	748-769	AALKEAKRARRAAKKAARQAKQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S289	Exosome complex exonuclease rrp6-like protein	0.828	717-730	RKVARKAHKEAKRL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2U4	Nucleolar protein 58	0.999	459-495	SPAKEKKDKKEKKEKKEKKEKKKEDKEEKKKDKKRKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2U4	Nucleolar protein 58	0.938	512-519	KKKKKRKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S384	Uncharacterized protein	0.871	158-165	KKHRKRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5W8	LysM domain-containing protein	0.996	98-138	EKKKKKEEEEAKKKREEEEKRRREEEEKRRREEQLKQKQRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6K0	DUF4211 domain-containing protein	0.925	221-245	RRTRSARRPLTAKAKALERLRRKKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S762	20S-pre-rRNA D-site endonuclease NOB1	0.773	467-475	RNVNAKKRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M5	Uncharacterized protein	0.998	126-186	KSKPKKRKRDPEVLSGIVLKDGRKVKRGWTTAEDPREKKMKKDKEVKKRKRENEPKKQAKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M5	Uncharacterized protein	0.988	515-540	RAWKRRRKLAGKEKRYRENKARMARA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M5	Uncharacterized protein	0.705	214-219	KKKKGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M5	Uncharacterized protein	0.627	85-95	KGVKIRIERAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDE9	Uncharacterized protein	0.994	99-131	GPKKKGVKRGAAALGPNGEPKPRGKPGPKKKQR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE43	Helicase-like protein	0.641	67-73	KRRATGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE84	Uncharacterized protein	0.736	544-555	GRKEIVARRGKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW0	Uncharacterized protein	0.892	1086-1112	PRKAALKSAKKSAEIERQERIKKRWRE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW0	Uncharacterized protein	0.854	191-208	RKTTKKRRVERSQPASKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW0	Uncharacterized protein	0.688	1199-1209	KAGKPLAKKDK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW0	Uncharacterized protein	0.611	1450-1452	KEK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF97	CID domain-containing protein	0.637	565-572	PRPHPLRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF97	CID domain-containing protein	0.635	95-104	KKRLPSVRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG38	Mitochondrial import inner membrane translocase TIM40	0.996	407-427	RAKKERKEKNKEKEKGKKKRQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGV3	Uncharacterized protein	0.851	353-361	PRASKKKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHA7	Uncharacterized protein	0.894	678-690	TSPTRRRKAPRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHA7	Uncharacterized protein	0.619	664-670	KERPVPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHU3	Uncharacterized protein	0.958	565-580	FKKAHRRRRGSSAKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHU3	Uncharacterized protein	0.911	415-458	EKYDREQIRKRERRENKQARQIEKGEDPEVVAKKKLRKEEQKAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHU3	Uncharacterized protein	0.681	18-27	TKAKGKMAVK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHU3	Uncharacterized protein	0.624	404-413	RKFEEKERAE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI20	Structure-specific endonuclease subunit SLX4	0.985	665-766	PPKKRGRPRKSSTSTTSEAAKETKTTKKKTTKTESKTRKEAEGEEEPEPEKKGRGRPKKTETAEPAESKAAKASTTKATKKSAATKTKAATTATKTTKKSSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI20	Structure-specific endonuclease subunit SLX4	0.976	318-341	PKKPTKRAIKPRGNASRKKQEPPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	P0CU28	40S ribosomal protein S24	0.992	97-136	AGLAAKVEKASRQQRKQRKNRLKTLRGTAKVKGAKAKKEK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYF6	Nucleolar protein 58	0.998	551-582	KSKSSKRKHEPEEETPAKEEKHKKKKKKSSKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYF6	Nucleolar protein 58	0.963	480-492	KKDKKEKKKEKKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYF6	Nucleolar protein 58	0.711	519-529	KKLEKGKIKIK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ21	Uncharacterized protein	0.705	158-168	KKQKHLKPIRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZS3	Uncharacterized protein	0.743	41-49	SPKRSKKEE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZS3	Uncharacterized protein	0.606	82-83	KK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZW4	Zinc-finger transcription factor of the Zn(2)-cys binuclear cluster domain type-like protein	0.618	39-40	KK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S119	Uncharacterized protein	0.998	26-138	RDRDRDRERDRDKEREREREKRHRERKSERKDRDRERDGERDRERDKDRDRERDRERDRERHKDRDRERDRDRDRDRDRDRGRGRDKEKRDRDKDRDRDRDDRSRSRSRNHER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S119	Uncharacterized protein	0.879	1008-1017	FRRPKRRRER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S163	5'-3' RNA helicase-like protein	0.828	984-1008	ARARERAEKARRDAEAIAKAKALRA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S163	5'-3' RNA helicase-like protein	0.811	1063-1096	KSKKIWDEAERRRLELEAEKLRGPVKKMKILRSA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S459	Uncharacterized protein	0.999	638-665	EKRKEMDRKKRLEKLKRAAGKKKRGRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S461	Uncharacterized protein	0.87	1109-1123	RARRVEQRRRREAKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5D5	Uncharacterized protein	0.924	53-65	SKGKRKRSAHKKD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5K5	Uncharacterized protein	0.676	294-299	KAKRRQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7L2	C2H2-type domain-containing protein	0.822	140-152	HKKRVETLRRRRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7V2	Putative ribosomal protein	0.988	456-491	KRPRVHSAKPPRKPRGWEAKRQGPKYRHLWKYTKRI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAK1	Histone acetyltransferase	0.975	413-434	RKPRGSRKRSTGRSSRRRTSRN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAK1	Histone acetyltransferase	0.97	973-1020	SRPRSRRLTAGSRRSTTSRPRTSGSNSSKRRPGGTGRGPGRWPKGTKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAK1	Histone acetyltransferase	0.764	1097-1105	PRGKGKGKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBE7	Putative microtubule motor protein	0.801	587-595	REKKLRRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC70	Uncharacterized protein	0.723	100-106	RPKKPRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCN4	Uncharacterized protein	0.915	96-109	GRRAGKDKKGRQRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCP5	PX domain-containing protein	0.887	915-928	RKRRARRQDRLRRN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCP5	PX domain-containing protein	0.861	222-240	RRKLRHRKHAEFILRVKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCP5	PX domain-containing protein	0.618	151-152	RK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDM0	Uncharacterized protein	0.985	7-39	KKLSKPTKAKANQKPKKGVTKPQKPKLKSTADK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDM0	Uncharacterized protein	0.845	68-85	KGRKKGEEQKYKGGSRKF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDQ4	Nucleoporin NUP85	0.931	154-172	KKKKPQLLKPKGKVQEKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDS2	DNA polymerase lambda	0.621	155-157	KRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHW6	Uncharacterized protein	0.727	447-471	RKRLKEDEAPASPRPRHAEVPIKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG9	Cir_N domain-containing protein	0.999	237-325	ELEKERRREAEERKRELEELKREERRRERRDRERKRGGSRSRSPDGKERSHKRDRSRHRYHSQDREEKRDRSRDRREHRDGDGKRHRDR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG9	Cir_N domain-containing protein	0.959	348-384	RRRYRHKDPRHRDQSRDGKRHERYHSRSRERDRRRTD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG9	Cir_N domain-containing protein	0.867	83-91	EPHRKRKRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2H3	Nucleolar protein 9	0.997	727-801	PKKKEVVEEGKGKEKGKAKEKRDKVQSGEKEREKKKKSDERKKSTDTRDGEEKQANDEDRKKREKDKKKEKKSSG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2H3	Nucleolar protein 9	0.977	3-38	KNRKSKRQLIRDEKRAKKRERELAEEEERQAKRQRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S321	Mannose-6-phosphate isomerase	0.935	810-836	KKAEEEERKKKEKEVKGEKNEETKEEK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S393	Uncharacterized protein	0.62	912-916	GRGGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S393	Uncharacterized protein	0.616	907-910	SKGG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3W9	Uncharacterized protein	0.924	112-134	RRAKARLRKLFFKRRDGSERGRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6F2	Chloride channel protein	0.819	82-89	RRKARRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7M9	Putative transcription factor	0.693	402-408	RKEKIKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7M9	Putative transcription factor	0.681	214-224	SKRAIATPRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7M9	Putative transcription factor	0.601	210-210	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7U5	Putative sequence-specific DNA binding protein	0.988	377-402	RPPRPASRSRSKQPTGRPRGRPRKKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7U5	Putative sequence-specific DNA binding protein	0.96	982-1018	KAHRPPERWDKDAARLNQPRKRRNKNNNASKNKKSEP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7U5	Putative sequence-specific DNA binding protein	0.701	1250-1258	KTPRSGKRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9B5	Ribosomal protein L18-like protein	0.996	173-213	AREAVKHFGFGPHKHKKPYVRSKGRKFERARGRRRSRGFKV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAM1	Uncharacterized protein	0.814	758-770	DARKGRARGPQRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAM1	Uncharacterized protein	0.68	617-629	EKPATPERRPIKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBF6	Uncharacterized protein	0.82	127-140	SRKQGKGPKGRAQK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC98	Inner membrane translocase subunit tim44-like protein	0.956	102-128	KEGKAKEEGKEEEPKKEKEESKKSKKD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCB1	Uncharacterized protein	0.996	50-84	GETKKEKKKDKKKREPELPAVEELPKRRRGRPPRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD22	Mitochondrial 60S ribosomal protein L2-like protein	0.998	361-403	SRRARMRSRRKKRAAYFRELKARRVAKARRREESKRRLREKRA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD22	Mitochondrial 60S ribosomal protein L2-like protein	0.754	137-150	LKSKKTIPKKLGAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD55	Uncharacterized protein	0.72	1430-1441	KKRGGMFARRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDA7	Transcription elongation factor Spt6	0.984	84-95	KERRKKKKRRIR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDA7	Transcription elongation factor Spt6	0.955	118-141	RPRPEPKFKRLKRGHRAESRGSER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU7	tRNA (guanine(37)-N1)-methyltransferase	0.738	723-731	SPSPKRKPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU7	tRNA (guanine(37)-N1)-methyltransferase	0.684	38-50	PRRSRASSRARDA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU7	tRNA (guanine(37)-N1)-methyltransferase	0.606	53-53	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGF4	Uncharacterized protein	0.994	205-216	GKKKKKKGKGKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGF4	Uncharacterized protein	0.984	33-82	KKTAAKKKPDEVQKKAVKKRKRENEFDDAPRAFKRLMALKEGKLPPKSVE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGF4	Uncharacterized protein	0.877	84-94	TGEAPGKKKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGF4	Uncharacterized protein	0.66	149-156	RQTKKERK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGV0	Protein transport protein sec16	1	2047-2065	EKKKKKDKEKQKKKKKKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGV0	Protein transport protein sec16	0.912	2294-2311	PPRRGAGGAAAKKKGRGA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGV0	Protein transport protein sec16	0.807	1229-1239	PGPLKGKGKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH60	26S protease regulatory subunit 4-like protein	0.99	17-46	EKDKKKEKPKYEPPPRPTTRVGRKKKKQGG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI48	Uncharacterized protein	0.682	341-351	KQKDKRGEGVR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY93	Uncharacterized protein	0.64	235-238	KKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZL0	Small nuclear ribonucleoprotein Sm D1	0.999	85-118	PKPKNKARKEADRGRGRGRGRGGRGGRGGRARGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZU1	FHA domain-containing protein	0.737	675-688	AERRARSLERSRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZX7	Uncharacterized protein	0.601	275-275	R
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S030	Uncharacterized protein	0.895	427-485	RPRGRSRSRSPSRWDPRGSPRSRSGFDYGRPGSPSRGRLDDRDRGRADYRQRSPRGRRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S030	Uncharacterized protein	0.7	677-689	GGGRWRHRDKHHK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S124	SANT SWI3, ADA2, N-coR and TFIIIB'' DNA-binding domain-containing protein	0.977	579-595	AGAVAPPAKKPRGKRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S124	SANT SWI3, ADA2, N-coR and TFIIIB'' DNA-binding domain-containing protein	0.751	644-653	RKAKKPQERK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S124	SANT SWI3, ADA2, N-coR and TFIIIB'' DNA-binding domain-containing protein	0.602	567-567	R
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1F0	Uncharacterized protein	0.982	491-511	QRRAQWERMKKGKHKGKKSSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S219	Uncharacterized protein	0.997	1190-1216	KKRELNLKEKLKKQPRRRKKGGRTKQK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S219	Uncharacterized protein	0.995	1280-1305	GRRRAGTVAARVGRRRLKKRRPRGAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S219	Uncharacterized protein	0.992	161-251	DRPHFRDERSREREREREREQRERERDRERERERERERERERERDARDRDRDRDRDRDRDRDWQRDQRDRPDFSRPRRPSPPPLRARSPPP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2I5	Uncharacterized protein	0.94	7-53	KTRKEIAKKKKGNLSTLHEKSRDARKLHKAQVRDERLEKLAEARKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2I5	Uncharacterized protein	0.616	103-105	RRP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S600	F-box domain-containing protein	0.789	664-670	RRRRRRV
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6L8	Enhancer of mRNA-decapping protein 3	0.793	198-205	KKKRRQRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8D6	Protein kinase domain-containing protein	0.998	887-934	HHSRHSRHSNRSKSRSRSRSRSRSKSRSRHSKPKKHKANTKVKIKHPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8D6	Protein kinase domain-containing protein	0.991	802-844	RHKQRQWRGRGAALRGRRLKSEKVKDSMILHRKRQEKRRKRRE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9A3	Mannose-1-phosphate guanylyltransferase	0.636	171-173	KRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAL8	DUF676 domain-containing protein	0.997	1163-1200	KRTKMAWKKTKRFYQEKLEPESRKEARRKRREEKRRKL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAL8	DUF676 domain-containing protein	0.873	688-703	RRRKLIRERYRRGRAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAN3	NAD-dependent histone deacetylase-like protein	0.985	569-586	KEKGKGKGKGRGRRGGQA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAN3	NAD-dependent histone deacetylase-like protein	0.924	336-354	GRKRKLQRDGTEKKPRRRP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAY2	Histone H2B	0.99	9-48	KKPASKAPASTASKAPSEKKDAGKKTAASGEKKKRTKARK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCC8	Putative fkbp12-associated protein	0.987	17-40	PRRGRGGRRGGRGRRGHGHGQPRS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCC8	Putative fkbp12-associated protein	0.931	86-105	GRGRGDRGRRVGRGRGRGWS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCC8	Putative fkbp12-associated protein	0.685	574-582	KAAERRKQK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCG7	Uncharacterized protein	0.861	357-366	PRPRKKGKSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCI8	Autophagy-related protein	0.665	116-121	PPPRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF46	DUF3835 domain-containing protein	0.998	514-538	PAKKEKPKAKEKPKEEKPKERKKKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF46	DUF3835 domain-containing protein	0.842	253-264	HPPQPRKRAKPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF46	DUF3835 domain-containing protein	0.617	489-490	KK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFQ9	AAA domain-containing protein	0.983	593-611	GKTGSKTKGTANKKKRKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFQ9	AAA domain-containing protein	0.797	88-97	KKAPPRKRTR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFZ4	Uncharacterized protein	0.999	65-105	KKDKPKPKLSPKKGKGRGKGKLPPKGKGKKTLTPPLPKRGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGU6	Putative amino acid transporter protein	0.798	594-603	RRGGRRRGRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SI31	Reverse transcriptase domain-containing protein	0.641	418-421	KKRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RXR6	Putative rab guanyl-nucleotide exchange factor	0.849	1214-1224	RIKRKKGVRKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYL9	C2H2-type domain-containing protein	0.652	361-369	RRGSAKTKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0E2	Uncharacterized protein	0.999	216-274	EKRKKKKKKRYGPKGPNPLAVKKPKKKQPPPPKKKDEPPPSQASGEKKSKRKRRKKQKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S277	Component of oligomeric Golgi complex 3	0.968	94-108	RKRKQKTRRRRGSGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2D8	Putative mRNA 3'-end protein	0.774	88-97	RAAPPKKKPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7S7	Putative pre-mRNA splicing protein	0.986	40-55	KKVKKIIRKKRRPARP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8V0	Uncharacterized protein	0.99	764-794	AGRRGGRGGGRGGRSGGERGRGRGPRGGGKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8V0	Uncharacterized protein	0.851	52-61	GKRKRRTSRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S922	CHY-type domain-containing protein	0.947	660-691	EGGKGTRDQRLMRRNDPRKYKRIGPAKKDKDK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SBP6	Putative GTPase activating protein	0.633	1039-1049	RLQKRVSAGGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDW1	Uncharacterized protein	0.999	23-68	PKRKRGRPPLSPSKRKPKPQPTGRPRGRPKGSGVKKSKPGPGRPPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDW1	Uncharacterized protein	0.939	124-136	VKRKRGRPPKNRP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU2	Chitin synthase	0.864	164-183	EKGRTRRRTNSGKITKEKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF95	Putative inositol polyphosphate protein	0.791	291-318	KSPRMPPSQPPSPPPPRRSAELRRDREL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF95	Putative inositol polyphosphate protein	0.604	989-989	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFC3	60S ribosomal protein L4-like protein	0.997	184-208	KVKKSKKLRAGKGKMRGRRHRQRRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG71	Uncharacterized protein	0.934	193-216	PSKPKSKPEKTKSKDEVKPKSKTK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGA0	Uncharacterized protein	0.92	128-153	GRGAKRARAPSMKKTPGTTPASKRRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGG1	Metalloendopeptidase-like protein	0.745	467-481	KAREAERLAKRKEEL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHL9	Uncharacterized protein	0.996	34-145	KVSGSEKERGRSSASREESKRHRDDGRRRDNRSRSRNRDRDRDRVRDWSRERDRERERDRNRDRDRDRDRSRDRDRNRDREREKIRHRDRARSRERDASRERHHNRERDRNR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHL9	Uncharacterized protein	0.909	271-285	KGEGKGKGKGKGRED
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHL9	Uncharacterized protein	0.858	1134-1149	RHGKSNTKEDKRKGGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY38	PPIase cyclophilin-type domain-containing protein	0.986	203-231	KKRERRIQHEVPRPLPATEKKPKKRKGGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY38	PPIase cyclophilin-type domain-containing protein	0.87	510-557	AKALKEEKKGSREGNHRPEGSGRGWGRDLDRDRDRDRYRDRNRDRERG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY38	PPIase cyclophilin-type domain-containing protein	0.76	567-577	RERGRDRDRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY38	PPIase cyclophilin-type domain-containing protein	0.74	385-392	RGRKRRPG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY44	HECT-type E3 ubiquitin transferase	0.997	2830-2884	KEAKAREEEERRKREEERKKREEEERKERERKEAEERAAREKKEAEERERRERER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RY44	HECT-type E3 ubiquitin transferase	0.77	3314-3328	RRKEAEEEAKKKAGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYQ8	DNA repair protein rad14-like protein	0.984	178-206	RREAEKKRRKEAKFKEKLLDLKRKTRTEA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ86	DNA-directed RNA polymerase subunit beta	0.618	308-311	KKGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S009	Suppressor protein spt23-like protein	0.892	415-426	RERKRAGRKKLK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S009	Suppressor protein spt23-like protein	0.841	605-616	AGGPAKRRKANK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S009	Suppressor protein spt23-like protein	0.793	1110-1122	PREKSPAARPRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0B5	Translocation protein (Sec66)-like protein	0.953	243-253	SKKKKGKKGAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0S0	RRM domain-containing protein	0.999	190-367	KEVEEALRREAKKAEKSSRRRRHRSQSRSKSKSRSRSRDRHHRSHRSRRDDHDDGERHREKDKYRDREDRDSDRKRRSRDDTPVEEDKDRKRRRDTPDDRRDRDDRRDRDRSRDRARDRDGDRREDYRRQDDGRDRDRDKRRRHADSPERSERRHRDLEDRTRRPKDRSRSRSPRRRD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S102	Valyl-tRNA synthetase	0.731	25-39	EQKEKAKADKAAKFA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1C0	CENP-T_C domain-containing protein	0.944	541-555	PPAPSKKRKRAPAKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1L8	Uncharacterized protein	0.929	154-169	QKVRKRRKGWRIAWRT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3V7	KRR1 small subunit processome component	0.992	276-320	QRAAEAERAEKARQKKEEKKREREKEFVPPEEDGGKKKKRKVKHG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3V7	KRR1 small subunit processome component	0.945	226-246	KKRTLSKRRKPFKINDKSKKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S400	Palmitoyltransferase	0.721	664-671	RAKNKRRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S463	Uncharacterized protein	0.974	670-687	KSKNKKGKAKKAKYQRPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S463	Uncharacterized protein	0.71	775-784	AKAAKRGSKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S463	Uncharacterized protein	0.614	25-29	GGRWR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4E3	Fcf2 domain-containing protein	0.959	183-203	EHKKSGRKGYYKKLMAARKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4R1	Autophagy-related protein 101	0.998	73-93	RAGIGVPRRGRRRRRRRRGGG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5M5	Uncharacterized protein	0.877	399-413	ERAQEREKAKKAKRD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5M5	Uncharacterized protein	0.85	422-446	KAQKKYLEREREKELKRSMKKATIR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5M5	Uncharacterized protein	0.618	101-103	KAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5R1	Uncharacterized protein	0.994	313-345	KAERAGKKPTRAELKMYKEKRRQKKEEKRRAWL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S682	Uncharacterized protein	0.836	257-268	RRRRRNKNIRKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7A6	Mannosyltransferase	0.716	22-29	SAKHARKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7A7	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.92	345-356	KGRKGKKRADRN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S855	Uncharacterized protein	0.694	484-488	KKKPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8P9	Uncharacterized protein	0.911	891-910	RKVREKERRAEEKREKERER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ4	Tudor domain-containing protein	0.87	224-256	KPQPKFKKLKATKELEKSKSKWQEFTAKGKISK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ4	Tudor domain-containing protein	0.734	56-68	PKHEPKAAPKKAQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB86	DNA damage-binding protein CMR1	0.956	40-67	PKPPKPKRSSTPRTKREPIQREPPRPTR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC84	WD_REPEATS_REGION domain-containing protein	0.975	220-247	NAGKGRGRGRGRAKEKNGTGSGPGEGKD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC84	WD_REPEATS_REGION domain-containing protein	0.819	68-88	RGRPSSLPRSRSRSRERNRDR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCY4	Putative calcium ion binding protein	0.824	570-589	RSARRARVEARRRLLERWRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDL8	Calcium-dependent cysteine-type endopeptidase-like protein	0.999	693-771	YEKRKREKLRKKLRKELNERRKEDYYLSWKKTREEWKTKARDRKVEKKLNKKLHDKRMAAKERAARKRREKMAKKVKRA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDL8	Calcium-dependent cysteine-type endopeptidase-like protein	0.985	1250-1313	VEKKEEKEKKGNEEASKEREKNDDRKRPKLEKQDSKAPKLERNDSGRTPKFERKDSGRIPRLER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEK8	Transcription factor BYE1	0.999	187-245	ARRKAYEEEKAEKRKRGPKKGKKRASDQKEEALQKAKQSPPPPPEPKKEVKAAGQKRKT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEK8	Transcription factor BYE1	0.969	91-104	PKRRGGGGKKKKAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG72	Uncharacterized protein	0.974	141-172	AKQRQKRKKKEEEAAEKARLAYAKRFDKKIRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGE6	Uncharacterized protein	0.722	394-405	PRKRGRVIIRIK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S358	Uncharacterized protein	0.89	1114-1168	AGSAGKKRSASTSSPAPGRAAAPSARSPAAKPGAKPTAVVRGARTAPAGAPRASA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S358	Uncharacterized protein	0.81	1210-1224	KPAPKRKGTAAAGKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S358	Uncharacterized protein	0.738	146-156	WVPRKRHHSRW
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S358	Uncharacterized protein	0.669	1044-1052	KKVVAGKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S358	Uncharacterized protein	0.62	1089-1094	RLPPPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S468	Putative elongation factor	0.997	1027-1053	APKKAKKLTSSELRKKKKERMARRKRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4T4	Calponin-homology (CH) domain-containing protein	0.994	269-368	KEKKRKEKEAEEARKRKEEEERRKREIEEEERRAREEEERRWEEETLRLREEERKKLEEEKKRWEEEERQWKLEEERRRKEEEEAEARLRAEREKARKQR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4T4	Calponin-homology (CH) domain-containing protein	0.938	404-439	RRREAEYERARQERFGRAGLKADERKARSRSRSRPP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S588	Putative sequence-specific DNA binding protein	1	482-498	RKMKKKKKRKKRKRKRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S588	Putative sequence-specific DNA binding protein	0.742	164-178	RKPKRELSQSKRAAQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S588	Putative sequence-specific DNA binding protein	0.689	377-382	KPRRRT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5J4	Uncharacterized protein	0.631	33-37	RPSKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5M3	Uncharacterized protein	0.914	416-429	PTKKRGPGRPRKIN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6T7	Uncharacterized protein	0.916	283-324	VGGKFGRGGRRGGRSMRNNPLFSRRNKMEWKPSGFRGDNKIR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6T7	Uncharacterized protein	0.637	263-268	KIRSRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S790	Putative DNA damage protein	0.924	459-479	RKKNSPADSKKSRSRRKAVEK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S790	Putative DNA damage protein	0.87	656-667	RRRREARKKAPA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S790	Putative DNA damage protein	0.827	990-997	RGGKKRKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7S3	Ubiquitin thiolesterase-like protein	0.999	766-832	KEKRGKKEKDKKKDKDKNKEKEKDQDKEKDAEKDKEQHRQGNNKKERKPSKSRDRSDKNKRRGSKEP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S847	Putative pre-mRNA splicing protein	0.985	284-301	RGRGGNRKGKKEKSKRRP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S847	Putative pre-mRNA splicing protein	0.831	22-30	SGTKKRKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S847	Putative pre-mRNA splicing protein	0.635	219-224	RKEKER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8Q0	Uncharacterized protein	0.748	26-35	KKPKRPPGSR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8V3	Ubiquitin-protein ligase-like protein	0.754	104-110	SRRRKGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SA24	Drf_GBD domain-containing protein	0.837	917-933	RSRGASPAKKTPKKQAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SA24	Drf_GBD domain-containing protein	0.804	484-492	PKKKKHGRG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SA24	Drf_GBD domain-containing protein	0.626	512-515	KKHK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAA9	Uncharacterized protein	0.831	59-70	RGSRAKRLRRSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAG8	Protein kinase domain-containing protein	0.755	65-73	GHKRPKPPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAU9	Uncharacterized protein	0.798	697-708	KKHRRIQRAKRD
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD02	BRCT domain-containing protein	0.734	306-318	KEKLKQKPKPLSP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SD02	BRCT domain-containing protein	0.613	97-99	RGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDX2	Obg-like ATPase 1	0.813	133-143	KRAKPKKMPPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEN3	Uncharacterized protein	0.989	207-244	KRRKAAEERRKREEEERKRLEEERERNRERKLRVLKER
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEN3	Uncharacterized protein	0.88	297-312	GRGRGGRGRGGGRGGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEN3	Uncharacterized protein	0.818	73-92	AHSRHNPRGRGGGAEKPPRS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU8	DUF1752 domain-containing protein	0.93	436-455	KRLNPKKRWPTPKRRSSHRP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU8	DUF1752 domain-containing protein	0.921	338-350	AKAQGRKGKKRPG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEU8	DUF1752 domain-containing protein	0.896	79-102	KKMRESRTKSPPPRRQRASSPRNH
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW9	Uncharacterized protein	0.62	226-229	RRNG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW9	Uncharacterized protein	0.601	217-217	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFW6	DUF4604 domain-containing protein	0.929	170-190	GAKSEVGTAKPAKMKKAKKIK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFW6	DUF4604 domain-containing protein	0.893	121-131	AGRAGKKRKAR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFW6	DUF4604 domain-containing protein	0.715	152-166	NKKREVKTGKTSEKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGW1	Zinc finger domain-containing protein	0.966	297-343	ALAGAPKKVITAPPPKMSEAERIMKEELERKRAREEGRGPPSKKPRF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGW1	Zinc finger domain-containing protein	0.619	287-291	KPAPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGW1	Zinc finger domain-containing protein	0.604	295-295	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGY6	RING-type domain-containing protein	0.765	212-222	EERRRRIREQR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG5	Ctp-dependent diacylglycerol kinase-like protein	0.715	80-92	SRSRSRSPVKPRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S067	Origin recognition complex subunit 1	0.832	221-233	RGTKATRRRKAAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S067	Origin recognition complex subunit 1	0.792	261-290	PKRPRTRDVITPSSKRKHLGSKPATPGSHR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S067	Origin recognition complex subunit 1	0.614	55-57	KRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0D9	Uncharacterized protein	0.647	475-481	RHPRNRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0V7	Putative response regulator protein	0.949	609-626	AKTSPPRPPPSSRKKKKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2B0	tRNA (guanine(9)-N1)-methyltransferase	0.997	94-120	KEARKAKRKEKRHERQARKRAEREAKI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2J1	Eukaryotic translation initiation factor 2A	0.968	525-537	LKNKKKRNRKKEG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2K9	1,3-beta-D-glucan-UDP glucosyltransferase	0.967	281-291	KGRKKGKKGKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3S0	Uncharacterized protein	0.998	757-798	AKKRAKLKQEKEERRKVKEKLKQERREARRRLKLEEKRKKRE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3S0	Uncharacterized protein	0.713	325-336	TLRRRLLRSRRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6C0	Helicase-like protein	0.867	218-227	KRKRKREAQK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6C0	Helicase-like protein	0.819	707-716	ERATKRRRKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6C0	Helicase-like protein	0.749	350-358	AGRRRGKTR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7G0	WAPL domain-containing protein	0.909	104-118	KQEKDEAKRAKKRRL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8E2	Uncharacterized protein	0.999	444-468	RQGSRGVEKKKKKKKRKADRAAENA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9P1	Uncharacterized protein	0.731	174-184	GRLRKERPSKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9P1	Uncharacterized protein	0.655	112-123	KLAMKLKEAKGE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB80	ATP-dependent DNA helicase CHL1	0.753	119-136	AALRKAREKERQEEEKAA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB80	ATP-dependent DNA helicase CHL1	0.635	140-146	HGRSVKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCD0	Serine/threonine-protein phosphatase 2A activator	0.898	54-66	KIPKLEPRRRKKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDE4	Uncharacterized protein	0.764	806-811	RRRRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE53	SHNi-TPR domain-containing protein	0.654	426-431	KKNKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEZ0	Uncharacterized protein	0.977	497-527	GFRGGRGGGRGGARGGRGGGGRGGARGGNKS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEZ0	Uncharacterized protein	0.918	8-45	KAVKAKAVEKAAKPAKVAPKEVATSKAKAVEVKKNKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEZ0	Uncharacterized protein	0.823	267-277	AAKEKSSKKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEZ0	Uncharacterized protein	0.781	163-176	PKAAAKQEKAKPKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH15	Heat shock protein hsp90-like protein	0.968	250-263	KKKEKPKKTKKVKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SHU0	GPI-anchored wall transfer protein	0.678	115-119	RKKPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYG0	Putative exchange factor	0.733	78-95	VPPRPGKDGAGGRSRTGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYH9	Chromatin modification-related protein	0.664	1219-1224	KESKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYK2	Uncharacterized protein	0.942	35-59	KPQLRPKAAARSSKIPRPSPRGKKG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYK2	Uncharacterized protein	0.873	749-759	RRRGKSRRRTA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYK2	Uncharacterized protein	0.79	1860-1867	KGKKGKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RYK2	Uncharacterized protein	0.607	365-366	RG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0B8	PWWP domain-containing protein	0.971	328-358	SKSSGKGAETKSAKSKTKKGKEEEKKVEKEP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0B8	PWWP domain-containing protein	0.97	110-136	SKSKAKRKSIGAGESKGKKLNKKQSKQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0B8	PWWP domain-containing protein	0.89	276-290	AKAAKAAAPKGKKGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1G0	Phosphatidylinositol N-acetylglucosaminyltransferase-like protein	0.94	83-102	RRRIRHNDGSRSRSRRRKRF
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S455	Non-specific serine/threonine protein kinase	0.975	151-173	PEKRPRIRSRSPRGRPDKERRDR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S455	Non-specific serine/threonine protein kinase	0.89	62-100	RRNQSPRGWKRSRDDYRDYRDHRDRRDRRDSRKSRPHHE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4F3	Nucleoporin NUP82	0.667	40-47	KIKPGPRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S689	DUF2431 domain-containing protein	0.616	311-313	KRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6L6	Uncharacterized protein	0.81	679-690	EKRKGKEKMFRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6L6	Uncharacterized protein	0.649	524-529	SRWRRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S731	ATP-dependent rRNA helicase rrp3-like protein	0.982	469-478	DRKKKKKRKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S831	Gal4-like Zn(II)2Cys6 binuclear cluster DNA-binding domain-containing protein	0.842	19-27	TRKRRRRAP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB55	Uncharacterized protein	0.688	161-167	VKKRWKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB55	Uncharacterized protein	0.686	566-573	IRKQRKSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SB55	Uncharacterized protein	0.675	145-150	RARKAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC52	Chromo domain-containing protein	0.974	325-351	KKKVRPPKLKDSLAKRRQPPSTKKKQK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SC52	Chromo domain-containing protein	0.964	109-131	RKMKERVRKQEETKRTGRPRKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SCI6	RING-type domain-containing protein	0.665	340-348	KERRMRLKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE22	Telo_bind domain-containing protein	0.806	1699-1713	KGRGRQKRLRSARHR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SE22	Telo_bind domain-containing protein	0.689	223-228	GRGRKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SF98	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit	0.708	606-617	RRRKQLEEEKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFC1	Uncharacterized protein	0.763	414-421	SRRRNRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG46	Uncharacterized protein	0.75	583-589	IKRPKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG46	Uncharacterized protein	0.68	50-54	RGKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG46	Uncharacterized protein	0.676	475-482	HHRARKQR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG50	Cysteine-type peptidase-like protein	0.793	44-57	PRPPKRAKLNSPKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SG50	Cysteine-type peptidase-like protein	0.645	203-206	PKKR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGG6	Uncharacterized protein	0.767	335-344	RSSKGKGKRP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGG6	Uncharacterized protein	0.706	67-77	ARRARERDRGA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZB4	Uncharacterized protein	0.996	476-508	AKKEKGKKDQEEKGEEEEEEERRRRRRRRRRGQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZB4	Uncharacterized protein	0.608	297-297	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZB4	Uncharacterized protein	0.604	301-301	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZM2	Transcription initiation factor IIF subunit beta	0.881	159-179	TKRGAPYARKPIPKKTRIAGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZX4	Uncharacterized protein	0.993	107-197	APPRPGPPNPSQGPPKDRRPPPPPFREGIPPPPPGRRGPPPPNHRPTRSQEEALRARKMQGAPDKHGHPEPPRSPHRRPERPDRPERRPRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZX4	Uncharacterized protein	0.993	215-238	RRERERRRERERRHKEMKPKPSRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZX4	Uncharacterized protein	0.875	491-509	KPTGLLGRMKSLKGRRKPP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S049	Type 1 phosphatases regulator	0.908	125-154	RRRQKQRKRNPSPNAYERMPRYDKKPSKSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S164	Uncharacterized protein	0.983	723-801	RRARMKERERIREQERKEQERIREQERIREKERIKKQEKLKEEERVREQERLREQQRVKAQKRLEEYERPKPAKPGNSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	0.989	11-37	KGSAPPKPAKPAAKKEEEKKARAKGRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	0.988	1025-1041	PKKGKGKGKGSGRSKKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	0.964	994-1011	KMPKAKKPAGKKASKAAK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	0.944	223-240	KPAKKAAPAKPRAPRAKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	0.624	82-86	KSKAP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	0.617	108-110	PKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S1J3	Replication factor C subunit 1	0.6	112-112	K
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3A6	Uncharacterized protein	0.856	2552-2572	KDAKSKDLSPPPGPGHKKKPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3L0	Uncharacterized protein	0.916	105-120	KNLLKCLKKPKKAKKA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S3L0	Uncharacterized protein	0.724	90-101	AGKKPNPLKKVS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S4K8	Uncharacterized protein	0.632	999-1001	KKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S557	Sister chromatid cohesion protein	0.996	1887-1924	GRGRKRKSQAGGAAGQKKKRSRSSSQQPPRKRGRPRKN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8B9	WW domain-containing protein	0.922	522-552	REERRKRHEKALQERERAVAEEKKRQERKLQ
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8B9	WW domain-containing protein	0.872	130-147	EKPQPKPRPQPKDKPKSK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8Z6	mRNA cap guanine-N7 methyltransferase	0.886	351-360	KLQEKKKKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8Z6	mRNA cap guanine-N7 methyltransferase	0.855	239-257	RGGGGGRGGRGGHHRRPPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S8Z6	mRNA cap guanine-N7 methyltransferase	0.717	81-89	RKLKRPGQR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SDJ7	Uncharacterized protein	0.702	121-127	RRIRRRR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW2	SLD3 domain-containing protein	0.998	418-434	KGSRPKKRKRKKPKLGK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SEW2	SLD3 domain-containing protein	0.903	624-662	PPKPKASAAAKPTGITKAKPGAPVKRVSSASKRDSSRRL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFG0	Uncharacterized protein	0.846	600-611	GGKRKRTKLKLN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SFG0	Uncharacterized protein	0.71	16-23	APTKKKQR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGI2	Uncharacterized protein	0.991	179-213	RRRRGEWRDRDRERYRDRRDGRDRRDRRRDRRSKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGI2	Uncharacterized protein	0.952	236-271	KRASSRRLSHARRRSRSRGSSTGRDSSHSRRNREKE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SGM3	Putative transcription factor	0.636	109-111	KRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH01	Uncharacterized protein	0.99	586-607	KRRPSRRHSRRRPRSPSPARRE
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH01	Uncharacterized protein	0.913	991-1011	ARSRSARSSRSIRRKPSKASR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH01	Uncharacterized protein	0.854	179-189	GGRDKVKKKKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH01	Uncharacterized protein	0.84	457-484	KASKKVPTKKTADKLRQKKETEQGFKKP
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SH01	Uncharacterized protein	0.815	42-63	QAKPRPKSAPAAPNRASTHKRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0RZ98	Bms1-type G domain-containing protein	0.962	15-50	TTKTKHKPFKSRHATKRALRDAAKGRVPNEKGQRKT
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S0G3	Putative bhlh/zip transcription factor	0.849	282-291	RRKRRRESHN
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S2X1	Nucleoporin NUP37	0.641	59-65	RRLKPPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S424	Protein kinase domain-containing protein	0.746	138-144	RKRRRSR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S507	60S ribosomal protein L25-like protein	0.952	7-61	KKGGASKAAKGAQAKKAAQAALKGVHSHKKTKVRKSTTFHRPKTLVLSRAPKYPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5S7	J domain-containing protein	0.978	239-251	SEKKKKKKLKPIG
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S5S7	J domain-containing protein	0.645	202-205	RRRK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S6I3	Anaphase-promoting complex subunit 4	0.996	380-400	KQRRKKNKPPRKKPQRPLRGA
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7H0	Serine/threonine-protein kinase-like protein	0.726	519-539	TSRTRSRSRSPMRDRDRDRDR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7Z2	U3 small nucleolar ribonucleoprotein protein lcp5-like protein	0.922	284-301	PKESKKERAKRARMEGRS
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S7Z2	U3 small nucleolar ribonucleoprotein protein lcp5-like protein	0.65	376-381	TRGKGR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S849	Zn(2)-C6 fungal-type domain-containing protein	0.698	89-93	RKRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M2	Glucosidase 2 subunit beta	0.994	162-194	EEERRRSKERSIKKRRALAKEAGELRRKVEAKI
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0S9M2	Glucosidase 2 subunit beta	0.65	223-233	RARVAKPEGPK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ9	60S ribosomal protein L8	0.93	5-35	SGKKVAPAPFPQGKAGAKKAPKNPLLEKRPR
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ9	60S ribosomal protein L8	0.846	242-254	GFKAQKREEKRKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ9	60S ribosomal protein L8	0.69	118-125	AIKEGKKK
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ9	60S ribosomal protein L8	0.613	109-112	KERL
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAJ9	60S ribosomal protein L8	0.605	114-114	R
UP000008066	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)	G0SAM9	Uncharacterized protein	0.742	263-270	HARKKRSR