ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8J5	XPA_C domain-containing protein	0.98	284-309	RREGEKKRRREAKFKTKLNDLKKRTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8Q4	Uncharacterized protein	0.735	8-15	KVKRRKER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE5	Uncharacterized protein	0.79	608-621	RPTRHERQKRSKPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE5	Uncharacterized protein	0.741	469-475	PKKRRLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJW2	NUC153 domain-containing protein	0.992	470-514	RAKRVKEKIDKERESRIRGKKKVAVKVNKKLAEKLLAVEEKKERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM60	Uncharacterized protein	0.708	166-186	KKQDAAKGSSKPARSVSPPRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM60	Uncharacterized protein	0.657	118-123	RPPKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR11	Uncharacterized protein	0.969	596-624	RKKALKKAKKEQQRLEKLEAEKREARKAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV52	Xylanolytic transcriptional activator xlnR	0.907	158-168	ERKKRGKASKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ49	Uncharacterized protein	0.635	385-388	RARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZL3	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.761	99-105	KKKKPKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7X3	Uncharacterized protein	0.98	358-373	RKGNKRRPAKKSKSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7X3	Uncharacterized protein	0.916	228-257	KRKRGGRAPKSQTKPNAGEETESRPAKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA00	40S ribosomal protein S1	0.948	5-19	KNKRLSKGKKGIKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDZ9	DNA helicase	0.73	805-825	KDKAGHHPLFRKIERDRLKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE36	Uncharacterized protein	0.723	463-497	KRRREEEDWKREERNHARRQAHMRTLAAEREKARS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIH2	Uncharacterized protein	0.946	108-129	RALRRSFSWSRSKRQPKRPRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKD6	AP_endonuc_2 domain-containing protein	0.958	293-307	KPKKTKKKQAKRPAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKD6	AP_endonuc_2 domain-containing protein	0.89	368-381	EEKKKAKGPTKKQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLR7	Uncharacterized protein	0.946	87-118	TPKKGKGKAKKDDATPGAGNDASPSKPKRQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPS1	UBX domain-containing protein	0.759	351-359	AKRKPEKKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSD4	Uncharacterized protein	0.933	232-252	PPSGGGSKSNKKGGKGSKKSA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVS1	Uncharacterized protein	0.623	12-15	PRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYZ4	Fungal_trans domain-containing protein	0.731	56-68	RRKNRAARTGAGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZR0	HET domain-containing protein	0.996	777-801	RRRSIHRTRRDKRPRKRGIPRKEHI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D044	Uncharacterized protein	0.633	44-49	KRPPFK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1W6	Uncharacterized protein	0.999	150-173	KQGRRRKTTKKKKKGKRQPAPQKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE95	Uncharacterized protein	0.989	410-444	PGRRGDPRGRRGNDYRQRSPPGRRRRSPSPRKDPN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE95	Uncharacterized protein	0.83	375-397	GYRRRSRSPGWDRRRDVSPPRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHK2	U3 small nucleolar ribonucleoprotein protein MPP10	0.666	341-348	RKISKKGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI38	HECT domain-containing protein	0.989	34-86	PARKRKAPARTDRSTDAPGHSNPPSPPRRAKRQRRAASPPPAAAPAAARRGTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLS5	Uncharacterized protein	0.889	258-269	RHRRRQARKRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMG7	Protein kinase lkh1	0.63	212-215	RKRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB6	INCENP_ARK-bind domain-containing protein	0.95	870-907	ERKREQEEREARRKEEQKRELERKRAADEARRQEARSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB6	INCENP_ARK-bind domain-containing protein	0.844	672-694	QEGRRTRSSTEKEEKRKQREREE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB6	INCENP_ARK-bind domain-containing protein	0.738	71-83	KMRGKTPRTARKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB6	INCENP_ARK-bind domain-containing protein	0.684	993-999	KPPKRGA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTX4	Zn(2)-C6 fungal-type domain-containing protein	0.717	69-77	KGVKNKRKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUI8	RING-type domain-containing protein	0.975	539-565	RRRKRNKEKEAREEKDRIRAEKEDDKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUI8	RING-type domain-containing protein	0.79	688-695	GKKKKNKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUI8	RING-type domain-containing protein	0.626	69-72	KRQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV15	Mannan polymerase II complex ANP1 subunit	0.707	467-484	PKSGKPADQKEPKEHKAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE6	Altered inheritance of mitochondria protein 6	0.718	99-104	HKRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVQ9	FAD-binding FR-type domain-containing protein	0.974	813-841	RKAKDKLTEKEEAMAAKAQKKARRAKRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX09	TRP_N domain-containing protein	0.908	742-761	PPRPRKKRMDSGLSGEKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX09	TRP_N domain-containing protein	0.69	43-49	LRPPRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAJ2	5'-3' exoribonuclease 1	0.948	1380-1406	DRRGGRGGRGNSRGSERGSRARGRGRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEZ5	Transcription initiation factor IIF subunit beta	0.954	156-169	KRDARKRERKKKWE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI28	FF domain-containing protein	0.828	387-412	RKRVEREKREKALAEREKQVQENKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI28	FF domain-containing protein	0.825	241-256	QKLKERKEKQEKKDPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIH7	RNA-dependent RNA polymerase	0.771	510-518	KPKNKKKAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL30	Uncharacterized protein	0.89	322-365	RIARAKTTTTSKTAKPEAPKGPKLGGSRSARAAMREMQEKSARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL30	Uncharacterized protein	0.841	16-27	VKRRKFLRRRPE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL30	Uncharacterized protein	0.732	234-241	PWRGRKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTG4	Probable lysosomal cobalamin transporter	0.998	912-932	PRRRTRNRGKKGKKAKKNQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUP0	Patatin-like phospholipase domain-containing protein ATEG_02594	0.934	56-70	VRKTRGRRKEPRRTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVP3	Csm1 domain-containing protein	0.909	35-59	PAKKQRGRPRSKSVEGKQPAAQNKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVP3	Csm1 domain-containing protein	0.85	69-83	PATRKSTRRGRPKGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVP3	Csm1 domain-containing protein	0.838	178-190	AKAKPEPKGPRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVP3	Csm1 domain-containing protein	0.827	132-150	PVKPTKTTKATGARRGRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW08	Uncharacterized protein	0.998	29-47	PKKKPKKKKKPKSQRGIGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZX3	Pre-mRNA-splicing factor SYF2	0.727	245-252	RLKKRRDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1G5	Uncharacterized protein	0.889	1031-1054	PRKRNVPGEDRDSREERKAKRRAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1G5	Uncharacterized protein	0.705	1324-1336	SIRKGHREPERSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1G5	Uncharacterized protein	0.702	186-193	RSSKAKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1G5	Uncharacterized protein	0.642	145-148	KRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7X0	Probable E3 ubiquitin ligase complex SCF subunit sconB	0.765	81-94	VRPRARRLANGKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8E4	Nucleolar complex-associated protein 3	0.995	346-373	EPPVRGKKKQKKEFRTKRERKVEKERKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8E4	Nucleolar complex-associated protein 3	0.804	45-58	RRPRKMNKKDKERT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9B1	DNA-directed DNA polymerase	0.859	935-955	KGKGKAEEEAARRKRNPNPHR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAJ9	Pre-mRNA-processing protein 45	0.861	138-154	PKFKHKKIPRGPPSPPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAJ9	Pre-mRNA-processing protein 45	0.611	310-311	RR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDJ3	Fungal_trans domain-containing protein	0.612	20-23	HRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNE0	Brr6_like_C_C domain-containing protein	0.748	155-162	RVQKRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZV7	Uncharacterized protein	0.715	227-232	KGKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0E3	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.988	380-408	KRKLKQKRQEKKEARGDGPKARRGPPGPS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0E3	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.962	454-481	RGAGFRGGRGRGRGFDRGRGGRGRGGPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C909	Uncharacterized protein	0.978	170-216	AKTKTSSKKEKSKPQPRRVKLSQLSSISGGRHGSVGGGKSQKKRKHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9B2	Uncharacterized protein	0.961	255-292	QRRGTAEHSARRSPIRPVRARREPAPPKFRAVVSKRAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9F1	F-box domain-containing protein	0.937	14-50	AGGKRKKRDLGRAEWSRQNIDKRARNDKENETKRRKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA78	Chromatin-remodeling ATPase INO80	0.942	494-517	RSPSRRKSGRGGPVTRPKKSKEQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA78	Chromatin-remodeling ATPase INO80	0.935	403-459	KERKKDMQRKRRRENTVRLEMQKKLEAERKANKAQDSAEKAKFLREAERAQRKIKTT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA78	Chromatin-remodeling ATPase INO80	0.927	1655-1677	PKRGRGRGTGKGTSKRAKTTKER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA78	Chromatin-remodeling ATPase INO80	0.915	340-361	KGKKRAMDAERAESVRRKRRRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA78	Chromatin-remodeling ATPase INO80	0.803	1600-1611	KGGKKAAQKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA78	Chromatin-remodeling ATPase INO80	0.678	256-264	KKPSSEKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAV2	Uncharacterized protein	0.653	189-198	VKHREDRSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE40	TAFII28 domain-containing protein	0.949	77-91	SKKRGRKSKAEKERE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFU3	Prenylated Rab acceptor 1	0.628	484-492	SRQRSNRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH33	SANT domain-containing protein	0.995	236-266	RKMSRSKSRRTSKDENGSGKERKRRVRRKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH33	SANT domain-containing protein	0.906	11-34	KSGKKFAPKAPARRAAPAAAPPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIN7	Uncharacterized protein	0.812	184-194	KGKKRHEPRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPV3	Uncharacterized protein	0.899	374-388	RREEERSKQKKKARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPV3	Uncharacterized protein	0.82	10-25	GASRYRRRRNASNRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSP3	Response regulatory domain-containing protein	0.769	134-146	KRAHNRNKRNIRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXZ8	Ribosomal RNA-processing protein 8	0.992	369-397	RFGKVARKKAQIGARKPLTKAEKKKLKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXZ8	Ribosomal RNA-processing protein 8	0.954	60-87	RRHIEGHKGPAPKGQKQGPAKADKKRKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXZ8	Ribosomal RNA-processing protein 8	0.927	127-140	KPSKKQKKNKNKKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXZ8	Ribosomal RNA-processing protein 8	0.835	40-48	RSKKRKRDD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXZ8	Ribosomal RNA-processing protein 8	0.678	251-259	VKKGSKPDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYD5	Uncharacterized protein	0.851	28-40	KRKSKKPSPPRSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZV1	Uncharacterized protein	0.799	698-710	KKRNFNSKRRLKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8W8	Uncharacterized protein	0.825	5-30	RKQPFKPWTPRPTKRAKYTPRVPRSQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8W8	Uncharacterized protein	0.716	1419-1429	GARKRGQSTKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9W1	Uncharacterized protein	0.658	173-177	RRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG4	Uncharacterized protein	0.997	134-163	GNEGRKRAGGRGRARGRGRGRGGRLGRGGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG4	Uncharacterized protein	0.78	202-214	GGKPRAPRPQKQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG4	Uncharacterized protein	0.668	270-277	ARNERRKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDN6	Uncharacterized protein	0.917	219-234	RRNPRKKFPKSPKLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH23	Uncharacterized protein	0.724	316-321	GRKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL56	SWIM-type domain-containing protein	0.7	30-37	PPKRARRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL56	SWIM-type domain-containing protein	0.682	90-98	RERRFRARP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN10	Non-specific serine/threonine protein kinase	0.999	641-663	KPKKKARRGRRGGKAHKRGKKPG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN10	Non-specific serine/threonine protein kinase	0.611	599-600	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN93	Uncharacterized protein	0.983	37-64	VKRRRIDHEKRQRKAHRSQRIAKEKIKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNU2	Uncharacterized protein	0.755	434-441	KKHAKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP55	Uncharacterized protein	0.719	483-494	PRRARSHHRHRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPE1	40S ribosomal protein S15	0.99	48-78	RARRRFNRGLKRKPMGLIKKLRKAKQEAKPN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQB3	ERCC4 domain-containing protein	0.72	116-122	KKARKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRM1	Uncharacterized protein	0.903	236-253	KQKANKPDKRAGRAGRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRM1	Uncharacterized protein	0.82	344-353	PRSRAKGKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRM1	Uncharacterized protein	0.819	323-329	KGKRKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRM1	Uncharacterized protein	0.723	268-274	GKGKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRM1	Uncharacterized protein	0.637	370-373	GKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTP4	40S ribosomal protein S26	0.946	85-112	RVRSREGRRNRAPPPRIRYNKDGKKLNP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTZ3	Goodbye domain-containing protein	0.653	245-251	KEKRDKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWD9	MFAP1 domain-containing protein	0.977	435-486	AVRERRRSRSRSYSPRRDRREGDRGGNRYRPEDSSRRKRSPSPYEDREKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWD9	MFAP1 domain-containing protein	0.626	271-274	RIKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZJ0	E3 ubiquitin-protein ligase	0.782	282-298	KKPADKKAPAKSTTAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZJ0	E3 ubiquitin-protein ligase	0.78	387-417	RAPPKAESPSKTAAKSPATKRLPSSRPPAQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D086	Uncharacterized protein	0.947	622-634	PKKEAKKKAKKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1K2	HMG box domain-containing protein	1	83-121	GTKKKKATKKKKAAKKPKKAKKRGLTEKQKEAKKARDQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D205	Protein sip5	0.998	554-582	RRKREEKEAKKDAKKREKEAKKAEKAARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D205	Protein sip5	0.74	72-88	REARKLEKERIARVKER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9A8	Phospholipid-transporting ATPase	0.951	208-224	PRPKKSKKPAFKFGRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9G1	Uncharacterized protein	0.922	359-380	KRGPMKALKLKRRFTVGRRDRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9G1	Uncharacterized protein	0.873	120-139	SRRTPKRKRTVSPPSPSGKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J5	Uncharacterized protein	0.985	26-46	KKKKRREKADDKRRGWPLGRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J9	Uncharacterized protein	1	18-52	RRRDERRRREKMKDEKGERREKKRRRRKMEDRRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J9	Uncharacterized protein	0.696	121-128	RKIKEKIK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9K6	HET domain-containing protein	0.645	411-415	RRGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCS6	Uncharacterized protein	0.979	977-993	AARKNAAKARKKRRAAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDU7	Inositol-3-phosphate synthase	0.986	627-726	QHLRPRLRRLRRRIDPQHRPPRLVRIHPLQQLKPGHHARHRRPGHRTHHDRAKPHPHFPLLLAHLKRPPRKPQPAQRMVRRPRGDIVRPLPGRLALRPQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH67	Uncharacterized protein	0.996	114-148	KGKPRKATQKARKVAVKRVRRALSKERKSKRPSKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH67	Uncharacterized protein	0.883	66-88	GKTPPGPPNREKRGRSPDARSKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU1	RNA exonuclease 4	0.999	293-313	EKEKGDDQKKKKKKKKKTRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU1	RNA exonuclease 4	0.832	38-65	GAVKKRKTEALQGKTKYEQAREIKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJH8	DUF4604 domain-containing protein	0.982	140-156	RKDAGSRKPKQKKKKIK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJH8	DUF4604 domain-containing protein	0.68	118-121	KKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKR7	Inheritance of peroxisomes protein 1	0.983	190-204	KVRRRKKAWRPKGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLL4	PALP domain-containing protein	0.754	355-362	KKRKRAQG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLX0	Pre-mRNA-splicing ATP-dependent RNA helicase prp28	0.966	52-110	PEPKKKKLGWGSKRPAAAPLSVEELVRKKREADAAAAKPKFLSKKEREKIALEKRAKEV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLX0	Pre-mRNA-splicing ATP-dependent RNA helicase prp28	0.778	212-217	KKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMD2	tRNA-dihydrouridine synthase 3	0.959	365-379	PPKKKQKRDKTKGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMQ0	Uncharacterized protein	0.633	729-733	HARKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN25	Zn(2)-C6 fungal-type domain-containing protein	0.737	81-87	RRKRGRI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUA6	Uncharacterized protein	0.665	326-331	ANKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYT0	Uncharacterized protein	0.995	265-312	RKSKFRFKRSSKHRSRSHSTHADDGSHRRRHSHGHHHRSKRRKHRRSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYT0	Uncharacterized protein	0.663	435-440	RERRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZG5	Transcription factor pytR	0.758	72-79	RKGRPRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D054	DNA-directed RNA polymerase subunit	0.809	335-352	NRPVKAIRSRLKGKEGRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8Z3	Uncharacterized protein	0.711	5-10	KHKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC42	RNA-dependent RNA polymerase	0.706	78-89	KGRIRFKPPPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDA4	ANK_REP_REGION domain-containing protein	0.753	630-646	ERERRARAAEERIRRMQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDY5	Protein kinase domain-containing protein	0.993	291-408	REPPPRAAEPPPPPRSRMPLGPPPKFKSDNRFDRRDRDRRRDRDRDRGRNDRRGDFRDSRGFREPKDGRDNRRDDRRFDGRNDKRRGDRRQDLPPERPRERSPEPAKQTKVLARPKPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDY5	Protein kinase domain-containing protein	0.78	740-761	RKERDREARRAEYQRDKEKRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDY5	Protein kinase domain-containing protein	0.616	55-58	RPRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI13	Uncharacterized protein	0.999	230-282	EPKSRKKPGKKRRLQLRKRVTAAEEAKQKEAEKRNRKNRERKIKRRQKAREQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIP4	Separase	0.784	1770-1777	SRRKGKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKL1	U2 snRNP component IST3	0.999	205-292	EKSSKRRDHSRERSSRHHRSHRHHRREDDRSRERERRHRDRRSRSRSRGDRDKRRSPSRRDRDYRDRTPVGSRSPEPRRHRDREERYR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKL1	U2 snRNP component IST3	0.965	144-161	RRRRKKRRTSDDEPRRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL57	Uncharacterized protein	0.693	361-368	KKSRRREP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL57	Uncharacterized protein	0.65	372-376	VPKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLN2	Uncharacterized protein	0.937	103-140	RPRRSDSDRKVKRERPDSEIVVPKKRSRFPWSRRKEAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLN2	Uncharacterized protein	0.828	543-554	KRNGRGRRRHRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNF8	CBF domain-containing protein	0.737	12-18	KKRKNPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVJ3	RHOMBOID-like protein	0.796	119-130	RRKQRKGFFKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYI8	Bms1-type G domain-containing protein	0.895	19-48	KPYKSRHASKSSIKDKEKGKVERSERGTRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C924	PPIase cyclophilin-type domain-containing protein	0.99	152-180	KRDLAAKKAAGAAAEQPPPKKKKKAKAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C924	PPIase cyclophilin-type domain-containing protein	0.945	402-436	EIVGGRRRGLERDRERDRKRERVGDLEWERSRKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAC0	Uncharacterized protein	0.844	880-888	KRRKRPIKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAN9	Uncharacterized protein	0.78	463-472	PHSRRKKSMR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCU6	Uncharacterized protein	0.992	74-100	HPKPPAGSKRSTGPSRKRRTRAKNKKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEK0	Zn(2)-C6 fungal-type domain-containing protein	0.865	87-97	RKARSPRKKIK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEK0	Zn(2)-C6 fungal-type domain-containing protein	0.637	59-63	RPAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFT7	Uncharacterized protein	0.941	459-489	KREKAALKHDLKTKEGKTWLWRRKSKRVKGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI35	ATP-dependent RNA helicase mak5	0.998	143-174	KEKKEPKKKEAKKEVKKDAKNAKKEPKKKDLP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI35	ATP-dependent RNA helicase mak5	0.849	83-94	FKAKAGKPKKSI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI35	ATP-dependent RNA helicase mak5	0.732	699-707	RGRGRGRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI35	ATP-dependent RNA helicase mak5	0.718	17-21	KKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMP0	Zn(2)-C6 fungal-type domain-containing protein	0.775	58-68	RGYKGPSKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN15	Peptidyl-prolyl cis-trans isomerase cypE	0.843	36-42	PKKKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQY8	Uncharacterized protein	0.956	143-164	GRPPGTPKSDDPNKKKRKRTAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR98	Uncharacterized protein	0.994	434-475	RARRAELRKRRDLMFREEVRAKRIKKIKSKSYRRVHRREREK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR98	Uncharacterized protein	0.89	136-149	SKSKPKKKTQPAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR98	Uncharacterized protein	0.665	503-516	RAEARMGSKHKESK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR98	Uncharacterized protein	0.628	588-592	RKLRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRB9	HECT domain-containing protein	0.942	550-578	RRPSHPKDPNPKRAPDPKPPSRHRSGGPG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRB9	HECT domain-containing protein	0.741	506-514	KRPRRPLKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRB9	HECT domain-containing protein	0.735	71-78	GIGKRRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRB9	HECT domain-containing protein	0.601	55-55	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWV2	Uncharacterized protein	0.844	10-27	KGQKIPRARRQAAHRPKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1T5	Uncharacterized protein	0.94	136-147	PRGKKLKPRKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C819	SPX domain-containing protein	0.851	142-155	AAKKHDRKRGARYR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSL0	C2H2-type domain-containing protein	0.749	66-74	RKGKNHKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSP9	DNA damage-binding protein cmr1	0.998	40-82	KMPKGASPAGDKAKKKKPAPKKVKKEEAAAAAPVPRRMSSRLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVZ9	Uncharacterized protein	0.997	416-435	RKVSKKERKAKKREAKRQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVZ9	Uncharacterized protein	0.962	323-343	KRIKRAMKNRRHRKSSGSSRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYR0	Glyco_hydro_63 domain-containing protein	0.621	924-929	RRSSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYT6	Uncharacterized protein	0.964	147-176	KQREEQLKREKRKKLDDLRKAQAKAANKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYT6	Uncharacterized protein	0.72	235-248	PNKLKFLDKKEKRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D160	Ubiquitin-conjugating enzyme E2S	0.943	357-380	MPGTRKVSGSQGKKPKPRIGIRRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9Y5	Fungal_trans domain-containing protein	0.665	32-38	RPKPRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAD1	Serine/threonine-protein phosphatase	0.937	627-643	SPRGTRSSRRKQRRRGA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAX6	Uncharacterized protein	0.74	273-281	KRPMKKKIG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAX6	Uncharacterized protein	0.684	421-426	RRKKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDZ0	Signal peptidase subunit 3	0.968	136-161	KPNSRNSRAKKRTPPKNAKKDAAAPG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGZ3	Dolichyldiphosphatase	0.651	216-221	KRKLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGZ8	SNRNP27 domain-containing protein	0.998	38-149	PRREAHPKADGRRDDRRYRSRSRERRDRRRERSWSRDRRDRDRDRRDRDREGRGMKDRERTVSRERHHDRRGYPSKGDRYRSRSPVRNGNRDSRTPPRGPRTERRGDRRDVR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI95	Uncharacterized protein	0.871	828-846	AGKRKFLERRRGAGAPGRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI95	Uncharacterized protein	0.696	443-452	RSRRVRRMAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKT6	Structural maintenance of chromosomes protein	0.864	131-145	ARKRKSMPHPRKSRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNN2	Uncharacterized protein	0.666	280-290	KRPTMRPSRKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ05	Uncharacterized protein	0.984	536-580	EERRAIKEETRATRKVFREVLRRAREEQRERRRKDRSGLKRETAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSU4	Uncharacterized protein	0.981	1102-1166	RGSSERSSGSRHEEEKRREARKSRRTSEDEQAKAKEESPESRRHRHSGEGRHRHHRHRREPSPSA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSU4	Uncharacterized protein	0.971	956-1004	KALEEAKRQHREKLIQEEKRRREKEREQLSLEKEKERREHERSRRRSSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSU4	Uncharacterized protein	0.95	910-931	GSRRRKRRSPGIESERRHSKVS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSU4	Uncharacterized protein	0.72	5-11	KKSSKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTP2	60S ribosomal export protein NMD3	0.837	410-424	PNRQKKNKRNWKLKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV70	Fungal_trans domain-containing protein	0.829	25-35	RKHRRGRKPGM
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D074	Uncharacterized protein	0.732	44-53	KKAKLKRLQE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA89	WHIM1 domain-containing protein	0.861	272-286	EEKRKRRDYRIARKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAK3	J domain-containing protein	0.997	599-625	RPRERKKRRRVIARRQKELKKLIPKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CB20	Uncharacterized protein	0.963	46-78	AKRKSKAPARLIHGERDIPQRDEWKLRKKRRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD76	Anucleate primary sterigmata protein A	0.69	616-625	HKKRSVLRKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHZ7	Uncharacterized protein	0.926	1324-1335	ARPTRRRSRGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHZ7	Uncharacterized protein	0.793	276-285	PKKRRRTSGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJK3	Uncharacterized protein	0.988	1042-1075	RKDKGSSKSRSASKVRKPRSRNSSERRKNRSSSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJK3	Uncharacterized protein	0.756	1133-1155	SRRPEKGTTKRDPSPDNRRPRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMH9	RNA helicase	0.988	36-61	KKPKKAESPSSTPTQPGEKRKKKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMH9	RNA helicase	0.659	14-19	KSHKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNV2	THUMP domain-containing protein	0.61	20-21	KR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQD9	Uncharacterized protein	0.703	108-122	RPWNWIRKKSNHEKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQK4	Uncharacterized protein	0.997	191-215	DRRRRERRRREREGRHRDGKSRSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQK4	Uncharacterized protein	0.861	156-173	SKSKGARSRDHERRPRRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQK4	Uncharacterized protein	0.628	485-488	RKPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH2	Uncharacterized protein	0.938	346-361	PGGSRHRPHKRRKVGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH2	Uncharacterized protein	0.862	710-726	RNARSRRDRGRRSPSRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH2	Uncharacterized protein	0.767	634-662	KKSSTKRPSQSKAGSRFTDINKRPRLKRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH2	Uncharacterized protein	0.705	943-949	VRKRPPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0V3	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.881	131-145	KKSLKRGPGRPPKRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0V3	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.833	485-495	KSTRGRKRKHD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0V3	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.814	195-211	PKPKGRQPKSVSARRKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D227	RING-type domain-containing protein	0.81	78-87	RPHRRRREKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	H9CP13	Ribosomal protein S5	0.937	256-279	KLRKKRKLLRYLKALVRKAKIKDI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	H9CP13	Ribosomal protein S5	0.783	79-89	RKERLRRRLRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8X7	Uncharacterized protein	0.935	35-53	LKKRKHNKEDPTKKNKKQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8X7	Uncharacterized protein	0.835	90-102	RSKKKNLKGKPHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C941	Nucleolar protein NOP2	0.996	647-734	RAERNRLRRKGLNPKAVLSKPGKSPKKDKPAEQSNDAPKANKKEKNEAKEGTEKPSAGKPAEKAQSSPAEKKKNKKQSQSPKGKKSSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C941	Nucleolar protein NOP2	0.973	4-63	GRRMKKQGPPAPLDESKITTFKKRKAAEPESKPESGAKRRRAAAEDDEPVKKVSKKKADA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C941	Nucleolar protein NOP2	0.85	68-87	GKTTKDASAGKGKPKEKPTQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9M5	Uncharacterized protein	0.644	218-224	PTSKKPT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9P6	Uncharacterized protein	0.696	12-30	KRSRSRSPSSRQPQKLPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9P6	Uncharacterized protein	0.636	90-96	KKKAEIR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBG3	Uncharacterized protein	0.631	105-109	RPKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD14	HNHc domain-containing protein	0.951	104-121	TKSPKRKGKKGESPSPTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEM7	Uncharacterized protein	0.643	215-218	KRRF
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEP7	Exonuclease domain-containing protein	0.856	211-221	SKRASKKKRID
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEP7	Exonuclease domain-containing protein	0.641	398-402	KGPKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLS6	Uncharacterized protein	0.772	6-13	KKLRRKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNW6	Uncharacterized protein	0.992	104-128	SKGVREKAKKRGRGKEAARMTRKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP61	Uncharacterized protein	0.958	402-420	KEEKKKKKGFFSRLKEKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPU1	Polynucleotide adenylyltransferase	0.797	611-635	PKERLTKLQRKHQASRDRAARLKKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU54	Uncharacterized protein	0.981	569-587	APAPEAKKPGPKKPKPKPD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU54	Uncharacterized protein	0.62	468-471	KPKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXC7	PWI domain-containing protein	0.997	131-193	RRQKEQERARERELEDIRRRERSDRMRGGRRGGRGGGRDFDRRRSPPRRRSRDRFREPPSRRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXC7	PWI domain-containing protein	0.997	199-286	PSGSRRGRRPSPSAHQSRDDDDRRVSRSRDGRRRRASSSVSRSRSRGRSRTASSSPRRHRDDSRSRSRDRKRRRSLQRYAPAARRRRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZL7	Protein kinase domain-containing protein	0.928	58-90	RSSPEKASRNGKNRSDRERKGDESRSRRHAGKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1D9	Deacetylase sirtuin-type domain-containing protein	0.83	48-61	ARKKRRVTAPPKER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7G1	Uncharacterized protein	0.942	14-29	PPSSKKPKQARGKGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCQ4	Phosphatidyl-N-methylethanolamine N-methyltransferase	0.972	188-203	KRERERAKSKKGGKRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEN7	Zn(2)-C6 fungal-type domain-containing protein	0.805	69-76	RPRKRRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLP9	Pescadillo homolog	0.99	610-676	KKKKSSQAKKIAAKKRKEEEELERQKMMMSRKKRKLLEKMMYSNKKQSEEAAKLRSKRRKLEKTGEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLP9	Pescadillo homolog	0.601	50-51	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSC3	Uncharacterized protein	0.834	1090-1100	NKKPLRKRLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVP4	ATPase family AAA domain-containing protein 1	0.827	72-87	RRGGSNSSKRGRRQKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW63	DNA ligase	0.808	556-566	RKKRVKRTTKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX76	Uncharacterized protein	0.877	107-123	KPAKKTEKAAPKKAAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX76	Uncharacterized protein	0.855	148-162	PAKKEEKKVEKPKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX76	Uncharacterized protein	0.622	36-40	KAKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXL9	DNA replication regulator SLD2	0.986	492-534	VKETEKKQPRLRKVNPEAHANYRSLKIRNRGSKGRGAGRFRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXL9	DNA replication regulator SLD2	0.855	370-385	KKKGQKRTTRRVRMKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXL9	DNA replication regulator SLD2	0.746	78-83	RPKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8C8	Uncharacterized protein	0.686	661-666	IRRPKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA24	H/ACA ribonucleoprotein complex subunit CBF5	1	419-454	KKKRKRHEGETAEERAERKKKKKEKKEKKERRKSKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA43	Ribosome production factor 1	0.996	19-66	KPANKLRRQMLHVRRKKAKDAARRAERFGRKKEEAKNPKLKEERLKRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC61	Uncharacterized protein	0.997	91-167	KRKEEREARERMQQLRHKTAAARLAGESESRSHRHRDRDSRRDDRDDRHRSHRRRHRSRSASVERARHRKHRGRRDE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC61	Uncharacterized protein	0.996	174-240	ERYRSSRKSRRRRSYSRSRSRSPRDEDRHSRSHRRRHYKRADPSRSRSRSRSPETDDRRRHRRKEES
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDE3	Cysteinyl-tRNA synthetase	0.814	785-799	KNKRKKLVKEWERQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CES1	C2H2-type domain-containing protein	0.907	120-143	EKERAKHGGRRPSDRVKGEREARE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CES1	C2H2-type domain-containing protein	0.727	19-26	RRRGRGRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF85	Uncharacterized protein	0.88	56-79	RHHVQEKRKQRKHSLPRNDPDKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGC1	Uncharacterized protein	0.892	5-21	RRQRGRKGIARRIRGIE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG2	SAGA-associated factor 11	0.988	271-294	PKKKKLGAPKKLSGKKPPPAPSSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLP0	Uncharacterized protein	0.96	617-636	RAKGKSSKSKKADKSKGKNA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLP0	Uncharacterized protein	0.734	5-20	RRLSARDRREPAAKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNY6	Calcium-transporting ATPase	0.711	1176-1186	KRAAKRVFGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPA3	Zn(2)-C6 fungal-type domain-containing protein	0.958	181-206	PRKRGRPRKHPLPVPGGQAKITKGRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR75	Ubiquitin	0.805	416-422	RPKKKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTT0	alpha-1,2-Mannosidase	0.7	72-80	RTGPRLRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUZ6	Longevity-assurance protein 1	0.773	54-61	SKRRKSRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY08	Nucleolar GTP-binding protein 1	0.84	507-527	AKMRKSLKNRAAIPRSAKAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.994	1037-1053	ADDKPKKKGRKPKAKSG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.961	1011-1030	YVRVPKKTQKGGKGKKAKQA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.915	25-39	KTPAKKEEPSRKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.903	249-274	ASKSPAKKAAGRSKGTPSAPSTKKQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.799	97-138	KKRGRTPKAASNAPAKESQPAQDKSSKPSKHDTSPAKKRQSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.746	235-242	AKKRKSEA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.614	72-77	KPASKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS5	Replication factor C subunit 1	0.611	428-429	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y6	C3H1-type domain-containing protein	0.995	188-208	PSKPPPPADAARKPKKKKRKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y6	C3H1-type domain-containing protein	0.946	269-312	RKKRFPTQARIEERKKAMEEAKKAREEAARQREQRRQETKRAQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y6	C3H1-type domain-containing protein	0.922	326-348	AKAKQRADKLRRKLQKEQKRVEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y6	C3H1-type domain-containing protein	0.692	491-504	RPVKQKAAEKPGRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8C0	Uncharacterized protein	0.667	195-203	RRPGNRRTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAN5	Zn(2)-C6 fungal-type domain-containing protein	0.844	28-39	APEKRKRVRRWH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAQ9	Splicing factor YJU2	0.914	254-275	ARVKKAKKPPVNSLGIKKKVKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBK4	Uncharacterized protein	0.997	94-162	GHPDPERTQHRRQRQRHRERWRPHHLGQRQRRLRRRQDERGPRPGRSRLQRRRPQRRGRCESGRLRRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDL5	Zn(2)-C6 fungal-type domain-containing protein	0.777	317-327	PPRAKRPRAAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CG16	Uncharacterized protein	0.793	156-165	LSPSRRRKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGH6	Uncharacterized protein	0.884	17-59	APAPKRRASARLSASANPEPKRQKPQESSKTEAKPVRSTKKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGH6	Uncharacterized protein	0.838	107-122	KPKAKQTKTKKAGKVK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNX4	Uncharacterized protein	0.941	82-108	GKPDKRRIRHSYASRGQKGRVRRRSRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTZ5	Uncharacterized protein	0.626	14-17	RGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZE9	Uncharacterized protein	0.94	335-381	TRRAKGSGNALEKSRKRKLTEDGPRSDGAGLGHIFEKRRKKIEGWKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZE9	Uncharacterized protein	0.851	297-308	KESKKERAKRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN2	Uncharacterized protein	0.845	918-929	NRARGPKRRPPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D106	Uncharacterized protein	0.658	27-36	RKRMKDAARS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1T1	Casein kinase II	0.895	64-74	KPVKKKKIKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8V6	W2 domain-containing protein	0.992	147-166	KGGKKDKGDKRARRERKKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF16	OTU domain-containing protein	0.759	369-379	RRTRVRERKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFP5	Uncharacterized protein	0.952	711-720	KAKKKKKKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL72	Uncharacterized protein	0.895	144-155	RRPRRRSRAKSN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNY3	Uncharacterized protein	0.612	25-27	KRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQD8	BTB domain-containing protein	0.851	12-33	RVGKSVKHAKKKTFDRHVSKAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQQ5	Uncharacterized protein	0.907	137-161	PKHQFRLERKYRRRAALKFARPKWT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWP8	Clr5 domain-containing protein	0.979	176-204	KRKERLERLKAESAERWATRKRRRRTRGW
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZI4	Uncharacterized protein	0.995	288-303	KIKKPKKKKSKATKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZI4	Uncharacterized protein	0.884	121-134	KKRQKKIEKERARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZI4	Uncharacterized protein	0.857	630-650	KGSGKMKTEKRLKKIEEEKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZI4	Uncharacterized protein	0.797	75-89	KRKREERNAAIKKAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZI4	Uncharacterized protein	0.646	372-374	KKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C877	Hist_deacetyl domain-containing protein	0.976	942-974	RAADERKQRSSKGPRTPRSPVKSPKKRAVSAKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9U0	Uncharacterized protein	0.95	614-634	EKARRRAEKRSGSKKSDDRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAA9	Uncharacterized protein	0.877	446-456	KRKGAKAKRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAA9	Uncharacterized protein	0.796	334-339	RRKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC91	40S ribosomal protein S2	0.993	7-36	GRGGFGSRGDRGGDRGRGRGRRGRRGGKQE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD51	Rab-GAP TBC domain-containing protein	0.914	605-615	EKKRREKKRME
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFB6	PNP_phzG_C domain-containing protein	0.698	349-356	RFRKRSSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGU2	Calcium-transporting ATPase 3	0.746	246-255	RKRPVKRGPQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH26	Uncharacterized protein	0.931	95-112	PPGEKKRAMKKANRRPVP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH52	rRNA biogenesis protein rrp36	0.992	259-356	NQKREREILAEHKKKEKQLIREGKKSNPYYLKKSDLKKQVLLKKYENMNSKERMKALERRRKKMASKERKEMPMERRGLENDAAPAHDGPGRKRRRVA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH52	rRNA biogenesis protein rrp36	0.68	153-162	EKKPTRSSKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKU6	Uncharacterized protein	0.872	233-245	EARKRERKMRERK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM44	J domain-containing protein	0.779	561-573	PRSPRKPARPATK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPH7	Type II protein arginine methyltransferase	0.87	306-319	PKNRRWRRKTPRQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPH7	Type II protein arginine methyltransferase	0.845	65-98	RSASASIKPKKNTRAPSAPTRPAQSTAKPPNKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS36	Uncharacterized protein	0.962	224-244	KKQLKKQTKKAAKKASGKKTD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS36	Uncharacterized protein	0.85	640-652	EKRLRKEARRRLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.98	1591-1625	KPAAKGKAAAKGKSTAAAAKPTAAKARGRPKKDAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.979	24-60	APKPKAKAAPKKAAPKKLTQTTLTGKGKAAASKKRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.974	1422-1444	GQAKIAEAPKRGRAAAKPKPKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.871	89-103	PKKQKKAPATKKGGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.741	1294-1304	RGGGAAARKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.696	1320-1330	KSKKSAAAKKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.681	1370-1380	KSRGAPKSEPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSB2	DNA topoisomerase 2	0.653	1406-1417	KSRGSSKPSVKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWT1	Meiotic recombination protein DMC1	0.971	575-607	KRKMRQNELLKRFDEDKKRLEELKRRKGKLRPE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.986	202-220	GKKGKAKGSRSKRGRPSKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.98	545-565	KKSSKKKASAEKVKKSKKAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.972	253-272	KTKGKKKSSKSKSKTSKSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.947	418-437	KSEPKKKSTSTKSKSKKKQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.934	365-377	KSRAPPKKRGRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.92	295-305	PKPRRGRGKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.771	608-622	SHRRRSSKVPPKTAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.756	23-41	KRRSSSTKSAKKIAWPHRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C6	Uncharacterized protein	0.749	477-487	RKPSKSSKRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0I6	Uncharacterized protein	0.886	9-30	RKPTKEQNARDAKKDKKKSSQP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0T1	Heat shock protein Hsp88	0.772	531-541	KKTRKVKKQVR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C839	ANK_REP_REGION domain-containing protein	0.745	33-40	KKLKKNKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA08	Cation-transporting ATPase	0.803	1301-1310	LQPGRGKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFQ8	Acid trehalase	0.817	468-487	RGRAGRHQLPRRETRPGRRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU5	Uncharacterized protein	0.956	633-675	RMEARQRRLEQEEREEAAKRERIRQKLEALGPPPEKAKPKRKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU5	Uncharacterized protein	0.856	1278-1298	NNKPRKNAKSRDGPGGPNSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHW7	BZIP domain-containing protein	0.975	136-181	GKKRRESDDKTAKKPGRKPLTSEPTSKRKAQNRAAQRAFRERKEKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIX5	AAA domain-containing protein	0.999	243-265	RKHHRKRSKAKKKASKHSRKKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIX5	AAA domain-containing protein	0.977	337-370	KLKLSRQGKHRRKRHSDSNNDAQKRKRKRAASKM
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIX5	AAA domain-containing protein	0.926	476-488	KTEKKKKARKIAN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIX5	AAA domain-containing protein	0.85	185-201	KKHPGKESDPSARKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIX5	AAA domain-containing protein	0.73	302-309	LRKAKKNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK70	Chromo domain-containing protein	0.993	108-139	GRPEKTKGRKRKSMGAAKQKPDSAEPKRRRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKM9	Uncharacterized protein	1	139-180	RSKKAATKPAKAKTKAKAKAKAKAKGKGKGKGKGKRKRKTPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMB8	Uncharacterized protein	0.985	6-49	KKSTKKFEKKHLKDVLERRKAVAKIKQRNHLKEKRKADNARGRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMB8	Uncharacterized protein	0.892	95-111	KKARKKDVTPKTGKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMB8	Uncharacterized protein	0.868	202-208	AKKKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMB8	Uncharacterized protein	0.665	713-732	LREEKAKILEEGRREEERRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNC1	Uncharacterized protein	0.765	140-150	IQRKPSKWKKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQB9	Histone transcription regulator 3 homolog	0.72	1789-1804	RGRTKGIARRDIQKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQB9	Histone transcription regulator 3 homolog	0.633	1810-1815	RKLGPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVZ5	Uncharacterized protein	0.987	174-194	RRGKGHRGRRSLRRRAKMAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVZ5	Uncharacterized protein	0.887	119-137	KRDRLRWARRDRKAKTGVA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXS4	Transcriptional adapter 2	0.893	157-173	RKKRRIEERKEAAKAAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI17	VHS domain-containing protein	0.963	195-213	KHKRTSSKSLKKEKKEKKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJU2	Zn(2)-C6 fungal-type domain-containing protein	0.906	42-67	KPARRRGPKIRRVAASENNAGRMRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKI8	Zn(2)-C6 fungal-type domain-containing protein	0.659	103-106	RKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM15	Dipeptidyl-peptidase IV	0.992	941-986	RLRRREERRAKAARAQRQAQQREKQLVRRKRAQRREQAARRREERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPW4	Actin cytoskeleton-regulatory complex protein pan1	0.921	1115-1134	KIKKQEEKRRKEEAERRAKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPW4	Actin cytoskeleton-regulatory complex protein pan1	0.879	1019-1039	AQPSTKPIGKKPPPAPPSRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPW4	Actin cytoskeleton-regulatory complex protein pan1	0.607	987-989	RER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPW4	Actin cytoskeleton-regulatory complex protein pan1	0.605	992-992	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQH1	Nucleolar protein 58	0.997	533-577	KKDLKKAKKEAKKASKGDDKKRKRSDEGEGVDNAEKKKKKKKKDE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQH1	Nucleolar protein 58	0.699	488-494	KKSKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR68	Signal recognition particle subunit SRP68	0.78	380-399	PKGGKASGKREEATGKKLAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR68	Signal recognition particle subunit SRP68	0.769	30-46	KLHKLRKKLGQTTPKGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRL7	Uncharacterized protein	0.717	126-132	KLRKPRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRL7	Uncharacterized protein	0.617	176-178	KKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV02	Uncharacterized protein	0.965	111-160	PRKRRQHHGPESRNARPSPSPARRTAEHRKPRLAGGSSPHIKALSDKRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV02	Uncharacterized protein	0.719	79-85	KKNRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV03	Uncharacterized protein	0.982	75-116	VKREPPTPKTPRTPKTPSKLRSPVPDKSSKKKPTPPSARRKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYI7	WD_REPEATS_REGION domain-containing protein	0.995	460-519	RKAEDPIEKLKNRGRGRNSALRKYLRKKGRRNVIDEKRVKAEMLRKEHAARAKERLRAER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYI7	WD_REPEATS_REGION domain-containing protein	0.701	14-22	KRKENKRLA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1R4	Uncharacterized protein	0.615	588-590	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAR2	Uncharacterized protein	0.835	89-97	KRTGRRRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBJ8	ZnMc domain-containing protein	0.997	221-250	RKEEKKKEEKKKEEKKREERKTKETAKKDK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBS0	Flap endonuclease 1	0.997	362-395	LKRKHDEKLQEQKKRKKEEAKAKKEAKARPRGAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDX8	Uncharacterized protein	0.722	545-561	LRRLLRDQEKEARRRAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB2	Uncharacterized protein	0.809	117-126	KRLGRRKPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB2	Uncharacterized protein	0.649	746-751	KKSRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGS6	Abhydrolase_3 domain-containing protein	0.99	414-492	RRHKEPAPPSLQARRRARGRAPRRADDQPGPQRVALHAGHAPRRAPADPARRKGRLPPAYALRRALPHRGRARVHRHRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIQ3	ATP-dependent rRNA helicase rrp3	0.705	427-435	GRGPRNRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJZ1	Uncharacterized protein	0.888	112-123	GHAREWKKKKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK30	Fungal_trans domain-containing protein	0.729	10-16	RRKRKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN45	RING-type E3 ubiquitin transferase	0.98	154-183	RPTRGASTRKAQPAVKKKKTTKAKTSKKVK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN45	RING-type E3 ubiquitin transferase	0.895	400-421	GRGSRSRGHAPRRGGGRDKQNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN45	RING-type E3 ubiquitin transferase	0.888	1124-1134	GGKKGKAKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP74	HRDC domain-containing protein	0.969	682-696	KPSKKQRRKEKKSKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPF0	Uncharacterized protein	0.897	556-595	PQGRGRGQAAGRGQAPGRGGARGNSQRGGAPRGRGQPSNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT04	Uncharacterized protein	0.736	1186-1194	KASKKTRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT04	Uncharacterized protein	0.65	1259-1265	GMRRGPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT04	Uncharacterized protein	0.602	1256-1256	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV20	Importin N-terminal domain-containing protein	0.999	872-893	WRRRRAARRLMRRRRRRWRKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7F6	Uncharacterized protein	0.644	223-229	AKNRWRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8F5	Na(+)/H(+) antiporter	0.985	521-534	KPPHKTRRRRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8F5	Na(+)/H(+) antiporter	0.835	717-727	AKKKAAKAKAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9D6	Uncharacterized protein	0.66	156-163	RQKKMEKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I7	Uncharacterized protein	0.998	51-70	PKKSTKRKKKRQRKRHNRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I7	Uncharacterized protein	0.939	350-362	AARAGERRRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I7	Uncharacterized protein	0.767	303-325	RFGKSAPSSPGSPRSPRELRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CER5	Uncharacterized protein	0.994	88-112	VRIGKQDRRQRRRERRNSRRGRRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF73	Non-reducing polyketide synthase ATEG_07661	0.96	1724-1745	SRTTKKKAKASKSKSSVKKDKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU4	Histone acetyltransferase	0.965	58-81	KPEKKKTGPGNKAPSKNKRARAGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU4	Histone acetyltransferase	0.8	434-448	KKRLEKERIKGSRKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CND8	Uncharacterized protein	0.973	24-34	RPKKKRKKSKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNH8	DUF2235 domain-containing protein	0.76	252-260	KKRAHRWKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ00	Ribosome biogenesis protein RLP24	0.911	41-61	KMKRQPRKLKWTKASRAHKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTC5	C2 NT-type domain-containing protein	0.996	347-366	RFKRKPKRRPRFKKEEAKRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW96	DUF1308 domain-containing protein	0.754	151-159	KKRPNKDKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWJ3	Uncharacterized protein	0.935	722-746	RGHQAGTPEKKRSKSRHRSLFQRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWS7	Uncharacterized protein	0.984	341-351	RKPKKRKRKNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXI9	SAM-dependent MTase TRM10-type domain-containing protein	0.997	76-123	KISKRQLKKLQRQKHWEANRADRKVKRKEKLMEKKERRRNEIAKARER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXZ3	KRR1 small subunit processome component	0.999	277-352	ERARKEEVMEKQRQKREEKMQERAKSFVPPEELEAAKEKKEKKDKKKKRKRDSEGEPDVDSSEKKEKKKKKKSKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY11	Very-long-chain 3-oxoacyl-CoA reductase	0.946	337-353	RKRALRKAEREKGKKST
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ23	Kinesin-like protein	0.703	169-180	PRSPLKHSPRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D116	Ribosomal protein	0.72	94-103	NKNKKLIKKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1G9	Uncharacterized protein	0.999	181-199	KKKNKKKKARKAKAKAKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9M8	F-box domain-containing protein	0.899	686-695	GARRRRRRAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFY1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.963	788-802	KRKRDKKELKARKRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFY1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.752	195-202	LKEKRRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFY1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.74	1084-1089	KKRKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFY1	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.602	1010-1010	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH51	FCP1 homology domain-containing protein	0.621	246-249	KRQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI6	G-patch domain-containing protein	0.879	419-440	RRSSRRDRSRSSGDRHSRRRKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI6	G-patch domain-containing protein	0.855	455-477	RERERDRDRARDRDRDRERRRYR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI6	G-patch domain-containing protein	0.845	370-405	AKAKRDEDDWKERRDRNLERSGRDRDRGRDRDSRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI6	G-patch domain-containing protein	0.822	318-332	WGRAAMRKGARKGGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLP8	RRN9 domain-containing protein	0.998	547-578	NKRPRGRPKGKGGRPKRENENDRPKGKGEHRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLP8	RRN9 domain-containing protein	0.962	371-402	SRSQSRGRKRTRRSSRGSSTGPRSRSAHSSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLP8	RRN9 domain-containing protein	0.67	519-526	RKRSRSRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLR9	DNA mismatch repair protein	0.947	200-213	QPKKRKRPSQPKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLR9	DNA mismatch repair protein	0.89	151-162	PGRKNNRPKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSS1	ENTH domain-containing protein	0.73	169-178	RRPDRRERRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTK3	Uncharacterized protein	0.97	94-112	GRPAIPRKRRIGRPPKNRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTK3	Uncharacterized protein	0.902	132-150	VKRRRGRPAASGGRWGRNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWA6	Uncharacterized protein	0.806	40-51	AFGKKTQKRRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWP7	WD_REPEATS_REGION domain-containing protein	0.815	12-31	KRSRKSDAIEEKKMPAKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZM4	Uncharacterized protein	0.859	4-25	KKKRVASETAGAGSSKKRAGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0R1	DUF4210 domain-containing protein	0.872	435-447	RRREKKHRRAESP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1T2	Valyl-tRNA synthetase	0.995	50-93	KSEKELERERRKAEKAKKFAEKQAKAAAAKPAAPKAEKKPKVEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1T2	Valyl-tRNA synthetase	0.852	982-1000	KSLHRKPKNPRTARILKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8V8	DNA ligase	0.998	108-135	QKRRRKSPKARSSPSPKKKPPSPKKSKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAV5	Serine/threonine-protein kinase 24	0.669	390-396	RTQRKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBD1	Histone H2B	0.991	5-48	AAEKKPTTGGKAPAGKAPAEKKEAGKKTAAAASGDKKKRGKTRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBS2	Phosphatidylinositol-4-phosphate 5-kinase its3	0.787	300-310	KQRRASRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBY8	Uncharacterized protein	0.999	16-73	DKKRKREAEESKENKAAAPSAGAEGPNKKRKDNKNKGGKNDKKDKKNRKVKKDKKDKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC65	Uncharacterized protein	0.994	480-510	HRKHRRKKTKDDKDRKEKKSDRSKRDSSRVR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC65	Uncharacterized protein	0.767	10-26	SRGRSKSPSGRIRERSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH01	ASXH domain-containing protein	0.952	3-57	RKRRAVGRGSTRKHPARGRPSGSTNAAKSTNAGKSSGAMSAGNTRPKRNPRRAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV2	Uridine/cytidine kinase	0.998	889-908	RKERERKKRRKEKLKAAKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV2	Uridine/cytidine kinase	0.988	1064-1100	GRKRRRDRTDRDDEAETKPEDRKKKQKKQKKEAGGDA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV2	Uridine/cytidine kinase	0.976	950-966	AAARRKEEKRKKREERA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV2	Uridine/cytidine kinase	0.972	1003-1016	EKQARKKKGKGKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV2	Uridine/cytidine kinase	0.62	1103-1105	LKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLZ9	Uncharacterized protein	0.965	140-176	PKKQAGRPKKQIPKEEEAPKSESAPRPRGRPKGSTNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLZ9	Uncharacterized protein	0.949	250-296	GRKRATAPGRQTGLAAKPARKTTTTSARGRKPAATKKTASKPLSPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLZ9	Uncharacterized protein	0.771	969-978	KSEKARPRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNN5	Uncharacterized protein	0.988	310-340	EREARRARRAVRERARDERRKKIEELRSKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSH0	Uncharacterized protein	0.995	983-1021	KTSKKKKGKMAQKNKKKTLAELKKEASKNIKSKRKYLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV38	MFS domain-containing protein	0.995	268-290	GGRKRHFDEGRGRRRHRKKGRRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY56	RING-type domain-containing protein	0.933	157-187	HRTRRSSRSRRAESVDGRSRRRREEERASRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7N5	Zn(2)-C6 fungal-type domain-containing protein	0.88	91-102	GGRTRRKVKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA38	Uncharacterized protein	0.997	1496-1511	KVKRSKKKSSKRKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA38	Uncharacterized protein	0.961	1536-1553	EAAPKKRRRLERRSGSKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCE8	Fe2OG dioxygenase domain-containing protein	0.681	6-11	SAKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCW7	Uncharacterized protein	0.966	99-125	RAHRKPRTPRRVGKRGSGCKAPPAGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL94	Methionine aminopeptidase 2-2	1	58-76	AAKKKKKRKPKKKKKGGAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNZ1	Uncharacterized protein	0.669	186-195	KRTILHKRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPI1	TPR_REGION domain-containing protein	0.959	429-454	RRRTRSPHRGSRRGNSRRPEVRKFRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ30	BHLH domain-containing protein	0.85	285-299	KRRRRRASHNLVERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUY2	Uncharacterized protein	0.877	113-158	KKKPDNGGNKDPDKKKPDNGGNKDPDEKKPDNGGNKDPDKKPDDKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV42	Uncharacterized protein	0.994	740-761	KSKKRKSTKGTRRNGKRRAGAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVI8	Uncharacterized protein	0.784	1032-1055	RRSKSADAKPRNETQDGKRGRGRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVI8	Uncharacterized protein	0.69	432-436	GKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXD5	Uncharacterized protein	0.935	198-213	RARVDRRRKRLKEKIR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXD5	Uncharacterized protein	0.684	20-27	KEKSKRPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXK8	Uncharacterized protein	0.989	197-222	KPRKRQKSSEPSQKGKKKAPTKAKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXK8	Uncharacterized protein	0.772	111-133	PEKAKMPKRTKQDSSATSRKRQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXK8	Uncharacterized protein	0.716	145-152	KKPAKKPT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CB39	MFS domain-containing protein	0.801	656-666	AKRGPVRRRRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CB39	MFS domain-containing protein	0.635	593-597	IKPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGI5	40S ribosomal protein S30	0.964	10-40	RAGKVKSATPKVEKQEKPKQPKGRALKRVKY
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGL5	Nascent polypeptide-associated complex subunit beta	0.986	20-44	SGPRANRNRGKGTPRRKVKKVHKSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHM8	TRP_N domain-containing protein	0.739	613-620	RRRREAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKJ0	DNA repair protein REV1	0.81	933-941	PTKKRRGRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ5	MRC1 domain-containing protein	0.942	260-277	ARRRLAKQARPPRKASKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ5	MRC1 domain-containing protein	0.81	218-238	KRKEREEKERLEAEKKAERAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ5	MRC1 domain-containing protein	0.786	550-559	IAKRERKSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ5	MRC1 domain-containing protein	0.784	812-820	KRAKRLRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL31	Casein kinase II subunit beta	0.902	331-342	AKRKKAPMRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN53	Uncharacterized protein	0.669	42-46	RKKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNW8	HABP4_PAI-RBP1 domain-containing protein	0.99	267-303	PRSGGGPGNGPRGRGGRGGRGARGGRGSGAPRGERGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNW8	HABP4_PAI-RBP1 domain-containing protein	0.835	105-132	RNNNREKPIEDGAQPPRRREGGGGRRDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNW8	HABP4_PAI-RBP1 domain-containing protein	0.681	245-253	AQRQKHRKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNW8	HABP4_PAI-RBP1 domain-containing protein	0.634	66-74	GKRDAPKEA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNW8	HABP4_PAI-RBP1 domain-containing protein	0.613	86-88	RRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP37	Uncharacterized protein	0.851	998-1008	RKRKEAKRRMK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPH9	Protein kinase domain-containing protein	0.92	21-35	RKREKEEKRRAKAEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPH9	Protein kinase domain-containing protein	0.884	395-413	SKAGMEKRRRRETPEAPKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPI3	RING-type domain-containing protein	0.762	121-131	HRATPPRRRRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQG8	Ubiquitin-like modifier HUB1	0.999	6-101	RSRSPGRRSGGDRDRPKKSGGFRWKDKRRDDNDRPEADERRLNRGYRERSPRRERESDRREDRNREGDRERSRPGGDDKDERKERKKEKKEKKKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQR7	Uncharacterized protein	0.924	203-215	KRRGEGKKRKHHG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRK5	Uncharacterized protein	0.915	130-158	RGRFKGPPLGRKLKKHPSTAHAIGKALAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRK5	Uncharacterized protein	0.665	799-806	AKRQRPSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTK5	MFS domain-containing protein	0.722	547-556	KRRLEGKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWT6	40S ribosomal protein S24	0.997	100-133	KIEKASRQQRKQRKNRSKKFRGTAKVKGPKKSKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYV3	Uncharacterized protein	0.664	15-25	KSIRGREGARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZW2	Uncharacterized protein	0.994	215-226	KKKKKKRSKKPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CB44	ThrE domain-containing protein	0.961	375-387	KPRRHKKKTHRKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI26	Transcription factor BYE1	1	125-158	KPWEEAAEKRRKEAEEKKSRRRKGKRGGRRGRPS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJX8	DUF4110 domain-containing protein	0.987	3-35	KKNKKSAEHKERVAAKQSKKAAQKEKKSKTKGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJX8	DUF4110 domain-containing protein	0.659	401-408	RPRAPGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJX8	DUF4110 domain-containing protein	0.616	337-339	RKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR46	Uncharacterized protein	0.845	133-158	KKPKLESVSDIKKRLAEHKAKKAEAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR50	Uncharacterized protein	0.875	961-984	REAEAKPDKKRFGLFKRGKLAQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS24	Uncharacterized protein	0.974	314-362	RARHTRGSPGPAEGPAESKLRVRVRRSKRPDQKPESSSRSSHRRSGKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS24	Uncharacterized protein	0.822	266-283	RTRRSNPRREKPDRPESR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1B6	CBF domain-containing protein	0.993	571-597	PTKGGKSQAGKKPGKFGKKGGKKSAKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1B6	CBF domain-containing protein	0.958	59-103	KQKSKNNKTKAGSNDSAKEPKQIAPKTDSKRGDAEKNKGKKRDRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1B6	CBF domain-containing protein	0.879	927-938	KDKDKTRKKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1B6	CBF domain-containing protein	0.795	1085-1092	RKKRRKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBY7	RRM domain-containing protein	0.999	55-95	EKKEKKEKKDKKEKKEKKDKEEKKEKKDKKEKKEKKEKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBY7	RRM domain-containing protein	0.995	17-35	EGKKAKRESKKEKKEKRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBY7	RRM domain-containing protein	0.993	143-158	KKSKKDKKAKKEKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBY7	RRM domain-containing protein	0.978	273-304	RKAKIEAKNKKLYEERQRNAKEQKKEKEKKKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC27	PCI domain-containing protein	0.907	199-226	KINRRYFARKPKKSPEEIEKLKKQAEER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDA1	Valyl-tRNA synthetase	0.755	16-28	RLKLEKFAKKKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDA1	Valyl-tRNA synthetase	0.751	43-49	KKHKAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CG01	Fungal_trans domain-containing protein	0.648	24-27	RRKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE8	Phospholipid-transporting ATPase	0.684	54-65	FHKRHESKSEKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHL8	Protein GCN20	0.954	133-154	SRVDKKKLEKAERKIRAKQEKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI91	Palmitoyltransferase	0.981	106-121	HRHSGRHRRKRSRRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKX2	Uncharacterized protein	0.604	16-16	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL63	MutL_C domain-containing protein	0.804	382-394	RPRAGKRRQGPRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNS0	BZIP domain-containing protein	0.892	329-366	PATKGKSKKAAATKSTGAANNRRKADDSAAKGPNKRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP07	CID domain-containing protein	0.608	796-796	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPB3	Cir_N domain-containing protein	0.996	165-320	RKSRSERSERDGGRERSHRHRRDSAEDSRSHRHHRRSHRHRSRSPAERSPERSSHRRRRDDYRDDRDRRDRNRRDDRDRDRDRKDRDHDRDRDRDDRDDRRSSHRDRDRGSPSPRRHSERRRDDDRSNGRRYDQDRRDRPYRPNDRDRRDDRARPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW29	tRNA wybutosine-synthesizing protein 2	0.807	24-32	DDKRPPKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXY8	Uncharacterized protein	0.645	72-75	RKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8B7	Uncharacterized protein	0.829	353-365	EPQRKLKRPRTRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8B7	Uncharacterized protein	0.639	339-341	KRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8B7	Uncharacterized protein	0.61	203-205	GRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFS6	Zn(2)-C6 fungal-type domain-containing protein	0.673	24-29	RRRSKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGI3	Uncharacterized protein	0.95	4-22	KAKHKNKSRGNAKKKTSGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLM5	Uncharacterized protein	0.98	289-304	SGKKKKKKQSRMRSPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNG1	Uncharacterized protein	0.702	555-564	KAKKAIAAKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPS3	Uncharacterized protein	0.777	714-725	NSPAPPRKHRRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTK1	Uncharacterized protein	0.804	159-176	KYRLKRGSRLKLLRRTLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8Q8	Uncharacterized protein	0.674	147-152	QRKKPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9B6	SET domain-containing protein	0.998	94-123	GPPPRPPRSPPPAPTPARRKKSKKSKKNPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9B6	SET domain-containing protein	0.998	502-523	GKGENKPKAKKKKKGKSAARPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA96	Ribosomal_L5_C domain-containing protein	0.951	73-95	SKAKGRKKQLPRSRFRSPKYDRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAR3	Uncharacterized protein	0.921	142-179	GRGRFAWGGRRRLQWLARRGRNGGGGGGGGLARRRVSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAR3	Uncharacterized protein	0.894	18-29	RRRRRHLRPRSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCK0	DUF4413 domain-containing protein	0.644	107-113	RREAKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD10	Zn(2)-C6 fungal-type domain-containing protein	0.629	65-69	PKGSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE47	Uncharacterized protein	0.999	120-223	PAAKKRKLSPASREAKQQEKEAKEKARLEERAKKEEERRAREEEKRKREAEREEEKKKREEKRKAREEEKAAKEEEKRKKEAAKEEERRKKEEDRLKKERAQPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGN7	Uncharacterized protein	0.677	108-119	RDRRGPPPGSER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIJ5	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.818	79-85	RGRKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJG0	Uncharacterized protein	0.899	232-246	RTARRRRREARLKEA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJX7	Uncharacterized protein	0.888	208-220	KRGKKRKSDEYKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJX7	Uncharacterized protein	0.746	223-235	VSPKKNGAKVRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKC3	Zn(2)-C6 fungal-type domain-containing protein	0.712	52-62	KPKTQKGRKAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQE8	Uncharacterized protein	0.952	185-196	SGQKRKRGRPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQE8	Uncharacterized protein	0.878	147-156	PRRRRGRPRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQT8	Uncharacterized protein	0.685	351-361	IRERRIERRNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT15	Uncharacterized protein	0.923	74-87	KRKAYRSKSRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT54	PH domain-containing protein	0.972	224-274	EPAKKAAEPKEEPKKEEAAEEAKKDEAAPAEEPKDEAKEKAKSRSRSRKRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT54	PH domain-containing protein	0.905	332-356	KEEQPKEEAKEEKKEEKKDDKKSKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUV3	Uncharacterized protein	0.672	90-94	VRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0U5	Velvet domain-containing protein	0.983	1147-1171	SGEKKRERRRTPPPAGKRTPSSRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0U5	Velvet domain-containing protein	0.873	1043-1061	AKDKGKPRRASGNRPVAPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0U5	Velvet domain-containing protein	0.632	253-255	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D4	Pex2_Pex12 domain-containing protein	0.918	198-214	RKRLAKERQKKKAEQEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA18	25S rRNA adenine-N(1) methyltransferase	0.886	4-49	KKSKAKTKKPMLLSHTRPPTVRPKAALSAKATRNLIRSHHRLLKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAL8	Uncharacterized protein	0.92	430-454	PRRRRRPDVIKLRRVGQPARGVRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAL8	Uncharacterized protein	0.68	353-358	PRKKAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCP0	Ribosome biogenesis protein erb1	0.687	252-267	KRRFVPSKHEAKRVMK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE4	Uncharacterized protein	0.996	160-219	ARRLRLIVLARPRLRRPRKAAPQTPVRRRERRLRVPVRRPRRVLCQRQRPHRRPRRAVHP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE4	Uncharacterized protein	0.944	107-139	HLQPPRNRILRKPLHKPLHIRRRIHHPPPARLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE4	Uncharacterized protein	0.628	100-103	PRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIB2	Uncharacterized protein	0.975	165-181	PRLDRKKEKRRQARRKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKS6	C2H2-type domain-containing protein	0.777	208-219	KRRVIKRGGKAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLZ7	MFS domain-containing protein	0.848	1379-1391	PARARARPRHRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLZ7	MFS domain-containing protein	0.762	511-523	KKSSRSRSKSGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM71	Uncharacterized protein	0.993	38-63	RRDRDRSRERERRRRDRSRDRRRGDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM71	Uncharacterized protein	0.966	78-105	HGSANGSHRSRKRSRSRDSDRHRRSRRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM71	Uncharacterized protein	0.949	140-165	SGRSRRDERDDDRRARRDRKRSPSRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVL1	Uncharacterized protein	0.878	122-132	PRRVRRKKERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVL1	Uncharacterized protein	0.749	32-44	HARGHRREPTKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0R9	Adenylyl cyclase-associated protein	0.943	354-375	KSPAPSKKPKPESMRVRKPPRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.988	979-995	SKKAKKKLEKEKKKAKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.987	1039-1052	KAEKKKKKKAKAAE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.979	578-590	AKKDKKKKKGKEP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.971	112-127	REHKGGKKKKKAAAAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.963	394-403	KKDKKKKKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.954	1365-1413	RERRVKRSNTAPKKAEPGGLMGLIGSLRRTARPEPSERPPERRKSRSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.952	1496-1514	REAEERRARRRERQKARER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.952	1527-1578	REERLREEKRARRAAREQRRAMEEQEAREAEARAEAKAAERRERRRQREAER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.943	885-914	ERIKALEQAKKDRLKEKAAEKAKAKEAPPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.937	439-451	KKEKRKAKKEAAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.929	193-211	KKKSKKKQKEEEEEMKRKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.919	1075-1089	PEKPTKKSKKRSTKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.918	1695-1707	RRELRRKARRRAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.917	644-657	KERKRREKTLKRKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.91	270-278	KKKNKKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.881	809-824	KPKATKKKSEEKPKAD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.881	1150-1206	APPPKKTASKEVRHSRREPSPQAMARSRSTKHSKARESENEAERSSASEKDRRREAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.866	492-500	KKKDKKKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.858	1472-1484	RRAARRAKRASRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.858	1625-1636	ERDKSRRRKSRI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.857	533-542	GKKKDKKSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.836	731-739	DKKKSKKNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.82	1429-1440	RRMRREERRRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.8	1281-1294	RRERERPHGSRRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.695	1126-1134	RSAKKERAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J6	Uncharacterized protein	0.679	1722-1728	RKREGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7K4	Uncharacterized protein	0.841	287-302	PKRRRRSSGSSKLLKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBG1	Uncharacterized protein	0.934	256-265	QRKKRKQRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCQ2	Uncharacterized protein	0.621	283-285	RRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEI7	ADP-ribose 1''-phosphate phosphatase	0.788	4-15	RGRKYRPAKKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMQ2	Mitochondrial import receptor subunit tom-20	0.63	40-45	KRNNRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNZ9	Zn(2)-C6 fungal-type domain-containing protein	0.666	59-65	KPKGSKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVZ0	Uncharacterized protein	0.998	558-591	GGRAGARRVRRRRARLRGAGVGRGGRRRRGHGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWD7	Uncharacterized protein	0.987	763-780	VSSKRKRPPRNRKRGGPL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWI2	ATP-dependent DNA helicase mph1	0.965	861-874	PKRRGRVPKKPPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWI2	ATP-dependent DNA helicase mph1	0.922	1017-1034	RPGNKKRLRKGRSGQPEP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWI2	ATP-dependent DNA helicase mph1	0.792	127-146	GPRWKKPDPPPPPPPAPTKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXL8	HAD_SAK_1 domain-containing protein	0.987	491-525	RRGGSYRGRGRGFGPRGRGHANRGGRGRGRGRDAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYA9	Uncharacterized protein	0.965	445-466	KKSRKHRKSRGSRSENARGNGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYE6	Tau95 domain-containing protein	0.621	202-203	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYE6	Tau95 domain-containing protein	0.616	244-248	KRGSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYJ1	Uncharacterized protein	0.647	346-352	KSKSRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0T3	Chitin synthase	0.98	732-745	QRSKRKRLRKPRRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D209	Fungal_trans domain-containing protein	0.765	34-45	SANARPVKRRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D209	Fungal_trans domain-containing protein	0.651	25-29	KRKAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9D3	Uncharacterized protein	0.976	751-763	SKVPRKKRRKPAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I6	Uncharacterized protein	0.946	308-319	RPKKEKRRTRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF07	Uncharacterized protein	0.747	143-150	KKRLSKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF07	Uncharacterized protein	0.613	291-293	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHN3	TPR_REGION domain-containing protein	0.769	122-129	RRRKARRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIV8	Uncharacterized protein	0.995	14-39	PGRFKRRKKNKNKKPAAAAAPAPAPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJD6	Protein BCP1	0.786	195-201	PQKKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJL9	Protein rho4	0.848	266-278	GGGRSGPKKVKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKU1	Polynucleotide 5'-hydroxyl-kinase grc3	0.707	76-93	SSRRKAEPSEIEKTPRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKU2	Uncharacterized protein	0.997	266-330	KGAEKEERKRKHHHTEADSSQAGVPRKKSKKHSESGEKAEGKENEKSKKSSKSKEEKKRKKSDKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKU2	Uncharacterized protein	0.697	223-233	KPPRKQPKNLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM67	DOC domain-containing protein	0.993	294-313	REVRHKKRRKRRGGVFGRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP66	acidPPc domain-containing protein	0.725	36-45	MRRKIRSKLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPX7	Transcription initiation factor IIF subunit alpha	0.946	407-430	EKKEKEARRVLGKSVRKALKRREK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPX7	Transcription initiation factor IIF subunit alpha	0.945	21-46	PMRIRRPRAADPLVRPKRKPVARPPG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP5	40S ribosomal protein S6	0.968	171-203	TKAPKIQRLVTPQRLQRKRHRIALKRRRAEAAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP5	40S ribosomal protein S6	0.931	218-237	HEEKAKRDELRKRRASSMRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP5	40S ribosomal protein S6	0.711	88-95	RTGERKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP5	40S ribosomal protein S6	0.614	136-137	KR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP5	40S ribosomal protein S6	0.614	166-168	GKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQR5	Uncharacterized protein	0.851	11-27	KAARLRRERREAKIKEG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSU8	OTU domain-containing protein	0.786	28-40	TQKKKSATKKTRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSU8	OTU domain-containing protein	0.749	121-133	QKKPNRQKARLAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTJ4	Brix domain-containing protein	0.964	378-404	QRKKEKEERKRQQKENIEKKKQAKVQA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTJ4	Brix domain-containing protein	0.861	231-251	GIPKRIRRLDPKEIRNKEKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTP5	Uncharacterized protein	0.925	80-105	IRRKMEADLNKKRHNPARAHRSRKAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW67	Uncharacterized protein	0.896	45-54	KRGGPRKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY50	Uncharacterized protein	0.91	384-403	PPRPRPGSRRVGVRGRRRFA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH1	PAPA-1 domain-containing protein	0.85	251-264	NRLLRKQAPKRRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH1	PAPA-1 domain-containing protein	0.833	226-244	RRAEMARRRKNLSEKRNEE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0S5	Uncharacterized protein	0.795	135-146	RRRKRNRGVAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C838	Methionine aminopeptidase 2-1	0.999	67-84	KKKKRKKSKKKNKKSKSG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9U4	Uncharacterized protein	0.843	817-845	GRVRSMRQRLRRTLQQRAEGKREARREKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDG3	RRM domain-containing protein	0.983	201-233	EGGSRRRRGGGGGRRAGGGGGRYRRSDVSKPPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDG3	RRM domain-containing protein	0.781	242-270	GERSPGPRASSGRRQGGGGGDGRRMVNGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDG3	RRM domain-containing protein	0.691	23-33	RGRRPQGRRND
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF28	Uncharacterized protein	0.652	311-314	KKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH49	Uncharacterized protein	0.934	176-197	RRVERKKPGHVKARKMPTWVKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH49	Uncharacterized protein	0.71	73-80	ARGKGKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJJ8	RRM domain-containing protein	0.988	72-103	PKPATATKTANARRGRRARRGGGRNTSRPKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPP9	DNA mismatch repair protein msh3	0.755	194-205	KGKAAAKKGGGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPU9	Uncharacterized protein	0.941	183-201	RRRRPGGTPKLRRKGLPRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSQ3	DUF2013 domain-containing protein	0.975	531-551	TKPKPKIKPLPPKTRRWRGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSQ3	DUF2013 domain-containing protein	0.638	673-678	RTRRAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTH5	Uncharacterized protein	1	165-204	RVGRKRLKTPLRRANRVQDVKKKKKKKKKKKKKNEQRKIR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU59	C-4 methylsterol oxidase	0.734	234-240	KRRREKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA55	Uncharacterized protein	0.989	397-434	KATRGGRYRGRGRGGRSRAGARFAGTRRGRGGTRTRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEZ6	Uncharacterized protein	0.722	44-65	RGRGWAPYRGRPYARGGRGAAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJD8	Mitochondrial division protein 1	0.858	141-154	KVHRRRISKGKKLL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJW9	Uncharacterized protein	0.998	836-871	KKTTTPRDTKRGRRKSSEKPKSGRKEKAKKEKQRHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKD9	Uncharacterized protein	0.81	269-283	AKRTWERRRFKPSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKD9	Uncharacterized protein	0.619	215-217	KPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM19	Calcium-transporting ATPase 3	0.829	355-370	SKKRPVKRGPNGETKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM19	Calcium-transporting ATPase 3	0.811	1121-1153	LRRRRGVEVRQAAVLPRARQKAAAARAGAHRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM19	Calcium-transporting ATPase 3	0.644	1005-1011	RRQPRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN64	Uncharacterized protein	0.638	72-76	PKKTP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNV8	Bromo domain-containing protein	0.844	466-481	RGRKAPGKSAAKKGTA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNV8	Bromo domain-containing protein	0.684	1079-1084	SKKKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNV8	Bromo domain-containing protein	0.618	1031-1035	KPRLP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNV8	Bromo domain-containing protein	0.609	131-132	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP25	Uncharacterized protein	0.917	374-422	AKRKRISPFAGWLRKKETPAVTGPKARKRDAEAEGSPGGPATKRTRGSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPF5	AMP-binding domain-containing protein	0.681	82-88	VEKKKVK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQJ9	Phosphatidylserine decarboxylase proenzyme 2	0.951	225-239	KRRRRMRLARLKRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQJ9	Phosphatidylserine decarboxylase proenzyme 2	0.848	764-779	KSREMEKKRIRKILKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTM2	Uncharacterized protein	0.999	442-524	TSLLKKALKRKESAKKKSEREWKERLEAVKKGKDMKQQKREENLRKRREDKGNKGKKPAAGGKKKARPGFEGSFKAKVGGKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTM2	Uncharacterized protein	0.993	126-157	ALKQKEEKQAQKTAEKKEKRKAKDAAKKAKLE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTM2	Uncharacterized protein	0.926	303-324	ARRQKAEQRKAHKKLLRQKAKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTM2	Uncharacterized protein	0.843	97-115	PKEGLKRGELKSKKQKQAE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTM2	Uncharacterized protein	0.828	37-53	KRKKQTKAEAREAKRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTM2	Uncharacterized protein	0.659	430-440	KKRAHGERVRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUW0	Cytochrome b561 domain-containing protein	0.95	576-590	REAKRRERRHSRRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUW0	Cytochrome b561 domain-containing protein	0.871	693-704	RRRRRAERARAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF2	Signal sequence receptor subunit alpha	0.898	199-215	KRKAGKPAEKKAAVAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF2	Signal sequence receptor subunit alpha	0.769	243-254	GARKVKGRSRTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS6	Uncharacterized protein	0.873	119-133	RRHHGRSGKRGHRRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS6	Uncharacterized protein	0.635	708-711	KSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZS8	ATP-dependent RNA helicase has1	0.677	10-14	KRKRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZS8	ATP-dependent RNA helicase has1	0.632	572-575	FKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J4	Uncharacterized protein	0.708	395-412	RKRSKYDRPLGLRRGSRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J8	Uncharacterized protein	0.829	6-13	KKKKKPAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J8	Uncharacterized protein	0.822	320-330	KPKKGKRSGRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAH6	Uncharacterized protein	0.698	587-592	KKRARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEA1	Uncharacterized protein	0.81	910-922	HKRKRESGRIRPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGH2	Non-specific serine/threonine protein kinase	0.941	481-502	KGPRRRASNRNSHRPRVAKRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGH2	Non-specific serine/threonine protein kinase	0.621	1062-1064	KKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH41	Enhancer of polycomb-like protein	0.669	238-246	IRKTRGRDA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH41	Enhancer of polycomb-like protein	0.627	250-254	EKLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHA7	Uncharacterized protein	0.722	88-94	DPKRKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKF1	DRIM domain-containing protein	0.999	2564-2614	KERREGRRVKRRIEAVAEPEKYEREKKRRNDRKREKRKERGMEHRGKRRGW
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN51	Uncharacterized protein	0.998	305-330	AKRKRDPVGKASSKKKRKTNPRPRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXB2	PX domain-containing protein	0.64	891-895	KRRVK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0X3	Uncharacterized protein	0.999	459-640	SYRPSRRSRSRSTTRGYDRDRDRDHDRNRSRGRYRDRSPDRHREREYDSYRGDRSRDRDRRERDRDRDVDRDRERERDRDRDREREDYRRRRSRSRPRYRSRSRRRSRSRSRRRERDRERERDRSRDHGRDRDRDRDREKERERDSEPGRTRERERSASRASASSRRRSRSRRRSRSRRRSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0X3	Uncharacterized protein	0.989	400-440	ADDRLKPRRRDSRSRSRRRSSRYEDDRRGSRERSARPRERE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0X3	Uncharacterized protein	0.987	192-276	REIEEEQKRRKAEEDRKQRELERKKEEEERARRREREEQRRAEQRLLDEQREKERQERYERRRREERERFRDYDRYRDRDRSRTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0X3	Uncharacterized protein	0.964	654-682	NRSRSPRRRVRSPERAERERERERERERD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0X3	Uncharacterized protein	0.952	716-731	RRARRSSPSRRRSRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1D4	Uncharacterized protein	0.688	293-298	RRKRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7W0	FACT complex subunit	0.961	1004-1026	KKAKKKDREGGLDDEDRGKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C835	Uncharacterized protein	0.949	238-255	RRPIHPPKNPKKEKEKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA86	BAR domain-containing protein	0.966	390-413	KKAPPPPPPSRAKKPAPPPPMKRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCG3	Glutamine--tRNA ligase	0.989	26-60	ELKKRMQKRAKAAAKAKAKADAPPPKPAAQQAPKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCQ1	AB hydrolase-1 domain-containing protein	0.639	705-709	RRAKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF83	Uncharacterized protein	0.99	215-272	SKKPEKPKAKLQNRITAAERRRSKNLGLDVVLGKEKQKGRGRGKKRETNDAKGGPSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF83	Uncharacterized protein	0.884	806-817	SPKRSKSKKMRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF83	Uncharacterized protein	0.762	156-166	QKEEARKKRVA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFD6	Uncharacterized protein	0.989	1238-1271	HRPARLHIRLLRRHRRNRLRRVEARHRRPPPGVP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CG43	Uncharacterized protein	0.8	408-421	RRGHRRLKSVKIRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGS7	FAD_binding_3 domain-containing protein	0.843	10-27	PKYRIPPSKRRLRLHRQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH05	Uncharacterized protein	0.639	44-52	KAKNDKAKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIX8	Uncharacterized protein	0.779	43-49	KKRGRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKZ9	Uncharacterized protein	0.997	171-194	RSKEPKMKAKTEEKKTKKKSKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP40	Uncharacterized protein	0.929	7-29	GRAALKKTKVPKPSPPRPGGKSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTY2	Uncharacterized protein	0.841	1548-1561	PYIKKSKPEKKEKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXG4	DUF1708 domain-containing protein	0.87	544-557	TRKRLGRRKSSARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXG4	DUF1708 domain-containing protein	0.689	756-761	KLKKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY97	Bms1-type G domain-containing protein	0.997	1105-1164	KQAKRAAKQEERRKEYRAKVAESLEKKAARERRERDEYWRREGKKRKNPEEAGGGGKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY97	Bms1-type G domain-containing protein	0.743	10-18	RPSKEKKKY
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1G3	Uncharacterized protein	0.987	757-795	ASRSAKRYRRDSRERDRSRGARRERDRRERTPAAEETKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1G3	Uncharacterized protein	0.6	672-672	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7E7	Uncharacterized protein	0.892	88-104	RLRPRHKHKHSKSRDGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG7	VASt domain-containing protein	0.982	1054-1070	PRGRGAGKAKGKSRRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG7	VASt domain-containing protein	0.743	79-85	RTRRKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG7	VASt domain-containing protein	0.69	600-608	RSRLARRRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG7	VASt domain-containing protein	0.61	228-229	RR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBG9	SEC7 domain-containing protein	0.646	451-454	RRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCN2	Uncharacterized protein	0.872	582-618	RKRTNSSHKREPLKPIQPRRSLKRTSMQSTKSRRLSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE13	Uncharacterized protein	0.603	418-419	KR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF86	Uncharacterized protein	0.894	119-128	RRMKTKRRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF86	Uncharacterized protein	0.659	97-101	KKRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGY7	COPII coat assembly protein sec16	0.799	1787-1798	RKGGTVKGKKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH56	60S ribosomal subunit assembly/export protein loc1	0.993	7-57	SAKGKADSKKSNPLASASKVSKKKAAKRPPPQEVKSKARTEASQLKKTKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH56	60S ribosomal subunit assembly/export protein loc1	0.926	130-159	KEAEARQAQKKSKLEEAKDSIRNKKKHKGD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH56	60S ribosomal subunit assembly/export protein loc1	0.793	79-86	KPKGKKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL37	Uncharacterized protein	0.989	678-701	NKIAKRNRIIAKKRMQRRTRKGKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL37	Uncharacterized protein	0.985	621-667	RAEQQAKVRAFKKDQQKGEKAPGGDQSKGKPSPKGQKRKRSDSTGGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL37	Uncharacterized protein	0.613	532-533	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLV2	Uncharacterized protein	0.998	907-998	DAEAPKKRRRRRNKPLVKLRILPPKKEEQNDANKAGEHAKESKKRPHSEVESGGTEERARKSPKLDEPKPWPQKIKIKRRSPETNKPKPDEG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLV2	Uncharacterized protein	0.988	752-769	AKHRKDAKPKESRKRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLV2	Uncharacterized protein	0.973	1045-1064	KQSAEERARKARRRSRKSTG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLV2	Uncharacterized protein	0.946	819-894	TPRSQKRVKDGKQSKTGSEAVGEKTAAEPPKTKERKPASQLKIKERKTVAETPKTKPSKDMSGSTKVKVPKNAPVP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLV2	Uncharacterized protein	0.782	790-797	RPKRRRKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLV2	Uncharacterized protein	0.656	571-581	KELREKYRREK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQR2	MFS domain-containing protein	0.754	483-494	RFLRLEEKRRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTR7	Intu_longin_1 domain-containing protein	0.996	399-413	PRRRKRRRRRGRAGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWA7	Putative transferase CAF17, mitochondrial	0.781	954-964	LKKHKLRAKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWS6	LisH domain-containing protein	0.963	619-641	KAAPKGKKDTKDTNRKRPKKAAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZM7	Uncharacterized protein	0.665	7-13	RRRTRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8R2	Uncharacterized protein	0.707	10-16	KKRPGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C999	Uncharacterized protein	0.817	243-254	GPKKSRSRRSKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9G9	Uncharacterized protein	0.631	141-144	RKSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC95	DNA polymerase kappa	0.636	521-523	RKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIW1	Elongation factor 3	0.997	978-1001	KKKKLTSSEARKKKKERMARKKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMF9	DUF2293 domain-containing protein	0.987	7-73	SSRKKISNSPAGRRKSRTRPRFSPRSLQSLRSPQPRKNSLAPRGGRGTGRRSPFGRSSKPAGNRSKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQM4	Uncharacterized protein	0.998	622-669	EKKKKKTPPGTKKSSKSKSGKKESKKSGLLSGSKKDKKSGSKSKSGKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQM4	Uncharacterized protein	0.825	437-459	RPKRSIHPPKRDLPYSTKPKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQM4	Uncharacterized protein	0.824	381-398	KKPKKVSPKTSAARREPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQX1	Uncharacterized protein	0.793	642-658	RRRARLRGEPPPPPRTP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV08	Uncharacterized protein	0.948	814-845	RRAHKPQAQKRRQQQLDKEKREKEREERKRQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWQ4	Uncharacterized protein	0.632	757-769	RSLAKSPGQREKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX95	C2H2-type domain-containing protein	0.966	489-518	KQHKEKKHGWQYVRTKSNGKRKDKVKGKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0V1	SCP domain-containing protein	0.779	61-73	RPPPPLRLRRPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1R5	Uncharacterized protein	0.627	191-194	KERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I9	Uncharacterized protein	0.992	913-924	GKKKRRKRRSKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I9	Uncharacterized protein	0.986	204-218	GSKKSKKGRKKGQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I9	Uncharacterized protein	0.971	56-65	RKKRRSKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I9	Uncharacterized protein	0.963	90-104	RKPTGKSKKGKKKDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I9	Uncharacterized protein	0.938	7-22	RDRSRSRSPRKGKSRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I9	Uncharacterized protein	0.852	1005-1016	RRRRKERSSSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I9	Uncharacterized protein	0.846	511-523	DERRQKRRAERRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDP8	Uncharacterized protein	0.868	132-146	RPGTRSGRRPRRSRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGK7	Structural maintenance of chromosomes protein 5	0.774	1161-1176	KRKRALNEKQGGKGKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHL0	JmjC domain-containing protein	0.67	561-565	RKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI78	Uncharacterized protein	0.826	27-38	RRRKPSVRKRDI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI93	Uncharacterized protein	0.981	359-384	RRSRALEPRERERSGRSRRRVSRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI93	Uncharacterized protein	0.97	431-513	RPRRRRSHSRPRPRDLSPGKSTSPKDIPGRPDSVKKPDSASPDAPPKGILKPPRDKFPEEPNPIREGVAPLKDAHKKGIPPGA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI93	Uncharacterized protein	0.889	574-587	ERRRRREEDRRRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI93	Uncharacterized protein	0.814	308-317	RHRHRRHKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKC1	Abhydrolase_3 domain-containing protein	0.629	247-249	RRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ7	Uncharacterized protein	0.842	483-501	GGGRRYWGRPGRPPKSPPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ7	Uncharacterized protein	0.701	233-245	KRKPLDKGGRGPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLD9	ATP-dependent RNA helicase DOB1	0.944	382-395	AKRKGKGKDKKINK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLD9	ATP-dependent RNA helicase DOB1	0.882	23-33	KRSKKDKSKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLW4	Uncharacterized protein	0.857	361-368	EKKKPKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU32	C2H2-type domain-containing protein	0.974	62-80	RHRKSAKPKRRGRYGTPKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUN6	Uncharacterized protein	0.96	550-593	QSRKQSPRTSPRRMVSPPPPTRRHSRLSPRRLRSPPPPVKFKSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUN6	Uncharacterized protein	0.952	677-708	KKRQKRKEKFWRQHCRKAAKEQMERRPIPGKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUN6	Uncharacterized protein	0.633	446-450	RRRWP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D178	G-patch domain-containing protein	0.953	288-298	DKKKKKRAKSE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D178	G-patch domain-containing protein	0.904	236-254	RRLRVPEKPKPPRTKEPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1X5	Uncharacterized protein	0.84	177-196	KRLSKKEREREEEIRKKLRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGY5	GAR domain-containing protein	0.672	974-980	RSNRPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHD2	Uncharacterized protein	0.945	339-354	VKPKYKGGKKKTRPAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLK1	Pyruvate carboxylase	0.654	982-986	RNRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLS2	Protoheme IX farnesyltransferase, mitochondrial	0.744	113-119	RRRKRLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPK4	UBC core domain-containing protein	0.821	796-803	KPKGRRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPL9	Uncharacterized protein	0.959	62-151	GPAPKKPAPPKRGDVPPPAPKEPQPQPEDGPHGKRGDVPPPAPKGPKQDGAHPKRGDVPPPPKGEQPQPQPQHPKRGDVPPPKGAKPQPQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUA7	Homeobox domain-containing protein	0.739	182-190	KNDKKKMKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXU3	Uncharacterized protein	0.623	417-419	KKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXU3	Uncharacterized protein	0.603	32-33	KR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYI5	Uncharacterized protein	0.893	119-130	KAPPKRRGRGRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0K8	Phosphoinositide phospholipase C	0.757	766-776	KRERKGRQKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9E8	ATP-dependent RNA helicase mrh4, mitochondrial	0.686	190-195	KKPKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9E8	ATP-dependent RNA helicase mrh4, mitochondrial	0.607	601-601	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9E8	ATP-dependent RNA helicase mrh4, mitochondrial	0.601	47-47	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J0	Uncharacterized protein	0.934	120-141	NGKGSRRRERIRSPSRERERTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAL2	DUF1996 domain-containing protein	0.627	476-480	HAHKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCS1	Uncharacterized protein	0.933	453-467	ALKRAKREKKRTASK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCS1	Uncharacterized protein	0.85	163-181	RRAKKKAEDNREKKAAEHA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI83	DUF3591 domain-containing protein	0.674	997-1007	KERRFAREKQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPM6	Uncharacterized protein	0.818	159-167	VRRRKRWKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPM6	Uncharacterized protein	0.705	140-146	RRRLKRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPM6	Uncharacterized protein	0.617	31-39	RHIRAGVRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRU8	Uncharacterized protein	0.925	12-35	TKKNSIKKNPTKRNPTKRNPTKRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU66	Chromosome segregation in meiosis protein 3	0.844	83-98	PKLRRSAKQKLKFKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXH4	Eukaryotic translation initiation factor 2 beta subunit	0.963	105-113	KKKKKKSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXH4	Eukaryotic translation initiation factor 2 beta subunit	0.928	73-82	SKKKKTKKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0W0	Transcription factor iws-1	0.994	116-171	GRHKRKRTGDEADGERSQRKREGRREKKSRRMRELEDAGSDDEGRSRKKDRKKRRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0W0	Transcription factor iws-1	0.831	197-208	ALKKPTKRRFRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0W0	Transcription factor iws-1	0.635	449-454	QKGSRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0W0	Transcription factor iws-1	0.611	187-188	RR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0W0	Transcription factor iws-1	0.602	444-444	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D152	RNB domain-containing protein	0.855	369-379	KKEKEEKKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D152	RNB domain-containing protein	0.634	35-44	RGRGGPPGGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z9	Uncharacterized protein	0.796	844-860	KTELKRERKGAMRELRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z9	Uncharacterized protein	0.634	907-913	RMRQGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7X6	Uncharacterized protein	0.629	100-102	RKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8L5	Zn(2)-C6 fungal-type domain-containing protein	0.747	449-458	VRRRIRRIAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA92	Uncharacterized protein	0.96	101-123	RKLLARFREENGKKKRPVEKRKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBS9	Zn(2)-C6 fungal-type domain-containing protein	0.897	15-28	PKRRRIRPSRARGL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC08	Uncharacterized protein	0.996	583-790	PRPKEKERAKELRAEAKKAASAKKTSRKSSSTRRRIGAVLDGPTSRITKTRKRVTSRSIKSGVKKAISRVRGAAKATTSRRTTAQKAKDDAKASKKTGTTTRAPRRRANKKESNEKVKLPRVRATKARATVRVRKPAQKNEKTEAKATPGQLTRPSEKTKARILATVKGANARKRTTTNKSPAKQSPRANASTQRARTTSRSPRKPKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC08	Uncharacterized protein	0.736	212-234	KRSRGAVEKGKDDSRRASLRPRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC08	Uncharacterized protein	0.651	314-322	KRRSISGAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCA9	J domain-containing protein	0.986	458-474	KKDKEEKKKKKKESKHE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCA9	J domain-containing protein	0.895	219-227	LRKKGKKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB9	Uncharacterized protein	0.641	107-112	RREAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF52	Ribonuclease P protein subunit	0.971	49-78	RSRRRLHRLRKKEYFLRKQKPRPLSAREKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGS2	Uncharacterized protein	0.988	1062-1086	KFKARKKKKLTRAQLKEREARRRLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU78	AZUL domain-containing protein	0.967	758-820	PRLRRKGPAPPRRENAHNTKNHIKQRQRVRNQPPHTAHARHRTEHARRAIRAPPDRRGRQKIP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUP6	Eukaryotic translation initiation factor 3 subunit A	0.991	799-919	KRHEEFEKRRKAAERDFEAKKKQRVKEVQERRRREKMEREMAERQRKEEEERAQREEEEKRARDEERRRVLAEEKAKREEERKRLDEIAAKQKQREEEAEARRAARKAGLEPAAPAARPEP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVL2	Uncharacterized protein	0.976	137-157	EEQRRKRNSKATKEKRKRESL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVL2	Uncharacterized protein	0.773	215-222	KREVKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVL2	Uncharacterized protein	0.761	166-176	RAGVSKPRKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWQ0	Uncharacterized protein	0.771	690-700	HEKHERRHRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZY7	Mitochondrial distribution and morphology protein 34	0.978	358-378	RHSKAHARKRKKRVVDLRRPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE06	Telo_bind domain-containing protein	0.91	1263-1274	RGSRRGRKSRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE14	Structure-specific endonuclease subunit slx1	0.861	298-310	RKKARSDKRKAAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE14	Structure-specific endonuclease subunit slx1	0.66	103-109	KRRQRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHD4	Zn(2)-C6 fungal-type domain-containing protein	0.678	723-727	KKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMM8	ATP-dependent RNA helicase dbp10	0.997	852-928	KRFRHHKDQAPKRADPLRDDFYKKKKKNEAAKERQMSRAGGAAAGGKSEIKNTDDIRLARKLKQKRREKNARPSRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMM8	ATP-dependent RNA helicase dbp10	0.808	352-359	KNSKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMM8	ATP-dependent RNA helicase dbp10	0.677	822-827	KKSKRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNM2	Ubiquitin carboxyl-terminal hydrolase	0.669	588-592	RRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPL8	Uncharacterized protein	0.999	513-538	KKKLQREKKRMKKRNRRQAKKDKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPW8	SPRY domain-containing protein	0.987	55-82	RSKRNKRDSRKKREAKGLDPEAAPPKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQV2	Uncharacterized protein	0.791	366-373	ARRRKRGA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS46	GCS light chain	0.882	410-432	RAHRVLLRRKLRGPHPRLARLHP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS46	GCS light chain	0.702	518-525	RGRRGQRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS46	GCS light chain	0.66	325-332	ARMRAPKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUN9	Uncharacterized protein	0.919	631-644	EVGSSRRKKGHRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV00	Uncharacterized protein	0.956	334-344	APGKRGRKRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV00	Uncharacterized protein	0.937	266-277	REPKKKKIKRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV00	Uncharacterized protein	0.908	173-181	EKKRGRKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV00	Uncharacterized protein	0.852	211-222	KRRGRPPKNAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV41	Uncharacterized protein	0.75	249-260	RPKTKPRIPPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CV41	Uncharacterized protein	0.743	21-38	PRDTKRDKPDATPRPRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXD1	tRNA wybutosine-synthesizing protein 4	0.807	463-472	KKKAEGKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1H4	Nop domain-containing protein	0.982	310-324	KPSRKRGGRRARKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG6	Uncharacterized protein	0.985	583-597	AMKKINKKRRKKERE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG6	Uncharacterized protein	0.678	428-432	RRKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG6	Uncharacterized protein	0.632	333-336	KFKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCT1	NFACT-R_1 domain-containing protein	0.9	141-164	AKRREERKTREEQRAREKQEKRER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD84	Polynucleotide adenylyltransferase	0.719	964-972	KKKQKKGAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK19	Uncharacterized protein	0.991	206-238	KKWPRPRKSSISGARKPKHERSKSKEYGRRPSL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK19	Uncharacterized protein	0.823	315-345	RIARRFPRDSKDCRPRPRTVRSRLIPTPRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKR8	MI domain-containing protein	0.997	28-63	KKNRRNTPAARKDRRRAERAEKKTKRAPVSKKGRSQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKR8	MI domain-containing protein	0.885	772-782	QKGKKGKNKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKR8	MI domain-containing protein	0.878	102-117	AKQKKDKPKSILKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKR8	MI domain-containing protein	0.826	190-206	RKRKREADEWLRSKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKR8	MI domain-containing protein	0.732	157-165	LGLKRGKKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNX1	ATP-dependent RNA helicase dbp8	0.872	517-527	GRKRNKLKKVR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPD0	Uncharacterized protein	0.999	64-86	RRRIAKKKKRNAQKKKKKNKGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSJ8	Uncharacterized protein	0.87	179-196	RQPKGPMKESKRKMRPPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT45	Mediator of RNA polymerase II transcription subunit 19	0.919	401-409	GKKKRKKVG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT45	Mediator of RNA polymerase II transcription subunit 19	0.629	364-369	PSRGRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT45	Mediator of RNA polymerase II transcription subunit 19	0.62	335-337	KKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY52	Uncharacterized protein	0.703	137-143	KRKLRRW
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEQ6	TAFII55_N domain-containing protein	0.993	55-104	DAKPKKKKPSSSKKRPADEPALKEPSAAAPPSQPTGPKRLKLNASKKPGV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFY2	Ubiquitin-like domain-containing protein	0.905	42-51	GRERRKRRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGM5	Serine/threonine-protein kinase sid2	0.66	244-248	LRKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ3	Plus3 domain-containing protein	0.929	49-65	RKGTAKPVRRGRKVRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ3	Plus3 domain-containing protein	0.882	208-231	KRQREQKGKRDELRRREPAVKEKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKQ3	Plus3 domain-containing protein	0.874	160-174	REEARQAKKNKRKAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQB2	MFS domain-containing protein	0.628	433-435	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSX4	Uncharacterized protein	0.992	513-576	PNPRPGRGRGRGGWQSRARSPPSRPKPSSNPRGSQRGGRSGGRGGGKRGGGGDAYRPMPSAAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSX4	Uncharacterized protein	0.629	43-47	RKRQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH9	AAA domain-containing protein	0.788	925-932	RKGRRKKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1E1	60S ribosomal protein L35	0.804	86-111	PKLTRALRRRLTKHEATLKTERKRKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA10	Uncharacterized protein	0.868	1107-1115	KKPKPKRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAD4	Uncharacterized protein	0.724	845-855	RTKARISRRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAD4	Uncharacterized protein	0.638	630-634	KQKKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDY7	ULP_PROTEASE domain-containing protein	0.995	804-836	PKARAARRVDSKNSRGLKASPRKPLRKSKRRPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDY7	ULP_PROTEASE domain-containing protein	0.991	375-394	MPRQKRDKLSKKKSKKGKGL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDY7	ULP_PROTEASE domain-containing protein	0.804	1163-1176	AKRSPKSSKNKSKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE77	Uncharacterized protein	0.713	32-47	PRGPRNSIRRPEPIRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE80	Uncharacterized protein	0.916	372-383	KKKSKDKKPKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEL1	Methyltransf_11 domain-containing protein	0.748	970-977	RKPQRKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE7	Uncharacterized protein	0.984	1995-2086	APKSENSKGASKRKRTDSPSSDTQKPSKKGSEKHPPPNAPTGPKNQRRKIDANVPPSMERPPRPPQRPGNGVRPPMMRKKKEVDPFIRPKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE7	Uncharacterized protein	0.943	952-969	QAFREKREREREAKKKRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGE7	Uncharacterized protein	0.892	917-948	AKKKAEKATRVEKAARALPAIPKPAPAPLKSN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH66	PH domain-containing protein	0.76	104-114	RPRRKSMQKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CML8	Uncharacterized protein	0.804	79-98	KKQQEKEKARRAALGDKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CML8	Uncharacterized protein	0.68	148-153	RKRQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMS1	RRM domain-containing protein	0.99	510-546	GNRGGKPEGGSSRGRGGRGSKNKGGTKKEGEGKAEGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMS1	RRM domain-containing protein	0.983	203-257	KEKKANKAKDGSGKSKHRGDKDGKSEKVQAKKLLQRSDKDGEKSEKKSSKTDKAT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMS1	RRM domain-containing protein	0.837	318-332	SGGRRRGGKGGGADP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMS1	RRM domain-containing protein	0.829	30-42	PKKAPKPPAPRLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMS1	RRM domain-containing protein	0.741	345-355	ESGKKDRKGGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMS1	RRM domain-containing protein	0.618	487-490	GRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSN3	Uncharacterized protein	0.926	487-504	RKKGRRGRQNIGQKKRVR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT49	Uncharacterized protein	0.997	229-250	RISRKEKKRLRREKKERKKQAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTQ8	Serine/threonine-protein kinase ssp1	0.905	273-310	RQKVAIKIVQRYSKRRRLGKLGNPEDKVKKEVAILKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D019	Signal recognition particle subunit SRP72	0.988	638-648	ASSKKKKKGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D019	Signal recognition particle subunit SRP72	0.961	552-608	ARKRSSNQKDGHAAKRVRKSRLPKDYDPNKKPDPERWLPLRDRSTYRPKGRKGKQRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1N2	Uncharacterized protein	0.986	270-292	KQRRSTDATKKRSAKKPRRTKKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C954	HNHc domain-containing protein	0.831	115-131	KRKFKGRDRSSSKIPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9R2	Structure-specific endonuclease subunit slx4	0.932	77-98	PRGPPSKTSERREKREKKVERS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9R2	Structure-specific endonuclease subunit slx4	0.827	114-133	LPQKANAPKRASGSNKKRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9R2	Structure-specific endonuclease subunit slx4	0.613	320-321	RK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBH8	Uncharacterized protein	0.924	30-42	PSKKALRKAKKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBH8	Uncharacterized protein	0.876	263-273	PKKSKKPRQKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBH8	Uncharacterized protein	0.624	298-308	KRFGKDGEGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD24	Aa_trans domain-containing protein	0.86	178-198	RRRPSERTPLLRARKRSRVGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDU1	Uncharacterized protein	0.662	221-226	MKRRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN63	Uncharacterized protein	0.853	181-194	QPAAHRRERSRRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN63	Uncharacterized protein	0.788	8-22	QKKPRSTVKDKPRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQF1	Uncharacterized protein	0.977	471-503	KKEQAEKASAVNKPRSRKTGPRKKGPIDPGMKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQF1	Uncharacterized protein	0.803	850-859	SARRGGRKKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUJ2	Uncharacterized protein	0.979	1009-1026	KAEKKKKKKGAAATEGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXK4	Phytase-like domain-containing protein	0.974	26-55	TKSKGGAGTKRKEAAQKGPEPKKEKKEEHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0T8	ANK_REP_REGION domain-containing protein	0.89	446-457	ERKRAFRKKQRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D145	Endopolyphosphatase	0.982	428-440	KEKKGGKKKKKPD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D145	Endopolyphosphatase	0.824	353-361	KKKRRFLKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D145	Endopolyphosphatase	0.782	547-554	KKKKHKNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBI3	Transcription elongation factor Spt6	0.987	74-88	AERRREKRKRRREER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBI3	Transcription elongation factor Spt6	0.639	121-125	RLKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD77	Pre-mRNA-splicing factor CWC24	0.891	309-318	KKRERARKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD77	Pre-mRNA-splicing factor CWC24	0.824	17-30	KKRSAKAKANFRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD77	Pre-mRNA-splicing factor CWC24	0.82	53-60	RRIKRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDM2	Mitochondrial proteins import receptor	0.997	75-100	PTEKKKSKNQRRKEKKKAEEEKKAKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDM2	Mitochondrial proteins import receptor	0.717	253-268	KVAERKAKAILEAKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF76	Uncharacterized protein	0.686	555-560	HPKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGJ1	Eukaryotic translation initiation factor 4C	0.935	3-16	KNKGKGGKNRRRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH22	Uncharacterized protein	0.86	178-187	KKRKRALKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH22	Uncharacterized protein	0.749	41-63	RREKLREQLKDQHPKVSSKKQKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH81	Uncharacterized protein	0.928	210-225	KAPPTRKKRRIPRSGT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI85	FK506-binding protein	0.978	278-319	KGKNKRAAEEEKKEEESKKQQKKVKKNNGEPAPAEQKKEGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIH6	Uncharacterized protein	0.698	220-226	KRSKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK85	Uncharacterized protein	0.639	438-442	PKRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKB2	Mitochondrial Rho GTPase	0.977	408-421	TRPRKRRRRPGRVG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ46	Nitrogen permease regulator 3	0.981	220-232	LGRKKKKKPRAER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ46	Nitrogen permease regulator 3	0.733	44-52	AKKARRASR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSI9	Transcription initiation factor IIE subunit beta	0.977	255-278	KNKVVKARPKVEQKKVKKPRRSGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW21	General transcription and DNA repair factor IIH subunit TFB4	0.987	353-363	ARKKKKKKARA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXM1	Zn(2)-C6 fungal-type domain-containing protein	0.735	23-28	VRKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZJ1	DUF155 domain-containing protein	0.907	195-219	RRRKIPPEKAKSYAERLPKARRAEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1K3	Pre-mRNA-processing ATP-dependent RNA helicase prp5	0.979	79-151	RPIRRDRSRDRRRSRDRGDDRDYRRRSRERDFRCRRDDSRDRARRRADDSTDLKHKSRRDSSRDRPKDSASRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1K3	Pre-mRNA-processing ATP-dependent RNA helicase prp5	0.945	32-69	RTKRDDGRSYRRSRSPERRYRERDRESYRRRERSIARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1K3	Pre-mRNA-processing ATP-dependent RNA helicase prp5	0.678	489-493	AKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Q9	SAS4 domain-containing protein	0.999	461-511	PSRRLPPRQQGLRLRRPLLPRRRRPLRRKQLRRTPGHQRRRRLGRPPAPAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Q9	SAS4 domain-containing protein	0.953	429-453	RRRKATQDRKGPPRRPPPHPHPLRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Q9	SAS4 domain-containing protein	0.76	41-53	PATSSPHRPRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Q9	SAS4 domain-containing protein	0.635	34-38	PRRPS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C811	Uncharacterized protein	0.944	405-422	RVGGQRRRLRKKWVHRKM
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C811	Uncharacterized protein	0.794	156-170	KKKAIRDHNRKKAIK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C811	Uncharacterized protein	0.728	283-289	RPKKHKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8T4	Uncharacterized protein	0.644	107-113	RREAKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C945	Uncharacterized protein	0.925	158-177	RRAYKRRRSWGAGRGKHRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDA8	Uncharacterized protein	0.973	31-73	ARGKPYQAGVPGASREFKPRGRGRGSTEPRGGRGRGRGAGAGP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDA8	Uncharacterized protein	0.742	1043-1058	PAKVSKPEASVARKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDA8	Uncharacterized protein	0.646	1203-1208	KFRKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDN5	Uncharacterized protein	0.952	11-35	EKLAAAKKRVAQLQKQKKKANKKAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJQ9	Uncharacterized protein	0.964	376-456	RRSRRSRARGSSRAHTRVDEPRSTRSFFGRSKAPSQAPSRAPSKSASKAPSRVPSHAPPRAESRHSSKEDKPKEKTKRSSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMJ7	SAM_MT_RSMB_NOP domain-containing protein	0.976	357-373	KPAPTKKPLRGKKRKQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMJ7	SAM_MT_RSMB_NOP domain-containing protein	0.632	471-474	RKWK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP58	Uncharacterized protein	0.945	478-499	PAGGESPGSKPEKRKYTKRKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP58	Uncharacterized protein	0.935	414-463	VRRRGPGRPPKDGIMSKRERAELAREQKLAAKREANGGVTPPPANRAKAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP58	Uncharacterized protein	0.775	530-538	PVKKRKPSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP58	Uncharacterized protein	0.742	639-645	KEKKRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ89	Rab-GAP TBC domain-containing protein	0.893	117-145	PGSRPGSRPGSRPGSRWSERKFGLRPKRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ89	Rab-GAP TBC domain-containing protein	0.799	841-851	KVHRRKKFHKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ89	Rab-GAP TBC domain-containing protein	0.698	527-547	ARKKEWQREDKWTKMAKPTRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT11	Probable ubiquitin carboxyl-terminal hydrolase creB	0.991	579-620	QSRKERAKEEKERKAAEKERERQRRKEQEATRKEQEARAREN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT11	Probable ubiquitin carboxyl-terminal hydrolase creB	0.656	662-668	LSRLKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUX1	UDENN domain-containing protein	0.964	140-148	RGKKKKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVV9	J domain-containing protein	0.997	291-365	RIKKFRKAARADKDKKRLEKEAEAKRLAEEKEKARLEEEQRKKEAEEAAKADREKAKKAKEAAKNAAKKNKRVLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVV9	J domain-containing protein	0.902	256-272	KRHVEKKNANARRKRKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVV9	J domain-containing protein	0.886	120-136	IKRAHRKKVLRHHPDKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX77	Alpha-1,3-glucosyltransferase	0.666	11-14	RKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z2	C2H2-type domain-containing protein	0.749	479-489	KRKKHERQRSL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z2	C2H2-type domain-containing protein	0.706	317-328	RKGHVGSRRRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z2	C2H2-type domain-containing protein	0.684	887-894	KVKKTKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCM6	U3 small nucleolar RNA-associated protein 25	0.978	4-23	PRGKGPKRHAKGSRAPVKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCM6	U3 small nucleolar RNA-associated protein 25	0.967	91-110	KGPARKKRKVEHKEEKVKKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDB5	T5orf172 domain-containing protein	0.871	27-41	KKRRDSRMRPKKQTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFX3	Uncharacterized protein	0.663	299-305	KERYKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGI1	Uncharacterized protein	0.785	1416-1428	GLRPKEDKRKTKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHZ9	Protein kinase domain-containing protein	0.71	478-489	PPPGRPRGATRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHZ9	Protein kinase domain-containing protein	0.689	541-550	RKKGRDRSPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJ12	Uncharacterized protein	0.819	467-477	GRQRQKKARRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLJ7	Uncharacterized protein	0.962	328-340	PRAPKPKSRRKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLJ7	Uncharacterized protein	0.863	546-559	PKRDRKKEREERQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLJ7	Uncharacterized protein	0.699	581-592	RSRARAARNARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNV0	Protein kinase domain-containing protein	0.608	433-434	HK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNV0	Protein kinase domain-containing protein	0.606	430-431	KP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQN4	Iron sulfur assembly protein 1	0.975	124-140	AKPAEKPRRKLRPRKAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR52	Uncharacterized protein	0.744	310-318	RKRSLRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT58	PHD domain-containing protein	0.995	194-219	PPSKPAPKSRSRRKSARAMRAAKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT58	PHD domain-containing protein	0.8	314-378	KRSSRLAGKAEKERQEREAAEAAKKHEAELIAARKEEEKQKKMETERQVRVMTREHRIKERERKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0I8	Uncharacterized protein	0.993	6-48	RTAREGHGRRRKNFKERRSRKECKRKVCGEKEGGRARGRERGE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7R1	Glyco_transf_28 domain-containing protein	0.813	855-860	KGKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBI4	Protein kinase domain-containing protein	0.746	372-386	ESSHPKPPPKPAASK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBI4	Protein kinase domain-containing protein	0.6	370-370	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDH9	Uncharacterized protein	0.617	123-126	PRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIV2	Uncharacterized protein	0.737	43-48	IRKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKE7	Uncharacterized protein	0.694	149-157	PAKPRIPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKY4	Uncharacterized protein	0.974	80-113	RSRKSGRIHKRHSNRKNRSSIVFQTKPKKGSKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP23	Ribonuclease H2 subunit B	0.991	365-400	RAEKKRRKEAEEKKKKAEQSRGVRELKKVDTSGMKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP23	Ribonuclease H2 subunit B	0.753	406-414	GKAAAKKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPQ3	Ribosome biogenesis regulatory protein	0.994	184-217	KGSSIRGMSRAERKERIKRNERKMRANERKARKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPQ3	Ribosome biogenesis regulatory protein	0.825	104-140	PTPKPPTKWELFARKKGIGKYNTRPGAALADKERRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR31	NAD-dependent histone deacetylase SIR2	0.71	337-349	KRKRSSNGNHKGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTD3	Zn(2)-C6 fungal-type domain-containing protein	0.677	164-171	KAGKERKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX96	Peroxisomal biogenesis factor 6	0.954	14-30	KRRRRNVGRKRLRSRAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX96	Peroxisomal biogenesis factor 6	0.932	1376-1396	KGKAKQGGPPVAKGKGKGKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYA3	Zn(2)-C6 fungal-type domain-containing protein	0.661	58-64	RDRKHPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D169	Fatty acid hydroxylase domain-containing protein	0.952	264-280	AKRKRREGQQRLRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D169	Fatty acid hydroxylase domain-containing protein	0.783	39-48	GKKRGKIRLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D6	Uncharacterized protein	0.969	184-272	KRRTGMRPPIPTPEPKTVPAKRPAQEDKPQKKPEPEPKKEESGSEKPSKPSTRESTPASSKPTEKTAPAKREKGSLFSSFAKAKPKQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D6	Uncharacterized protein	0.843	372-384	GRRRGKRQVMKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8F7	AAA domain-containing protein	0.994	521-536	EKQTGDRKKKKKRKKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8F7	AAA domain-containing protein	0.908	211-228	QGEENPKKKSNNKRKSGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8F7	AAA domain-containing protein	0.864	90-100	RRKRRKTDRHS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8F7	AAA domain-containing protein	0.855	259-286	KRRHAPTNPPKPAPPPVKKDEPPKPTHP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCW4	Uncharacterized protein	0.78	28-44	AKQREAKKPLPRFNPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFR7	Splicing factor U2AF 23 kDa subunit	0.622	187-191	KERGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA9	Uncharacterized protein	0.999	70-97	RQRVMAKWPNKRRRARRRRRAARARSRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CID5	Uncharacterized protein	0.965	562-581	PEAKKKKKLFSFGRKKKDQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJW0	Uncharacterized protein	0.805	1534-1547	RGGGRGGGGRRGKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJW0	Uncharacterized protein	0.796	638-648	RKEKRHKSKSG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJW0	Uncharacterized protein	0.714	1623-1632	GGGGRGRGRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJY3	Uncharacterized protein	0.72	105-122	GAGRRTSPRATLRPKPHH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK87	mRNA (guanine-N(7)-)-methyltransferase	0.981	47-73	PPAEHPLPKRRRMEERHQKPRRRGRTP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK87	mRNA (guanine-N(7)-)-methyltransferase	0.913	113-125	QARKRKRPGGGAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK87	mRNA (guanine-N(7)-)-methyltransferase	0.875	624-635	KQKERRRARRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK87	mRNA (guanine-N(7)-)-methyltransferase	0.703	281-288	RGPRGRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK87	mRNA (guanine-N(7)-)-methyltransferase	0.626	957-960	RRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKN4	WD_REPEATS_REGION domain-containing protein	0.993	621-677	PPHKPPLHRTPSPPAMRTRKHPQRRIPRPRILQRNPPPHRGRRIRIQKFRVAVRRHR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKN4	WD_REPEATS_REGION domain-containing protein	0.98	367-391	LEEHDRKMAKKKKLRGSGWEKRLRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKN4	WD_REPEATS_REGION domain-containing protein	0.672	351-357	KERERRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP15	Stress response protein nst1	0.999	462-597	KNAKKAREAEKRKEKKRLQKQAKEEEKARREAEKAAEEAAAKAEQEKKLEEQRRKREEQRKKREAERKAQEEERARKEAEKQRRLREERERQAEAERKHREQKEQEKKKREEARRKEREERELREKKAKEERERKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP15	Stress response protein nst1	0.998	86-102	SKPSGRKKKKKAKKGRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP69	Peroxin/Ferlin domain-containing protein	0.82	256-273	RRRRWVRLRVKRAPERSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR33	60S ribosomal protein RML2, mitochondrial	0.97	75-128	GIRHLRRPINDHLWKGRPVHKLTFPKRGHAKGGRNNSGRVTIRHRGGGHKRRIR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR33	60S ribosomal protein RML2, mitochondrial	0.92	353-401	GRGKSKGNVDPKSPWGLPAKSGYKTRPKWKINKAVVVPRVRNQGKRRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS26	PALP domain-containing protein	0.97	232-249	AGRRDHPPRRRRAQRRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT14	DUF2235 domain-containing protein	0.737	294-299	RPKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTE8	Uncharacterized protein	0.936	718-730	PKKRGRKAEKKEL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW18	Uncharacterized protein	0.943	6-24	KKPDHTVKRRKKSKADRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW18	Uncharacterized protein	0.632	213-216	GKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW66	EH domain-containing protein	0.952	58-113	SSPLRHTLRSPAKMKEEMKNDHRHHHRLLPHKHPHKHHEGDRKRWREEITEKARKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW66	EH domain-containing protein	0.661	25-36	RSPPPPPPQRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C0	Uncharacterized protein	0.937	262-287	RIRREKQKAERDAFEREKKKKIADKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C0	Uncharacterized protein	0.914	365-374	GKKGKKGKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1V3	PWWP domain-containing protein	0.966	310-366	KKSKSSKKRKKDAEDDDEKPAKTPKTGTKLKLTTPKTPASEKKTPASKAKQSASTKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1V3	PWWP domain-containing protein	0.839	277-291	AAAKAEKDAKKNKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1V3	PWWP domain-containing protein	0.834	105-127	KKSSSSKRKSTGGSGSKLSRKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7X7	USP domain-containing protein	0.995	490-553	KRLRPRGKPQAKPAKTMNTKGKSKKTKAESPGAQAPAKPRGVAKSKAGAKAGAKASAKAKGRKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9M9	rRNA-processing protein efg1	0.896	40-58	PHHAYRKKIKIPKKEHPYP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9M9	rRNA-processing protein efg1	0.685	27-33	RPKRKDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9M9	rRNA-processing protein efg1	0.654	63-67	LKKRI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCM4	Uncharacterized protein	0.752	40-51	SPRRPAHKASRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCM4	Uncharacterized protein	0.712	111-128	KHKPTPKMAEPRARAARH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI1	Uncharacterized protein	0.946	12-31	KKRKREDRAGAPASKKRGVD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI1	Uncharacterized protein	0.927	199-213	SKRAPRPQRKKPKQV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI1	Uncharacterized protein	0.657	37-44	GAKGNRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNK8	Uncharacterized protein	0.927	192-205	RRRQKMEKRRRAKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNK8	Uncharacterized protein	0.75	408-415	RPSRKKNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7G5	Uncharacterized protein	0.644	777-781	RRSRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C948	Zn(2)-C6 fungal-type domain-containing protein	0.863	31-38	RPRKRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9R7	RNA-binding protein 8A	0.978	119-147	PSNKGKGSGERGGRGGRGRSRSRDRSRSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA29	SMI1_KNR4 domain-containing protein	0.826	378-387	GRKPPRRKAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAN0	Zn(2)-C6 fungal-type domain-containing protein	0.691	37-42	KPGRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDH5	Response regulatory domain-containing protein	0.63	443-448	RQPKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKM2	Uncharacterized protein	0.97	546-564	KARRKDPRPRRIPRSKVER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKM2	Uncharacterized protein	0.944	812-836	GPRRGQKLRKRKLSEREEEVNSKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLE5	KH domain-containing protein	0.683	21-33	RRPSRFDRRSRSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNN9	Nonhistone chromosomal protein 6A	0.903	5-25	KTTRKTKPTTRRKKDPNAPKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRD6	Urea amidohydrolase	0.998	218-310	PTPPRSGKRRRSEVKSTPKQAETPKIPAPEAKTPAEKKASPEKKASPEKRKRGPKAAAAAQKDEASTPAAAGRKSLGGGEAPKETTKRAKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRD6	Urea amidohydrolase	0.961	91-107	GGKKKRKRAPHDPNAPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRF8	WD repeat-containing protein jip5	0.996	391-408	KRGDARKKRKKGKTPKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSV4	MHD domain-containing protein	0.998	474-491	RKTKKKKKKKVKKSSKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUY1	Uncharacterized protein	0.987	158-259	KKRQDEEDRQRKEKRDKEDEERKKKWDKEDDERRKRLEREDEERKKRQDEGDRERKEKWDKEDEERRQRLEKEDEDRRQRLDEADRERKKKWDKEDEERLKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWH7	Pre-mRNA splicing factor cwc22	0.79	30-46	RKRSPPSRSPSPNRRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWR5	Helicase swr1	0.998	1514-1532	KSKKKSKKGKEHRLRKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ93	Uncharacterized protein	0.666	316-324	RPNARNKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9N4	Uncharacterized protein	0.999	44-77	ERRAQSLREKEKRRIANKKKKAEKEAKAREERRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBI7	Anaphase-promoting complex subunit 1	0.906	353-368	SKKRRRETGGIRSKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGW7	Uncharacterized protein	0.984	6-26	KSREKREWKAMIRRRRHRKHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI18	3'(2'),5'-bisphosphate nucleotidase	0.706	355-359	KKKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKV1	Cytokinesis protein sepA	0.98	1689-1710	SRRRRETAEEERRKRRLRRRNG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKV1	Cytokinesis protein sepA	0.879	1586-1598	QRDRRRRARLKER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKV1	Cytokinesis protein sepA	0.831	1030-1082	PPPPPPPPPGGAAGLTPPPPPPPPPPGMKAGMPPPPPPPPPPGAAGGMPPPPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKV1	Cytokinesis protein sepA	0.695	1193-1198	KKRKDK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNA4	WD_REPEATS_REGION domain-containing protein	0.924	161-172	AKPKKKKSKASK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPN5	Dynamin-binding protein	0.836	471-514	RAKRDMTHGRSRRPPPVKGPSLGAYIAAPPPPKKSPTLRSSRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPN5	Dynamin-binding protein	0.662	1150-1155	RLKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQB0	Uncharacterized protein	0.934	558-569	GMHKPRKRRRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQW3	G-patch domain-containing protein	0.984	137-154	RRRRQRKKEERKRESRSG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTF9	J domain-containing protein	0.802	522-542	ARIRRRQQRPEESLRRGRLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTF9	J domain-containing protein	0.661	491-502	PRPHLRPHPPPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTF9	J domain-containing protein	0.65	335-341	ARSKSKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTF9	J domain-containing protein	0.614	244-249	SRPSAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVS8	60S ribosomal protein L7	0.98	29-62	KKRKSQEQARAVAREEAAKKKEANKKKRAVIFKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D096	Zn(2)-C6 fungal-type domain-containing protein	0.628	73-77	RRIRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0C5	CDP-diacylglycerol synthase	0.784	418-437	DKYKKSGKHSSPPKESPSKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7K2	Zn(2)-C6 fungal-type domain-containing protein	0.615	78-82	KGARA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE75	Uncharacterized protein	0.998	237-275	NRRNRWLAWRKRQARAERAAQMKSLKNKKKASKKAKGGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLK7	Aa_trans domain-containing protein	0.901	327-336	PGRRKRKPRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNP5	Uncharacterized protein	0.744	525-536	KTRKPRERPPLA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS42	Translation factor guf1, mitochondrial	0.882	631-647	RRRKLLEKQKEGRKRLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUK8	Multiple RNA-binding domain-containing protein 1	0.634	84-87	KKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWG2	Kinesin-like protein	0.874	605-618	RPSQPPGSRKKRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWG2	Kinesin-like protein	0.743	356-363	GRPGKRKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0B7	SAM_MT_RSMB_NOP domain-containing protein	0.843	3-17	KRGGRKGGGGRGGGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0B7	SAM_MT_RSMB_NOP domain-containing protein	0.792	600-610	PKPKPPQKRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y0	Uncharacterized protein	0.997	229-247	PPAKGKKSKKSKRKVRKPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D204	G-patch domain-containing protein	0.664	29-41	KRRQQREAEARAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGH5	Uncharacterized protein	0.982	146-180	GKKKKNKQTEIEVPMRKKNATKKGKGKGSAPNRMP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGS5	Zn(2)-C6 fungal-type domain-containing protein	0.754	755-761	RKRRRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIW6	Uncharacterized protein	0.997	232-272	SPKAEKRAPKAQILALEERKRRKTKKNKKPAAAAPAPRPAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJJ6	Uncharacterized protein	0.762	122-129	IKKRGKSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMM4	Uncharacterized protein	0.993	90-157	RRRRQAKARLQEEGRERRKEEEEIEARKRKRDQEKAWEDTREERIGSWRDWQKGQKKGGDKKKKKMKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPJ9	Usp domain-containing protein	0.986	279-292	PSPKREKKKKKRLA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ19	Ribosome biogenesis protein NSA2 homolog	0.853	21-66	EERARKREARESHQKSKDAQNLRGLRAKLMQQQRHKEKIQMRKRIK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP1	S5A_REDUCTASE domain-containing protein	0.807	287-304	KKERRYRKEFPDKYKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRC0	Ribosomal protein L15	0.959	40-78	SRPSRPDKARRLGYKAKQGYVVYRARVRRGGRKRPVPKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRC0	Ribosomal protein L15	0.675	169-178	KKSRGINKGH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT41	Uncharacterized protein	0.715	532-539	RKKIKSKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT41	Uncharacterized protein	0.646	186-193	KKNKDKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT60	Uncharacterized protein	0.831	344-361	RTRYTRRSRRSGTRSRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE5	Uncharacterized protein	0.968	28-57	ARDPNAKSKSKNKKKAQDAKKNDASKAQSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE5	Uncharacterized protein	0.956	224-237	GKAKAKKKGAGKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE5	Uncharacterized protein	0.951	89-111	EPKKKRKRDPNETAENSKSRKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXA3	Phosphoinositide phospholipase C	0.958	167-181	SQPKPPRRKKSVKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0I7	Uncharacterized protein	0.995	338-374	GSKKRVKTKKRQKKVRSWAGSILTRGKGKRHQSKKEP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0I7	Uncharacterized protein	0.878	840-850	EKARKKGRRIS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1H3	Pre-mRNA splicing factor CLF1	0.84	613-621	PRRVKKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAC3	Uncharacterized protein	0.608	132-133	KR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBU6	Zn(2)-C6 fungal-type domain-containing protein	0.619	15-17	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC68	SANT domain-containing protein	0.993	201-275	QAPRRTGRARRWTRRTRGGTRRPCRHNRRRNSGSHSRSRRRRDRGPHTSSSSLRLGRGWLRLLGRRQNRIRNRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC68	SANT domain-containing protein	0.782	22-38	RRRRAEKPDQSRHKRLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE85	Uncharacterized protein	0.714	9-16	KEPKSKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL89	Uncharacterized protein	0.991	120-134	PKRQRGGRKKRKKNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLD7	Elongator complex protein 1	0.972	1178-1192	KTRRREERKRARGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLI7	Vacuolar import and degradation protein 21	0.8	487-500	RFKDRKAREKERSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLU5	EVE domain-containing protein	0.997	13-66	EKRKRGRPRKYPPGSRPQPVPGRGRGRPRKDPNAKVTSKSEAPKSGRGRGRPRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM26	Poly(A) polymerase	0.777	554-562	RPKKKVIKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPY1	DAGKc domain-containing protein	0.888	767-779	KGKQRKKEMRRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSL6	Kinesin motor domain-containing protein	0.68	639-643	RKKRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWX4	Uncharacterized protein	0.999	302-350	KRRRGRPRKSEIDPNAPPKPKKPRKPAPSKEGPKRPRGRPRKADVLARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWX4	Uncharacterized protein	0.999	458-502	KRRRGRPRKSEIDPNAPPKPKKPRKPAPPKEGPKRPRGRPRKADV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWX4	Uncharacterized protein	0.985	214-240	PRRRGRPRKSEIDPNAPPKPKKPKKTA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXE4	Uncharacterized protein	0.954	371-393	RRNMRIAHKNRPPQTKKRGKPPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXX9	SET domain-containing protein	0.98	100-130	TERQRRLREQSDGGDRKKRSGAKSQKKKARE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXX9	SET domain-containing protein	0.905	451-472	RRHPKALDTKQASAKRKKVKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXX9	SET domain-containing protein	0.659	599-608	SSRGRHGSPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXX9	SET domain-containing protein	0.636	560-563	KKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0A6	CNH domain-containing protein	0.738	11-18	RKRRRIGH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBX0	SMP-LTD domain-containing protein	0.786	788-807	FKKNSGPSVRRKPVPASRPN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBZ6	Exosome complex protein	0.999	178-230	KQKSKSKGKKKEKAEGSGDKSAKKKNKRSKEGRKEESKERRKKKMEKRKARQS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM81	Uncharacterized protein	0.929	1093-1104	SRQRRRRPHRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNY7	L-ornithine N(5)-monooxygenase	0.95	204-215	SKHKKKKKQQRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT57	HMG box domain-containing protein	0.989	120-148	RSPPIRRSARGKAKGSRDSRARRRPMAKD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT57	HMG box domain-containing protein	0.7	266-271	KDKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTJ1	PHD-type domain-containing protein	0.997	89-116	VPKRTPGSGPRQRKNGSHPGRRKKRRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTJ1	PHD-type domain-containing protein	0.878	185-194	PRKRKRAVRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUI7	Ubiquitin carboxyl-terminal hydrolase	0.724	176-181	PRRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWJ7	WD_REPEATS_REGION domain-containing protein	0.972	704-714	ARKRKRRKEKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX20	MFS domain-containing protein	0.905	323-334	PRPRRSRKRPSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.997	1567-1580	KSKKDKKKKKKKQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.996	2176-2191	RKESKKKKKKAKKQAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.994	682-695	RKSSKKKKKNKKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.994	1254-1267	SAKSKKDKKKKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.993	331-342	KKKKKKDKKKNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.992	441-453	KKAKRDKKKKKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.992	1043-1054	KKKAKKEKKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.992	1706-1720	KERRKAKKKEKKRQS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.99	2401-2415	RKLSKKEKKKKGKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.989	1368-1380	KKQAKKEKKKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.987	815-825	KKKKKKKNRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.982	944-954	GKKSKKKKKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.974	1967-1979	KKKSKKEKKKQRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I8	Uncharacterized protein	0.897	2332-2343	RKLSKKEKRKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAR5	RNase H domain-containing protein	0.958	45-65	AGRRKQEAKEKRQRVKLGRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE33	Uncharacterized protein	0.82	196-216	RAEQEKVREQKRSEREANRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFA5	Uncharacterized protein	0.87	683-694	SKEKKEKKRHHF
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHE4	Mcp5_PH domain-containing protein	0.921	1072-1091	RDSIRIAKGRPRPTPKGKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR02	Uncharacterized protein	0.996	14-84	KKERREKSDRHRHHDRDRDRSRERSRHHRHHHHRRHSSRSRDRESDRHRESRRSEDNEHRHKRSRRSSDHG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR02	Uncharacterized protein	0.834	88-99	DHSHKRRHRREH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR02	Uncharacterized protein	0.715	675-689	RGGDRRVEGFKKRWR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSP6	PH domain-containing protein	0.851	105-126	KKKNSLSRKGSLRRSGSRRSMR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT23	Probable ubiquitination network signaling protein acrB	0.761	613-622	KRSRMKKAKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT23	Probable ubiquitination network signaling protein acrB	0.691	407-411	KKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT77	DNA replication ATP-dependent helicase/nuclease	0.836	184-198	KPKRRKIDGEKVRSG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVC7	tRNA-binding domain-containing protein	0.996	168-237	PKEEKERKKKEKAAAAGAGEKTVVVGQGKPEKNPAPAAKEGEAAAGDKPQGKKKEKKEKQPKQPKAAPAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS0	BHLH domain-containing protein	0.708	328-344	PRSRRSRGSSYNKSRRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYS0	BHLH domain-containing protein	0.604	350-351	RK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0R2	Uncharacterized protein	0.994	118-184	KPDHPQDRNGRRKRKPKPSAFAKEMAIAEQRRKAAEKRREEREFRQKDREAMARARRPDQHGKRRLG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C990	Uncharacterized protein	0.98	389-413	RRRRKRAMLLKEKKWRHRLGIWRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAA3	Protein kinase domain-containing protein	0.608	596-597	RR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD81	MFS domain-containing protein	0.801	317-330	AREKRRVRHANKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CET1	Abhydro_lipase domain-containing protein	0.779	232-248	RERRARGPRVFAERKGA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMV4	Uncharacterized protein	0.639	284-287	RKRI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPT2	Uncharacterized protein	0.999	168-215	EKTKKKSSDTKPKKKKKKFRYESKEERKLARAKERMSRARKAQARRER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPT2	Uncharacterized protein	0.893	31-62	RKRKQQRIKHAQEIAEQKAREIKREERRRIRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQD1	Uncharacterized protein	0.945	547-573	RGERGLSWFRSFGRKKSEPARKGKTKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQD1	Uncharacterized protein	0.913	16-44	GSKNPFRKEKRPQAASPKPSGSTRGSKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7H6	Zn(2)-C6 fungal-type domain-containing protein	0.7	17-24	KSPPRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7H6	Zn(2)-C6 fungal-type domain-containing protein	0.666	208-213	RKLKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBH5	Uncharacterized protein	0.955	775-783	ARRKKRKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCK9	Uncharacterized protein	0.999	885-928	KRLEKKKKVEAKKREKKVRQKEKTERGWQKAAERETRGKKRKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCK9	Uncharacterized protein	0.704	662-670	KASTPRKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD25	Ppx-GppA domain-containing protein	0.955	563-581	DLKKIKKVGKKKHWIGGRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHC3	ATP-dependent DNA helicase II subunit 2	0.914	551-565	KKVPPKTKGRKRTRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA4	PHD domain-containing protein	0.887	420-437	RPSTRKSGRPPARRGGRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA4	PHD domain-containing protein	0.847	369-379	NRKKGKNDKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJE5	ERCC4 domain-containing protein	0.995	152-209	QNKRGPRKTSKTTNSADKEAKAREREAAKARRERERQLEKERKQREKEEKAREKAREK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKA8	Uncharacterized protein	0.99	221-234	RKKGRKRKPKNKNA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLH7	Uncharacterized protein	0.816	35-53	WKHRHKRNQQAKSDRGKKV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQM5	Utp12 domain-containing protein	0.983	822-841	PSKKAKLGGGGGKGKNKARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQM5	Utp12 domain-containing protein	0.853	100-106	AKKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRH7	Uncharacterized protein	0.603	682-682	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWQ8	Uncharacterized protein	0.97	1177-1195	SKPPRPDHVPRDRRKKRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWQ8	Uncharacterized protein	0.668	652-657	RRRTKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ21	RING-type domain-containing protein	0.992	761-828	SKDRPTRREEERERDRDARRRDRDRDRHRERDRDRERDRDRDRDRYRDRERDRDRDRDRKRSRRDRSE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ21	RING-type domain-containing protein	0.981	688-716	SHRSSRRRDRDRERERDRRSGRRSHRSHR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ21	RING-type domain-containing protein	0.823	852-872	VRSSGDRDRPPKEKPPRTAEP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ21	RING-type domain-containing protein	0.733	838-849	RHHSRRVKRTRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ21	RING-type domain-containing protein	0.729	612-632	RSKSRGRSASQARSRSRSPAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ21	RING-type domain-containing protein	0.621	659-662	PRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D085	ANK_REP_REGION domain-containing protein	0.773	544-556	KKSKAQTKKGKSG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D139	Uncharacterized protein	0.987	336-359	RGRGATRVRVKKKNWQKKKKERRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z4	AAA domain-containing protein	0.997	31-52	RRSTSRTKSKKKSKPAKKKARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z4	AAA domain-containing protein	0.837	310-320	RRSSRKKPKSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z4	AAA domain-containing protein	0.73	368-378	RRPGLRKRASR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z4	AAA domain-containing protein	0.67	126-129	KKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHR0	Transcription activator of gluconeogenesis acuK	0.97	48-68	GQKPPSNAKDPSRPRRKKARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJH6	Uncharacterized protein	0.708	57-63	PRKRSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL28	Uncharacterized protein	0.73	476-487	GRRLSQKKKDAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN05	Uncharacterized protein	0.646	134-137	RKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN12	Histone H3	0.925	45-67	RGKGIRKKQSDEKKPKFLIKRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN94	Plasma membrane ATPase	0.861	895-902	RKRRRRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP53	EAF domain-containing protein	0.845	227-261	PKPRPKTQTNPLRQPKKTAPAAKRETAAVPKAAAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUT4	DNA topoisomerase I	0.954	141-206	MEKKRIELKGEKEGQKSTAAPKKKPTNGVKKELVDGQKPSAVKKTATKVKSEPKSAQSTPVKKGSA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUT4	DNA topoisomerase I	0.67	354-361	PAAEKKRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW55	Uncharacterized protein	0.784	77-84	PRPKKKPS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY25	Ubiquitinyl hydrolase 1	0.688	1019-1028	RKLRQTRRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY25	Ubiquitinyl hydrolase 1	0.668	414-420	RGRRKDG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C969	Uncharacterized protein	0.811	3-14	KKKSKNKAKAGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC70	Uncharacterized protein	0.875	38-52	VPRTRRRRSRTVRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDS8	BHLH domain-containing protein	0.948	959-981	KRKAIRKKTEKPPKAAEQTRLPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDS8	BHLH domain-containing protein	0.617	718-720	KRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV3	FNIP_N domain-containing protein	0.728	322-329	KRKKIKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV5	Vacuolar membrane-associated protein iml1	0.862	725-738	KQRQRRRSPKQKRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHV5	Vacuolar membrane-associated protein iml1	0.737	787-800	SAKSASPKKPALKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLW7	Uncharacterized protein	0.805	177-193	RRSHSSRRGHGHRRHSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP78	Uncharacterized protein	0.647	103-106	KKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQJ1	GATA-type domain-containing protein	0.838	356-364	PKKRRGKAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR49	Uncharacterized protein	0.99	164-188	RKKKKKSSPNKTKSKSDKKEAGSPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR49	Uncharacterized protein	0.677	100-107	KGALRRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSH2	RanBD1 domain-containing protein	0.611	26-28	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT65	Uncharacterized protein	0.903	371-386	LKKKEDKEKDKGKEKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT65	Uncharacterized protein	0.794	29-45	RRRHSVRRRSVSRHRHR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT65	Uncharacterized protein	0.617	75-77	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTL2	Uncharacterized protein	0.954	27-44	PHRPSKTPRRRGPKSRRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU56	AP-3 complex subunit delta	0.979	978-1012	KKKRKVKKAKGDEARPTDPQNPEVLSKKKRTRKPA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU56	AP-3 complex subunit delta	0.736	869-877	RKHGKSRPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU56	AP-3 complex subunit delta	0.613	800-802	RKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU56	AP-3 complex subunit delta	0.601	804-804	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXY5	Alpha-1,3-glucan synthase	0.831	1737-1750	PGHLVRRGRRRLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7E2	Uncharacterized protein	0.95	56-93	FRSRRGSPVASAKVARRKRPFQKPLLSGPVQKFRKSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE23	Uncharacterized protein	0.816	164-175	GERHRKRLGRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CES3	Uncharacterized protein	0.895	55-76	RDGQPAKRRGPKPDSKPALTRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHM7	BZIP domain-containing protein	0.863	50-65	RIAQRNYRKKLKRRLE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHM7	BZIP domain-containing protein	0.659	94-99	KSRKGH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHS2	Siderophore iron transporter mirC	0.839	252-268	RRARKLKLIKQKSLRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM30	Uncharacterized protein	0.796	531-542	RPVRRVRRRGWR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMD0	Cytochrome b5 heme-binding domain-containing protein	0.904	238-255	QRPKRKDMKRAAAKAGHP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNI5	PHD domain-containing protein	0.989	393-415	GRKSTPGGTKKAPAKKAAPKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNI5	PHD domain-containing protein	0.956	452-471	ASSPAPESKKKVGKKGNKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNI5	PHD domain-containing protein	0.622	444-446	KKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPQ0	Uncharacterized protein	0.946	77-99	KDARKKKGHGKPAAQTKVVSRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPQ0	Uncharacterized protein	0.754	347-359	RARDRKRSQEKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPQ0	Uncharacterized protein	0.646	328-335	RRRTNRPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWC9	Mitochondrial DNA polymerase catalytic subunit	0.963	477-497	KGKKKGDPPRPAARQKKPGMP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGH7	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	0.967	271-299	TKGKSRPSGWEDPEKRRERKRAEGLMRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU3	Pre-mRNA splicing factor cef-1	0.952	167-192	GKKAKRKARERQLEESRRLAVLQKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU3	Pre-mRNA splicing factor cef-1	0.676	265-269	RKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI22	Uncharacterized protein	0.993	54-83	ARPRGGEKRSRGRGRGRGGRGGPQNPGQRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI22	Uncharacterized protein	0.957	282-300	RGRGRGRGGRGRGGARGPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPA0	Uncharacterized protein	0.751	125-132	RAGKKKHR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPL6	Uncharacterized protein	0.936	816-827	RRRRPKRRTERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPL6	Uncharacterized protein	0.875	174-223	KSKDGKTKIRIRTESTRSSSSLRSKRDEKSKSSKTTKPDTPSKSKRSSHH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPL6	Uncharacterized protein	0.816	14-35	RTRSKKTASPSSPKTKHRHPRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPL6	Uncharacterized protein	0.601	287-288	KP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQZ1	Uncharacterized protein	0.789	492-503	KPKRQRSKGAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQZ1	Uncharacterized protein	0.689	620-627	KRKKLMPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQZ1	Uncharacterized protein	0.677	57-65	RAKSRKVWK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQZ1	Uncharacterized protein	0.642	542-551	AKGGAADKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CS43	DNA-directed RNA polymerase subunit	0.734	1443-1450	RFRKRARA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU99	Topoisomerase 1-associated factor 1	0.907	566-575	RSRRRAKRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU99	Topoisomerase 1-associated factor 1	0.777	943-948	KKKRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU99	Topoisomerase 1-associated factor 1	0.631	1036-1041	KKTQRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUR7	Phosphodiesterase	0.874	922-939	RRLPKRRSRIRLAFWKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUR7	Phosphodiesterase	0.68	187-192	SRKKLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW25	Pre-mRNA splicing factor ATP-dependent RNA helicase PRP43	0.847	750-765	RLSRKEKMRADSGKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW25	Pre-mRNA splicing factor ATP-dependent RNA helicase PRP43	0.69	365-374	PRRPGGRPGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWB9	LDB19 domain-containing protein	0.832	72-85	HKDKRRIRGRSSHS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY63	CBM21 domain-containing protein	0.777	235-259	RHPMVRKKSGELVRPALRPPSARRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ20	CBFD_NFYB_HMF domain-containing protein	0.895	245-254	KRKRGGRRPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0S4	Uncharacterized protein	0.991	736-752	KNGKDKGKKEKKPKKRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1D6	CP-type G domain-containing protein	0.997	6-50	KNSKRTPVRLRHKIEKASAAKQRKQRKLAKKNPEWRSKIKKDPGI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1D6	CP-type G domain-containing protein	0.728	386-392	SKKGKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1D6	CP-type G domain-containing protein	0.631	67-71	KRRLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKC6	Calpain catalytic domain-containing protein	0.983	593-646	KKAREEYERHRKNQERQKLKHETRRRLEKEWIRERKMSARKQRMTEKLAAKRHN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLS3	Mannose-P-dolichol utilization defect 1 protein homolog	0.816	265-300	TKKQPARKQTEKPAAVKSTGASPKPSGRTPTTRRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM47	RNA helicase	0.873	593-614	RRPRRSRDERPYGRPRRQSRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN57	Ribosome biogenesis protein SLX9	0.91	41-70	DKRTIKHASFVSKIEKSSQKATKRRRASKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN57	Ribosome biogenesis protein SLX9	0.829	104-118	LKHKPGAMKRREKLE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN59	Chromo domain-containing protein	0.962	102-114	QERKRRRQAKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN59	Chromo domain-containing protein	0.829	168-203	KRVSISIPSRPRPKPPPVLFGSSKSRPAPGPARAQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNY2	40S ribosomal protein S7	0.677	104-121	PRPKRSVNSRTNQKQKRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRW9	Uncharacterized protein	0.984	607-633	PRKKKAKAPRAPPTERSSKSRKAPETK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRW9	Uncharacterized protein	0.715	418-428	KPSKQIRRRPV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTT3	Eukaryotic translation initiation factor 3 subunit J	0.978	48-84	KAAKAAEAKAKAEAEAAAKKKSKAQRIQEHKEERKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTT3	Eukaryotic translation initiation factor 3 subunit J	0.698	228-236	KGNKKSKAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXE8	Uncharacterized protein	0.711	102-107	KKHKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYW3	NUC173 domain-containing protein	0.992	1231-1281	RAGDRNNGRRGLGAPKTHGPSGGKGGIQKRRSFGGRGGGGRGGRGGGMRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYW3	NUC173 domain-containing protein	0.974	1007-1019	IRKQRERRKKKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYW3	NUC173 domain-containing protein	0.626	1194-1198	RGKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYW3	NUC173 domain-containing protein	0.61	1204-1205	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAA8	CP-type G domain-containing protein	0.696	55-68	RKHQKNKGRLTVPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAY6	Fungal_trans domain-containing protein	0.651	34-40	RRRGALK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBG2	Phospholipase	0.612	26-28	RPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDB8	Uncharacterized protein	0.986	170-191	AKPAATPKRRAGRPKGAKNKRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDB8	Uncharacterized protein	0.665	147-151	GKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDB8	Uncharacterized protein	0.628	103-105	AKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKB4	Zds_C domain-containing protein	0.954	523-576	RKPEERKAETKKSKDKKDSEGGRKSSWHWLLGSEEKDKEKKKDKDGDAKKIKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKB4	Zds_C domain-containing protein	0.631	644-647	RKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL38	Mating-type switching protein swi10	0.636	269-274	RAKARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLK2	COesterase domain-containing protein	0.754	409-417	RPRRRRASR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNJ5	Forkhead box protein C2	0.743	35-43	NKKRKIDRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNM1	Lysine--2-oxoglutarate reductase	0.963	553-569	EKKKAGRPKKSRETVRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE8	SCD domain-containing protein	0.998	88-145	RERKRAARKASRRTSGSKSKPKPRSAKKPKVAANGIGSQLAFRPAVNGKKSSRKHKVR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE8	SCD domain-containing protein	0.939	1104-1131	PKPKSARSSKPKSKQSAAKDKSASSKRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE8	SCD domain-containing protein	0.683	328-333	KKKKSV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE8	SCD domain-containing protein	0.606	1081-1082	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU1	J domain-containing protein	0.753	349-356	RKKREKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXT5	C2H2-type domain-containing protein	0.891	295-314	KEIRKEWKARKKEEEAQRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY34	Serine/threonine-protein kinase RIO1	0.998	509-559	KKQPRGKRFEDKDSKREHKQKVKEEKREKRANKMPKHMKKRLVSSSSRKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBK3	Eukaryotic translation initiation factor 2A	0.963	531-547	SKSAARNKKKREAKKQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBK3	Eukaryotic translation initiation factor 2A	0.78	563-584	RNDKGGHERSKSKANGAPAKPA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC96	NIBRIN_BRCT_II domain-containing protein	0.816	452-468	GRKNFKKFRRRDDANRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDW1	Pectate lyase B	0.744	53-59	HRRRRRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE96	O-acetylhomoserine	0.989	187-214	EKGRQHLRRRRLLLPPHRARRRHRRAQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGZ1	Protein MAK16	0.997	288-311	KKPKPGFKRKRPAPQAKPRKKGPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGZ1	Protein MAK16	0.919	127-160	KLAKEEERLGERVVPKLAPKIRRREETRERKAES
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHM3	Uncharacterized protein	0.933	460-475	RGERSKRKRRFRSLSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ84	DUF1713 domain-containing protein	0.999	317-347	TKRRRKLKMKKHKYKKLLRKTRTLRRKLDKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ84	DUF1713 domain-containing protein	0.918	76-93	EKKEGKASRRRGRDGAGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQD7	PARP-type domain-containing protein	0.998	188-237	PKPKKTRGRPARAAAEKKAPKKAAKKKVESEDEAESPEEKPKRGRKKKSA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQD7	PARP-type domain-containing protein	0.986	121-173	GFRVRGGKKAAAKDDESEEEPEPKTKKRGRAQAKDEDKEEPAPKPKKSRKSKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQE0	Uncharacterized protein	0.884	94-112	RRDRGHKTGMKSSKRAKKM
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWB7	Uncharacterized protein	0.94	189-201	KAKPKSKKSKKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D206	Uncharacterized protein	0.995	142-164	KERRKEEKKRKEKGDKKTKSQSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D206	Uncharacterized protein	0.99	63-113	KKKLNGSILKGRKFKVEAARPQKRHRDEDEAEQPVPEHKPPKEKKQKKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D206	Uncharacterized protein	0.975	500-527	RAWKKRRRDAAKEQRQRENRSKGMRGKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D206	Uncharacterized protein	0.974	254-288	KSDKYQPGKVPGAKEKRKSAEVDVKKKKSESKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D206	Uncharacterized protein	0.88	191-200	EKSSKKKKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7Q7	Uncharacterized protein	0.686	19-24	KARKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7V6	Uncharacterized protein	0.942	14-29	PPSSKKPKQARGKGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA53	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.995	571-616	RQRSKSRSRSRSRSIEAPRGPAGHPRGHGRGKNHPHGRRSRRQGKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA53	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.699	400-405	RPRKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFX5	Uncharacterized protein	0.979	231-277	RKAMAQGKAASARKGDKAWIMRKKEQMAKKGKVVKANSKYTGRKRRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH04	Uncharacterized protein	0.98	276-293	APKPKKAKRMSKKPAPRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHP7	JmjC domain-containing histone demethylation protein 1	0.641	1324-1328	PKKAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIW2	Uncharacterized protein	0.999	176-196	KAHKKHKKGKKEKKHKGHKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR04	Uncharacterized protein	0.736	328-336	RHKKEVKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSV9	Uncharacterized protein	0.978	155-167	PKKRRLRRGRPRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSV9	Uncharacterized protein	0.81	1170-1183	RRKAETLGRGKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUR8	Uncharacterized protein	0.724	789-796	RRGKKEAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVT2	Uncharacterized protein	0.851	234-243	RPKKRRKIER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYR5	Required for respiratory growth protein 9, mitochondrial	0.926	138-152	KATGPKPKRKKEGWQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYR5	Required for respiratory growth protein 9, mitochondrial	0.689	225-232	RRKRWERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYZ2	Uncharacterized protein	0.65	29-35	RKGMRAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN5	ATP-dependent RNA helicase drs1	0.999	760-821	GPDAGLSKKEKVKLSNKDKKRLDDARQRLEGKAGWKKGKAEREAPKPAKGKGKGKDKKKGKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN5	ATP-dependent RNA helicase drs1	0.923	152-167	RRQAKKEAAEAKKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN5	ATP-dependent RNA helicase drs1	0.839	59-76	KKQKQQKPVKNGLKKNKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN5	ATP-dependent RNA helicase drs1	0.715	746-756	DKRAARKLGAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0G6	Ribosomal_L7Ae domain-containing protein	0.997	5-37	KTEKKDKREKKEKRAEKDGVHKSKKDKKEKKDK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D232	Uncharacterized protein	0.991	66-105	RTPRARTARNGPPARPRKFKTPAKTPSSRDRRTPRRRAPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I2	Uncharacterized protein	0.994	328-404	RNKSKSDRRSRSRHRRSASVKSTREGDEKRSESQRRKHMAGAGLAGAAVAGLVEKARSRSRSRRRKHSRSHSRLRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I2	Uncharacterized protein	0.965	423-446	KHKDKKEEEESRHRGRRRSRSRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I2	Uncharacterized protein	0.908	528-542	SHRRRRSHGRHRSKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9I2	Uncharacterized protein	0.656	506-519	RRSRSRSVSRGGRY
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBF5	Uncharacterized protein	0.998	183-243	RRKKKRGPRPGSKREGGKEDGPKSTDPEQRKKRGRPPRVDTPMEARIKAVLKGIRKLKGPS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBF5	Uncharacterized protein	0.78	277-284	KRKSKRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBF5	Uncharacterized protein	0.753	751-774	RRKLVEAQKRKEREEQEEREKSAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK27	T5orf172 domain-containing protein	0.618	428-430	RKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKZ6	Uncharacterized protein	0.661	109-112	RKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMP3	Ion_trans domain-containing protein	0.926	1028-1046	QREKKRRIERKVQGSRKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMP3	Ion_trans domain-containing protein	0.698	700-713	KRSRRLRYSPRSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMP3	Ion_trans domain-containing protein	0.677	821-832	KVKSRKTSPTRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNS6	Uncharacterized protein	0.957	513-528	VRKTTKRGRPKKHRPE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQF4	Uncharacterized protein	0.987	540-568	PPKKTKGKEKTKKTKPLTSSKVNRKRSRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQF4	Uncharacterized protein	0.695	51-59	RAAKKPAPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRL0	Uncharacterized protein	0.906	89-99	AARKKRREGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRL2	BZIP domain-containing protein	0.822	174-192	DRRRRNTAASARFRMKKKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSP7	Uncharacterized protein	0.994	14-51	ERSRSPRRRSRSPRRSRRSYSPRSRSRSRDDYRRSDRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU95	60S ribosomal protein L13	0.971	192-223	RRLREARSEARHRGIREKRAKDKAEEEAAAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU95	60S ribosomal protein L13	0.922	26-46	PGRKHRRREARLAKAAAVAPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVJ1	B-block_TFIIIC domain-containing protein	0.972	624-641	GRRRPAGKRQGRPKRSRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0F4	5'-3' exoribonuclease	0.946	410-443	RRRRQVEERKAANEKRRKQEAQDREERSKRQRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8Y5	Uncharacterized protein	0.868	135-143	KARRKRKQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8Y5	Uncharacterized protein	0.84	80-103	PPLRRGGVGSSSARPSETKRKRHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8Y5	Uncharacterized protein	0.603	11-12	PK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAH8	26S protease regulatory subunit 4	0.97	18-50	KDKKLRFQKDKPRYEPPPPPTTRVGRKKRKAAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCV3	Uncharacterized protein	0.962	50-60	RCRRRRRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDH8	Uncharacterized protein	0.978	111-128	RRRKAAKKLKTKNKFRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIF3	Uncharacterized protein	0.873	21-31	TKRRPPKLRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMR2	Double-strand break repair protein	0.984	529-543	GVKRRARGKKRFKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMR2	Double-strand break repair protein	0.824	591-602	RGRGRGRGRGGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR44	Uncharacterized protein	0.981	604-647	FNREGRTRNPKRSKAQIEADRAAEAARKAAEPPKMGKKKKTPNP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR44	Uncharacterized protein	0.952	476-500	AHPSTPARSSARGRGRGRGRGGARM
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR44	Uncharacterized protein	0.707	462-470	KRRTRSRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRA7	SRP40_C domain-containing protein	0.903	386-399	KGFTKEKNKKKRGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRA7	SRP40_C domain-containing protein	0.798	5-21	KANKSSPAKNVKGKGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRW8	Uncharacterized protein	0.998	10-46	PRKKVKAGAKKAGKKTGKKTTGKKKTTPSAIGNRKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSF8	Uncharacterized protein	0.895	474-493	KRIRRKTARRYREMAAKGRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSV6	Chromatin remodelling complex ATPase chain ISW1	0.871	1110-1119	PAPKSKSRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSV6	Chromatin remodelling complex ATPase chain ISW1	0.759	140-157	KAKKGSSRSGGAGGERRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSV6	Chromatin remodelling complex ATPase chain ISW1	0.755	1074-1091	KKKSKSGAVNKQVKAVKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTG0	AP-1 complex subunit gamma	0.787	620-635	KKRQSKVLKDKTKKPA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVY2	BZIP domain-containing protein	0.981	136-171	LGRKPGRRASKVQDGQRERHLEKNRIAANKHRKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWX3	Zn(2)-C6 fungal-type domain-containing protein	0.727	617-653	PNNRRSQRPRHQQRPPLAYARPDVRHLPPRRLHPHRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWX3	Zn(2)-C6 fungal-type domain-containing protein	0.637	714-720	RQARRSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXH1	Uncharacterized protein	0.931	174-195	SARASHHSSSKPRKRLSRARKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXH1	Uncharacterized protein	0.645	158-163	PRHKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY43	Uncharacterized protein	0.902	165-185	EPKRKRNFRETAKQKLLRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYX2	Lon protease homolog, mitochondrial	0.72	185-191	KKGKKGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0L9	Uncharacterized protein	0.671	315-319	RRRRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJH4	RRM domain-containing protein	0.699	189-198	KGWKPRRFGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CME1	SWR1-complex protein 5	0.976	75-90	KAKSKKQKKQRGKKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN84	Uncharacterized protein	0.991	873-889	NRRKKRKKKGDARAEAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN84	Uncharacterized protein	0.862	830-839	PKKKQKKRLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPN8	Rab-GAP TBC domain-containing protein	0.751	383-412	KDQKEEKKHLKEYKKMMEQSREADKRRAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQF3	ATP-dependent rRNA helicase spb4	0.91	565-586	KNKKQKRREQKHLQQEKRRWEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSL2	DNA repair and recombination protein RAD54	0.75	61-68	KPARKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF6	Zn(2)-C6 fungal-type domain-containing protein	0.972	509-553	PKSKKPKNRATSTASSKARGPKPPSAVRPPKNSKITSNAAPRKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF6	Zn(2)-C6 fungal-type domain-containing protein	0.873	681-687	KNKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF6	Zn(2)-C6 fungal-type domain-containing protein	0.744	167-184	RLARKRSMSPSGRSRRSA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVQ1	Mitochondrial 18 kDa protein	0.641	284-290	RRAKEQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU4	Uncharacterized protein	0.857	672-683	RKGWGTKRKRRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU4	Uncharacterized protein	0.787	448-462	KKSNERNKMRRRLAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU4	Uncharacterized protein	0.757	170-178	TIPPRKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU4	Uncharacterized protein	0.733	1203-1209	RKGKRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYC3	Phosphatidylinositol 4-kinase	0.647	323-326	KRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0T4	Uncharacterized protein	0.908	285-317	YRGRGGHRGRDNRGNRRGGDNRDWRERRAEDQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1R7	Transcription initiation factor TFIID subunit 2	0.812	664-674	KRLKRNKRQKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8X3	Uncharacterized protein	0.994	837-858	AEGKGKGKGGGGNKGGKGGKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8X3	Uncharacterized protein	0.984	605-631	GKRSKGDTKSAPASSRGKKGKAKKAAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8X3	Uncharacterized protein	0.892	652-692	KAKAEKAAAAAEAKANREREAEAQRKRRQAQHARAAEAERK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH93	Uncharacterized protein	0.799	3-14	KRKRDKHSGRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH93	Uncharacterized protein	0.741	343-350	RKARRKIV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH93	Uncharacterized protein	0.713	35-48	KKLKVYKADKKSRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLD0	Uncharacterized protein	0.992	87-117	AMAREIEKVKKEYEEKQKKKQKEKEKKKEKD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLD0	Uncharacterized protein	0.603	84-84	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM22	Uncharacterized protein	0.999	736-766	KRREERRKKKEAKEKKRQEKEERRAKRAAER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM22	Uncharacterized protein	0.77	301-313	RSLRRRLLRLKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMF6	Uncharacterized protein	0.989	35-56	RRRLSRWSRWSRQRRRKGRRRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN72	Uncharacterized protein	0.929	83-109	RKPRSTSTPKGGAGPKTPASSGKRKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRF0	Zn(2)-C6 fungal-type domain-containing protein	0.685	111-119	KKQKQRIKD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTG3	KIX_2 domain-containing protein	0.664	928-940	KKAPPAKQQPAKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTG3	KIX_2 domain-containing protein	0.663	1230-1234	PKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVZ7	Uncharacterized protein	0.626	94-97	KPRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ31	Uncharacterized protein	0.973	421-445	RSDRRRDERRHGQRPNAPKKGRRGH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0E5	Uncharacterized protein	0.836	8-17	PRRRSKSRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1D0	SLD3 domain-containing protein	0.971	362-374	RTKRKSKKKKLGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1D0	SLD3 domain-containing protein	0.75	694-705	RRTGGSGRKPKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC64	Septin-type G domain-containing protein	0.83	50-63	GERKPSASKSKKKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB8	Integrase catalytic domain-containing protein	0.806	1185-1192	HRKKSKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGK1	Uncharacterized protein	0.945	16-43	RKLEKQKSLKKGKAEALARRNEKLARRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGK1	Uncharacterized protein	0.812	93-122	APKFGGSESRRGGFGGRGRGDGGVLGKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK92	Uncharacterized protein	0.753	227-237	KRQISRKRRTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKF7	DNA-directed RNA polymerase	0.873	80-95	KKARQAEGRRPPKRNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKH0	RED_N domain-containing protein	0.997	808-824	GGKKRKRGPKKRKGDKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKH0	RED_N domain-containing protein	0.85	494-513	KVKEKKRGTMAPPPPQKKSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL51	pH-response regulator protein palA/RIM20	0.749	593-601	RRKRRAQAL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPT7	Zn(2)-C6 fungal-type domain-containing protein	0.652	25-29	KRSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRD2	Uncharacterized protein	0.95	475-489	LKGGKLKKRKERGSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRD2	Uncharacterized protein	0.774	918-932	LGKSKKGSQAKHRPG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUS5	RNA cytidine acetyltransferase	0.951	1014-1053	SAKAAKRKKGETAREIYDKEVESKRQKIIKKGTEGRKGKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUS5	RNA cytidine acetyltransferase	0.944	69-85	HRKKREAKIKREVKRGI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWP9	Uncharacterized protein	0.746	312-320	KLRRKVKKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX64	pH-response regulator protein palI/RIM9	0.731	320-357	PPPGFNSRGRGGYPPRGGYGRGGPYAGPRGPPPAGVRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX64	pH-response regulator protein palI/RIM9	0.714	181-187	RKARKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY82	Mannan endo-1,6-alpha-mannosidase	0.697	109-117	RSRRREPPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1H2	Uncharacterized protein	0.693	260-265	SRKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1H2	Uncharacterized protein	0.671	395-401	RKKDKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9P5	Fork-head domain-containing protein	0.712	304-316	RQRSGAKGGKAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9W9	Uncharacterized protein	0.991	153-200	KRRKSLKRKRTSTSARKGKVKTPKSETPSSFVGKVPKHEDKPRPRRPL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG9	Uncharacterized protein	0.964	180-207	PRVPKIKKNRLSRPPPPDAKYRKRQRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG9	Uncharacterized protein	0.955	86-111	PRSLRRRTASHNVKRVPRRLRARAKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG9	Uncharacterized protein	0.797	625-636	KREWERRPKGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG9	Uncharacterized protein	0.788	759-777	RKKWRALASEKPKRDEGRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG9	Uncharacterized protein	0.72	148-159	KTKTKRAAAKAQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG9	Uncharacterized protein	0.6	126-126	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU9	Sister chromatid cohesion protein	0.997	1537-1566	PPRPAKRKNSLSGQNPPKKRGRKPGPGKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIN4	Uncharacterized protein	0.959	62-81	VRETKPPKPKPKPSPARRNS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIN4	Uncharacterized protein	0.876	10-56	RSSPARPLKNTPKASLKGSRNSDPAPIEGPPLKKRKYVPGGPGGGGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIN4	Uncharacterized protein	0.852	221-232	IKRRPGRPPRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIN4	Uncharacterized protein	0.664	1172-1177	RRRWRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKD5	TPT domain-containing protein	0.967	90-104	KQRRQRRRRRRQQRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPH6	Rhodanese domain-containing protein	0.914	135-154	KRRHRGHRAGGSARPGRPAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPH6	Rhodanese domain-containing protein	0.834	178-190	KTKSKSKGKGKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTI2	Protein SOF1	0.976	329-351	KRIKRQRHVPKPIKKAREIKREE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU67	Uncharacterized protein	0.994	23-97	SSKTTAPKARAAKTSAASKPSVAESKKRAPRAAATESRKRKAESVEKEEKEAPAPREPKKARVAKPRPVAAPKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU67	Uncharacterized protein	0.602	13-13	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU81	Uncharacterized protein	0.976	33-62	RSHVMRDVRRRERIAGLRRVSRRGSRARKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX29	Uncharacterized protein	0.991	89-109	VPPRKVRGTSRRRRRKGAWKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXT9	Uncharacterized protein	0.959	600-619	KKRKRNPKGTAKATAPAKRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXT9	Uncharacterized protein	0.676	1567-1575	VRRLKPPSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXT9	Uncharacterized protein	0.629	148-151	KKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0Z4	SH3 domain-containing protein	0.971	415-441	SKDDKKRKDKKPGMLSGLFKRKDKKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0Z4	SH3 domain-containing protein	0.669	220-227	LKKAMRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC15	Uncharacterized protein	0.998	405-426	PKRRPPPPKRKAKGFGKGRRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJR7	HECT domain-containing protein	0.976	429-440	RKPRRRERRRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJR7	HECT domain-containing protein	0.838	372-388	KHRPQKHRGRAGEQRKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLN1	Uncharacterized protein	0.788	365-373	RKRHRRLRW
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRE6	Uncharacterized protein	0.913	301-312	KRDSRRPRKRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSK0	Probable E3 ubiquitin ligase complex SCF subunit sconB	0.925	501-523	SGHRRPKRKACGRTSSRKYAKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTL3	Tr-type G domain-containing protein	0.997	346-366	EERRRRREERKRQKKEKSRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTL3	Tr-type G domain-containing protein	0.826	324-336	KKLSKRRENRKRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTL3	Tr-type G domain-containing protein	0.75	193-203	PPRRSHKKHES
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTL3	Tr-type G domain-containing protein	0.716	282-293	KRRRLHQHPKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTY5	Protein FYV4, mitochondrial	0.973	221-242	GERRRAEVRAKKRSEERKKGTA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWC8	RING-type domain-containing protein	0.625	18-21	RKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWH5	Uncharacterized protein	0.774	376-384	NGHDRKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWH5	Uncharacterized protein	0.657	317-322	GKRRMK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYV5	Uncharacterized protein	0.79	250-272	PAGRPRASASRSQQTRERERRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYY3	Uncharacterized protein	0.986	165-205	KLPAPLHKEVKKWRVASGLQLPERPPEDAKSKKKKGKQRRN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYY3	Uncharacterized protein	0.719	696-703	KREKERRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0J1	Uncharacterized protein	0.994	13-38	GKLKLKGSKVSDGRVEKKKKKSKKNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0J1	Uncharacterized protein	0.933	92-117	EAERKHEEARRKRLQERLKREGVKTH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7E6	rRNA-processing protein cgrA	0.993	41-110	KRLEARKHQEAVKEHERELKEEKEAERQAHIQRIKDRRAAKEEKERYDKMAEKMHRKRVERLKRREKRNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7E6	rRNA-processing protein cgrA	0.635	26-29	SKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7E6	rRNA-processing protein cgrA	0.626	17-22	RKNGKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J7	Ribosomal protein L19	0.973	2758-2786	RSRARELNAARRIGRHRGLGKRKGTKEAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J7	Ribosomal protein L19	0.955	2838-2878	EHIQKAKAERHRERVLKEEMDAKRAKNKALRERRQERLEAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9J7	Ribosomal protein L19	0.601	2834-2834	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBD0	Uncharacterized protein	0.868	4-20	SKAKARAKAQKATPKRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBD0	Uncharacterized protein	0.859	390-397	LRKKKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBD0	Uncharacterized protein	0.795	422-430	REKKRIKKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDV8	Uncharacterized protein	0.836	463-482	RVRLDARVRGRRTERRDRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CG42	Uncharacterized protein	0.601	130-130	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHE6	ATP-dependent RNA helicase DHX8	0.995	117-159	ERERRRRRDRDHDRDRGDRSSGRKRERSRDEGARSSKKLRRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU2	Ribosome biogenesis protein NOP53	0.995	278-311	KKRPERKTKTQRNKIKRRKEAERQAKWEARMKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU2	Ribosome biogenesis protein NOP53	0.734	72-77	HKKRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHU2	Ribosome biogenesis protein NOP53	0.656	17-21	KGKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIR4	Zn(2)-C6 fungal-type domain-containing protein	0.635	8-11	RKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJR5	Uncharacterized protein	0.993	691-703	GAKKRRRRRKRGN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKG4	Uncharacterized protein	0.712	382-388	KKRHARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKM4	Uncharacterized protein	0.99	241-288	PRKQKPRSRAQKENYIKVRKHGACEKHRKQHKRGRGIARRYKSAHPWR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLJ1	Uncharacterized protein	0.998	150-172	EERKRKKKERRLAEKKAKAKAEA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRL4	Spc7 domain-containing protein	0.885	174-197	REEKERRERERKAILEQREARRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRL4	Spc7 domain-containing protein	0.747	866-875	KKNKLRGRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUU2	60S ribosomal protein L12	0.838	110-124	KEPPRDRKKEKNIKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWT4	Peptidyl-prolyl cis-trans isomerase	0.989	472-545	RRTSHSPQRGPRRDRKGSRSPRRDSYRSRYRDRSHSRSPPRRDSYRDKDRSRYYDRDRRRDDRDTERYRERRRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXK5	Uncharacterized protein	0.916	117-126	KFKRGKKRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXK5	Uncharacterized protein	0.773	157-165	KRLRRRSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXP7	Cytochrome c oxidase assembly protein COX20, mitochondrial	0.636	162-168	KKQREKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN9	Protein SDA1	0.982	261-285	NKKTRSKARAIEKAKATIKRRERKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN9	Protein SDA1	0.956	676-739	VTARRKERKEEQGKSTTNKEKARRKNFFMTLGKAKSKGKRSLVETRNVLKAHHERQKRGGRRGN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN9	Protein SDA1	0.722	460-480	KRRDRGKEASMGLRAGEKKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZN9	Protein SDA1	0.705	504-509	RKKRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1C1	Origin recognition complex subunit 1	0.731	76-88	GRRRQARTKSTKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C855	Uncharacterized protein	0.851	766-781	ARRRRSGGLFRRRRNS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8C7	Peptidase_M24 domain-containing protein	0.979	383-405	KSTGNKKNKNNKKKAAKKESGDK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA07	Serine/threonine-protein kinase bur-1	0.732	478-486	PPRRRSRSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC45	Uncharacterized protein	0.887	230-242	KERKKHKDKGRIE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH88	Uncharacterized protein	0.962	1018-1044	PKRKKGQNIPSWKKHADKKKLRQATKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CH88	Uncharacterized protein	0.798	969-990	IPRSLRLGDKHGEGKKERLARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJR2	Uncharacterized protein	0.865	490-515	REIKNRAVEPRKRHRSDTHYKRQHRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRA4	40S ribosomal protein S8	0.981	8-56	RHKRSATGAKRATYRKKRAFEKGRQPSNTRIGSKRIHLVRTRGGNRKFR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT87	Protein-tyrosine-phosphatase	0.961	13-28	RKGFRKAGRRRRRTAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC05	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.948	15-33	PRSGRSPSRSPRPKNRKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCT0	GRIP domain-containing protein	0.941	5-20	GKSKSKKKNKAAAKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIQ5	Zn(2)-C6 fungal-type domain-containing protein	0.72	479-489	PRKKGGLSKAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNQ1	Uncharacterized protein	0.897	149-172	RKPGKRTRKRFATDVRNPRRLSKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPW7	Bystin	0.724	35-41	KKNKRKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSZ9	Uncharacterized protein	0.62	449-454	KQHGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA1	Uncharacterized protein	0.908	416-429	EKKAKERAKAAKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUN5	Calponin-homology (CH) domain-containing protein	0.913	965-982	RVMKARRQRRRVKTGGRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUX3	Cell division control protein 16	0.82	229-243	KTKHRPKSRPSSSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1X6	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.98	721-737	RGHKRKRATKKKGPRVL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8B5	Uncharacterized protein	0.97	1338-1367	TKKARKERATRRRTSSSAGATSKTPKKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8B5	Uncharacterized protein	0.79	1473-1485	VKRSAGKRAAKPT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8B5	Uncharacterized protein	0.652	1491-1497	TRRSSRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA80	Uncharacterized protein	0.94	7-24	EKKRKRASDRHERPSKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA80	Uncharacterized protein	0.727	471-500	KGGKAEAAARRVVRLRVPVEFPKVSRGGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAD2	Cut12 domain-containing protein	0.779	428-440	RRKEKEAKLKQRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAD2	Cut12 domain-containing protein	0.636	712-714	KRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDZ6	CID domain-containing protein	0.983	362-397	SRSRSRSRTPPRRKGLGRYESRSRSRSRSGSRPREK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHW8	DUF2433 domain-containing protein	0.967	639-665	RGRGGFGGRGRGRGDRGGRGGRSGRGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIB9	Uncharacterized protein	0.927	531-547	SRRRHRDGKRPKDREIR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIB9	Uncharacterized protein	0.866	144-160	RRRDVYTRRRRRTRAPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIB9	Uncharacterized protein	0.713	180-196	RARSGLRYPPISRRRPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK58	Zn(2)-C6 fungal-type domain-containing protein	0.618	71-73	KKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQW6	Cnn_1N domain-containing protein	0.792	969-981	RRPRYMERRPRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRI2	Uncharacterized protein	0.733	46-56	RRRRTVRRHRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT69	Uncharacterized protein	0.795	393-410	KKKNHTNKKESAPKKASS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXP2	Uncharacterized protein	0.838	1201-1221	KKTRKLGEGLKRAKSEVLKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ29	BZIP domain-containing protein	0.985	633-654	SSKPSSTKKEPSKKRGRPRKTA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1T0	Uncharacterized protein	0.921	289-301	SKRELKRRAKKAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1T0	Uncharacterized protein	0.729	237-251	KPKPKPEKLPLNQKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9B5	Uncharacterized protein	0.815	720-729	RKDPKKKKTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9B5	Uncharacterized protein	0.685	272-284	KNPFRMPRLKRNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA30	Uncharacterized protein	0.955	62-83	SKKKGVRSNKKPREAPKASPAQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA2	Uncharacterized protein	0.928	1163-1180	PGLLGRLSRRKSKPRPGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA2	Uncharacterized protein	0.832	1313-1323	PRKKRFPRLRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKA9	Uncharacterized protein	0.934	299-338	AKPAPEHKSNKPAHENKPKENKPAHENKPALPKDEKKPAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQH9	F-box domain-containing protein	0.714	15-24	RASISRGRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT98	Kri1_C domain-containing protein	0.997	589-602	GEGRKKKRKRSRKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT98	Kri1_C domain-containing protein	0.974	293-328	REEKSLRKKQREAERQRKEEEKKQRETEKNRLRKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT98	Kri1_C domain-containing protein	0.943	531-550	RDPEKKRHDQKKLGKKARLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT98	Kri1_C domain-containing protein	0.901	444-464	KNKKSKAQERRDQKREARKDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CT98	Kri1_C domain-containing protein	0.627	394-398	KKHPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXF8	Uncharacterized protein	0.932	109-130	RKEKEEKKKNRKSLAHEGLAEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYQ8	Bromo domain-containing protein	0.912	546-563	PPRKRRRNEARTAERGRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYQ8	Bromo domain-containing protein	0.908	652-662	RSGRGRPKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYQ8	Bromo domain-containing protein	0.76	572-593	KTGLRAKPEKLAVSGSKRRDRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0Q2	Uncharacterized protein	0.993	340-367	EGKEPTRKQEKKKRSEEERRQRRERRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0Q2	Uncharacterized protein	0.906	504-512	RRRRRKAKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D3	ATPase synthesis protein 25	0.972	7-25	KKQKQKPLDKNKPAKKKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D3	ATPase synthesis protein 25	0.915	448-460	KIKLRRKARRARL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D3	ATPase synthesis protein 25	0.808	174-183	KKNEEKRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D3	ATPase synthesis protein 25	0.694	69-76	PRRRSNKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9R0	Zn(2)-C6 fungal-type domain-containing protein	0.975	65-77	PAKRPRKARRKRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE74	tRNA-intron lyase	0.962	1389-1422	KRSHKRHVPRLSRPRSHEPTTQPKRPRGRPRLKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE74	tRNA-intron lyase	0.772	1310-1316	PRKRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE74	tRNA-intron lyase	0.742	1922-1928	HARKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFT2	Protein kinase domain-containing protein	0.992	315-337	QRKERKRERKRREREAEAKNIRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFT2	Protein kinase domain-containing protein	0.875	427-441	RRRPQPPPKDRRRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFT2	Protein kinase domain-containing protein	0.764	488-507	KRAKSPHSKAAGGPGAHRKF
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHT5	YL1_C domain-containing protein	0.917	287-305	PEKEENARKKSKKADKEEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHT5	YL1_C domain-containing protein	0.835	104-114	RAERKKRRAQQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHT5	YL1_C domain-containing protein	0.655	143-147	RPKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHT5	YL1_C domain-containing protein	0.606	119-119	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHT5	YL1_C domain-containing protein	0.606	123-123	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHT5	YL1_C domain-containing protein	0.603	117-117	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI53	RING-type domain-containing protein	0.918	87-103	KHRKAAAAKKKEAEKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI53	RING-type domain-containing protein	0.914	1203-1232	PKVEPKKTKAKDKAVKDPKPEPVEVKEEPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI53	RING-type domain-containing protein	0.89	745-754	KQKKKGKKQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI53	RING-type domain-containing protein	0.885	1128-1145	SQAKKERRQKAKEAEAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI53	RING-type domain-containing protein	0.817	1162-1170	GRKRKTKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMC4	Ribonuclease Z	0.95	991-1013	KAEAKKSKKKLKQEKLAAESAKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMH1	Uncharacterized protein	0.988	244-256	SEKKKKDKKKGKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPB4	SH3 domain-containing protein	0.865	315-326	QKKDKPKRPPKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPB4	SH3 domain-containing protein	0.662	72-80	RPSRPSRPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR65	Uncharacterized protein	0.643	313-316	KRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSS0	Vacuolar sorting protein 4b	0.95	200-215	KKLSKKKSSPRRKELR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTQ1	Uncharacterized protein	0.998	83-98	SKKKKNKKKKKKASTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUP2	Uncharacterized protein	0.983	117-147	GRRRRRRGTGPFSGRYGARGGKGIKRGPRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUT0	Uncharacterized protein	0.991	156-168	KRDKKRDKKKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D071	ANK_REP_REGION domain-containing protein	0.953	32-60	KKWRWRKNKLSLDKWKIINRKISKRKRLG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7M4	Fe-S cluster assembly protein dre2	0.675	213-216	KKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7M4	Fe-S cluster assembly protein dre2	0.665	159-162	KKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAS9	Uncharacterized protein	0.751	87-93	RRRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC56	C2H2-type domain-containing protein	0.803	759-769	SRKRSARLRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHI5	RRM domain-containing protein	0.976	161-183	RDRRRDRTPPRRGRSPSPRRGRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMB0	ATP-dependent RNA helicase rok1	0.996	157-185	PKKKKKKKAKAQQEEPKTLTKKEQKKARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMB0	ATP-dependent RNA helicase rok1	0.937	670-727	KKDKKELKKHGVKARQSNLKSIKDNKEFRQAKISTKSGYERRMENKKKGAIAASRNRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMB0	ATP-dependent RNA helicase rok1	0.892	53-63	KKKHGQKRKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNC8	GRIP domain-containing protein	0.994	567-585	PPAGGAGPNKKKKNKKKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNC8	GRIP domain-containing protein	0.744	34-51	RRPSRNLSPSRRANRPRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP96	Uncharacterized protein	0.765	7-23	RRRIQNRLNQRASRRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPQ4	Uncharacterized protein	0.998	46-88	KKKTSLEGPPKYRQAKSAKMKKKKPIDRPRPPPVGERKTLRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQF5	30S ribosomal protein S15	0.842	77-102	NKRNLRLLVHKRQKLLRYLRKKERGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF0	Protection of telomeres protein 1	0.995	326-364	RKEMYWKQNPKRKAVEEARSASRAKKSKNKPRKPAEERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVH9	60S ribosomal protein L32-A	0.762	11-20	VKKRTKKFWR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVH9	60S ribosomal protein L32-A	0.707	34-46	RKPKGIDNRVRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWV7	Uncharacterized protein	0.933	530-553	RKESESRKRSRAAKASSKRNQDRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWV7	Uncharacterized protein	0.858	471-489	RRPSKKKSDAKSVRPSPGE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX10	Molybdopterin synthase sulfur carrier subunit	0.843	110-120	RPPKKSRARKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CX10	Molybdopterin synthase sulfur carrier subunit	0.609	20-21	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7J1	Uncharacterized protein	0.986	87-102	EGPPKKKKKKPLAKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8M7	Uncharacterized protein	0.73	33-44	EKGPGRSSKKGH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAE2	Ysc84 domain-containing protein	0.802	85-99	SRPKGKQRVLKKIPS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAG5	Uncharacterized protein	0.928	191-220	RRKQTAPNKNQKATASTKPKRAAAPKSRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CB04	Zn(2)-C6 fungal-type domain-containing protein	0.751	665-681	RHCRPRRHGRYLPPRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCR3	Uncharacterized protein	0.88	158-167	GKKSKKKNKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA6	DUF1752 domain-containing protein	0.722	133-142	KTRNIKRRPV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSR0	SprT-like domain-containing protein	0.963	256-272	PPPKPKKRLIKGRRPSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSR0	SprT-like domain-containing protein	0.92	454-486	KKGPKGPSKTALKKAEAEQRKAMMARRKSFDGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUV7	MFS domain-containing protein	0.603	697-698	RR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXH2	Uncharacterized protein	0.798	41-54	PRRHPRKLTRRNLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Z1	Uncharacterized protein	0.936	5-22	GKKGKGKTGTKQKNKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7E0	Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyldiphosphate specific)	0.954	41-54	RSRPRRKKTPPRKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9Z9	Uncharacterized protein	0.648	58-62	AKRRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF43	ATP-dependent RNA helicase dbp7	0.922	713-731	KKDYKAARAPAAGKKRKTP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF43	ATP-dependent RNA helicase dbp7	0.827	22-57	PKLKGGTWRDRLSAKKIAQHRAQPRKPSDGTAAPRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF43	ATP-dependent RNA helicase dbp7	0.721	275-285	KKKSEKARLRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF94	ATP-dependent RNA helicase DHX8	0.906	168-206	TSKKRSRSPDYRDDRDSRGRRNRDKYRSRSRSYSPRYRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF94	ATP-dependent RNA helicase DHX8	0.711	229-236	HSERRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNC7	Lysophospholipase nte1	0.864	373-381	TRPGKKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPM7	Uncharacterized protein	0.8	217-225	PKKKKERSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPM7	Uncharacterized protein	0.73	237-242	KKRKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPM7	Uncharacterized protein	0.659	400-405	RKSKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU68	2,5-diamino-6-(5-phospho-D-ribosylamino)pyrimidin-4(3H)-one reductase	0.947	205-219	RPLPEGKRPRKKRVR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF7	Uncharacterized protein	0.993	70-138	APKPTLKYKPRAVGRRSKEEREAIEKLEAERHRERLAEAAAIQRGRGGHRGRGGGRGRGDGARRGRGGF
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVR2	RING-type domain-containing protein	0.777	565-572	GNRRRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY42	Uncharacterized protein	0.936	323-340	PRRLHRRPRRPAPASRRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY42	Uncharacterized protein	0.694	621-634	RPRGDRRSDRASRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY42	Uncharacterized protein	0.685	592-597	RRRPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY42	Uncharacterized protein	0.658	115-124	RKDRTKERSP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCV4	C2H2-type domain-containing protein	0.965	110-130	PRDRSRVKARRSRRKNVSKSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE91	DNA-directed RNA polymerase III subunit rpc3	0.937	264-282	RGAKRRRGPGGAERSNKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHN2	rRNA adenine N(6)-methyltransferase	0.918	230-241	KNRPARKKKGKV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI08	DBF4-type domain-containing protein	0.97	578-599	KRRPSNNKAAPQKKRERRRDPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI08	DBF4-type domain-containing protein	0.809	368-389	KEVERHRARQQEKERKAASKAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIM3	Uncharacterized protein	0.84	104-120	KKRTVYRRIRRGERKHP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKB1	Probable catabolite repression protein creC	0.687	133-138	KRRKPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA3	ANK_REP_REGION domain-containing protein	0.991	645-721	RAKKSRKQDVSSPRRPRDRDKENRRPVRRDSPSPGGRPRKPVDSHRDVASKDPGLLKDRKRENLAHAKEKLASSRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA3	ANK_REP_REGION domain-containing protein	0.917	970-1016	RAARLAQEKAAEEERKRKEAEQRRIKQAEDERQKRIEQERARMAKLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA3	ANK_REP_REGION domain-containing protein	0.916	803-838	KPAPLKRGRSSVSPERSRAIDPDRQARELQKKKKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA3	ANK_REP_REGION domain-containing protein	0.911	752-777	RGEDAPKRRRLIAGRPPQDRDRRRPS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA3	ANK_REP_REGION domain-containing protein	0.813	89-102	KRRKFIRHEPKPRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA3	ANK_REP_REGION domain-containing protein	0.604	735-735	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTA3	ANK_REP_REGION domain-containing protein	0.6	737-737	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVV3	Uncharacterized protein	0.606	404-406	RAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW89	TruB_N domain-containing protein	0.879	46-61	RARRKRESKFQRNRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAK5	60S ribosomal protein L4-2	0.981	187-208	KSRKMRAGKGKLRNRRFRQRRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBR2	Uncharacterized protein	0.697	638-649	RKHGWSPPRRPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA5	Uncharacterized protein	0.997	479-513	KDRKERKRLAEKKRLLEKAKMKGRKNKKATKNASK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIA5	Uncharacterized protein	0.666	418-422	RKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPD1	Uncharacterized protein	0.729	1088-1098	RRPKSRHRLRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPX4	DUF1691 domain-containing protein	0.998	512-536	KKRNAERKKRRAAEKGAAKGKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR71	Eukaryotic translation initiation factor 5B	0.999	110-197	KKPNKAAAKAPPPPKDEDEGFRVKSKKEKEREKKEREKQRKREQAAKKKTAAPAEKAQPTKAEAKKEEAAPAPEPAVEAPSSKKKVPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR71	Eukaryotic translation initiation factor 5B	0.996	239-351	RKREEARQRKKEKEKERKEQLRKEGKLLTKAQKEAKERNELRLKQMLAAGAGKVAGLEDKQAEKKKPVYENKKKKKGPSKQEEDLEAAAARARAQREAEEERRRKEEEEKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR71	Eukaryotic translation initiation factor 5B	0.932	56-67	RKNRNKKAKKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR71	Eukaryotic translation initiation factor 5B	0.619	453-455	RRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTX2	BZIP domain-containing protein	0.985	41-100	KKSEEKKPAKKRKSWGQELPVPKTNLPPRKRAKTEDEKEQRRIERVLRNRAAAQTSRERK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU62	Uncharacterized protein	0.744	487-499	VERPLKRPERMKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU0	Uncharacterized protein	0.971	107-142	RRKGVPGPKPGAKRGLNQGESYSRSRGKPGPKKKPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7D6	Dynamin-2	0.907	543-553	DRRKREKRRLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7L9	SIS domain-containing protein	0.966	656-677	AKRKATGEPKTPTKRGKGKKAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCD7	Methyltransf_25 domain-containing protein	0.894	762-776	TKRAMKKSRRRWERA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE90	BHLH domain-containing protein	0.777	243-261	RKHRRRPSTTKTFSSRAKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFU5	J domain-containing protein	0.911	243-263	RRQKRMMERENRKEKKAPRAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFU5	J domain-containing protein	0.846	383-395	KSSRRRGRRSQKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJJ0	Uncharacterized protein	0.987	188-210	NAKRRKRKAIVEKKRRTTSASKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMM5	ATP-dependent RNA helicase dbp4	0.985	705-720	KQKRREKKEKRKARER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMM5	ATP-dependent RNA helicase dbp4	0.969	630-649	KRREKLLKSKKKLLKFKGKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMM5	ATP-dependent RNA helicase dbp4	0.867	774-782	RRPKKPKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNJ7	Chromatin modification-related protein	0.963	609-622	YGRRKAKPGKKRLG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNJ7	Chromatin modification-related protein	0.945	557-596	GRELRRKSATPARKSPIPETVRAGSASAPFRRRKRPAPGP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNJ7	Chromatin modification-related protein	0.673	431-436	RPSRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNJ7	Chromatin modification-related protein	0.631	148-151	RRAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNJ7	Chromatin modification-related protein	0.613	467-468	RR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSQ1	Autophagy-related protein 9	0.837	93-106	HKPTSRRRKLSRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSX9	Developmental regulatory protein wetA	0.73	506-519	KARREQEARDRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSX9	Developmental regulatory protein wetA	0.68	146-155	PKSIRRHREP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTQ9	Uncharacterized protein	0.811	472-485	RHRVRRARHKELRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY48	ATP-dependent RNA helicase dbp9	0.99	583-619	ENRIRKAREKNRGKGKGRNYAGVKKVDPLKTFNRGRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY48	ATP-dependent RNA helicase dbp9	0.667	381-384	KRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZP8	Uncharacterized protein	0.647	142-146	KRRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D059	Uncharacterized protein	1	125-188	KKRKAGEEGEEGGSVKKVKKEKETKEERRARKEEKKRRREEKEKKRAEKALRKEMKKQKKEERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D059	Uncharacterized protein	0.999	222-270	KEKRKEKKEKKKAEKKDKESKKRKKEEVSTADDSSRSKSKKSKDGKKAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y1	Nucleolar protein 12	0.997	495-532	RIRVKTKSRGSKGKPKNRSSKRAAAFRAAGGKKADGGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y1	Nucleolar protein 12	0.942	421-470	PRKIRVSRAKKVMKKREDSGAPNKTLREADKTLQGRAGKLFGRAGAAKLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y1	Nucleolar protein 12	0.935	135-152	KEEQKEEKKRREEKAKRQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1Y1	Nucleolar protein 12	0.829	341-347	KKKKKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C944	SANT domain-containing protein	0.981	1049-1070	YKAKLNKRWSRRGRARRSARPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C944	SANT domain-containing protein	0.87	1136-1156	KPTSRRGARSGAGSRGGRRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C944	SANT domain-containing protein	0.707	1219-1227	PRAKPGRGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C944	SANT domain-containing protein	0.672	463-470	PDHRPRRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C944	SANT domain-containing protein	0.639	219-224	RRSRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C944	SANT domain-containing protein	0.619	132-136	RGRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C944	SANT domain-containing protein	0.616	62-65	GGRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEA8	Uncharacterized protein	0.711	72-80	KKKGKSSPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL13	ATP-dependent RNA helicase dbp3	0.984	15-38	RPTKKSKGEKKVKETKEKKEKKVK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLL0	BZIP domain-containing protein	0.993	128-172	EDKKTRASPPGRKPGRRASKVRDEQREKFLEKNRIAANKHRKRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLY7	Rif1_N domain-containing protein	0.961	1287-1326	KESASKRSKRTPASNNKKSKRAQSLRKDTFKNTRSKQREG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLY7	Rif1_N domain-containing protein	0.778	1553-1563	KGSSKKRRQSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLY7	Rif1_N domain-containing protein	0.719	1377-1389	KPNSSKSSAKKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLY7	Rif1_N domain-containing protein	0.668	1522-1526	KKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM91	Choline_kin_N domain-containing protein	0.615	188-190	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP02	Non-specific serine/threonine protein kinase	0.738	10-18	RRKRREAIK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQL4	Uncharacterized protein	0.863	437-448	PKKKDAPPRKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1U8	Uncharacterized protein	0.997	185-200	SKGKKGKKKKDKKKQK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9E6	Histone-lysine N-methyltransferase set9	0.84	469-477	KRRKRRTRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBI2	PH domain-containing protein	0.834	196-203	KRRRKRHQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGG3	zf-C2HC5 domain-containing protein	0.894	79-97	APPTSSKKTKKPKAPLHST
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKY5	Uncharacterized protein	0.768	106-118	ALRKLRATAKKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL46	RRM domain-containing protein	0.998	5-78	KKDKKRKAAAAAAASDSPAKKTKKVDAKPVESPKPAAKPAPKKGKDKAAKAEEKPAPNVKVNGEPARQIKPRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL46	RRM domain-containing protein	0.993	410-460	DTPKKSKKEKKAGSEKGTPKQPTPKKGASEVTASPATKAGAKAKKAGKGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL46	RRM domain-containing protein	0.959	309-353	GANRRFKRTPWNRIEKKRLDKGKTREQWTERIEREQKRRLAKAEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL46	RRM domain-containing protein	0.919	199-212	SKKTKRKILKKQKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL46	RRM domain-containing protein	0.918	104-141	KKSSNKKSKKEDGTAAPAPKAKAPKLQSISKANTKGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLX6	Uncharacterized protein	0.872	589-598	RRPAKKRKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CLX6	Uncharacterized protein	0.746	405-415	KKKTPARKSTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CML2	DUF2183 domain-containing protein	0.659	591-597	KRKPVPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CP51	Serine/threonine-protein kinase psk1	0.976	78-90	ARKRDRGRKKKKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPM1	Uncharacterized protein	0.723	414-424	PSRRRSDGRPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTN2	Uncharacterized protein	0.955	231-254	RARKKLKESTEKRPVKKAVMKKRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D064	Uncharacterized protein	0.977	274-304	LRRPPTPIPISMGSRRRRRPRKSATTWNRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1J9	Uncharacterized protein	1	367-389	KKKKKKKKKKKKKKKKKKKKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA26	DUF2431 domain-containing protein	0.95	167-188	RVGFPRRRRRRPAWLEAKLAKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA26	DUF2431 domain-containing protein	0.805	3-27	KSKKARLHGPPPGAGGDAPQKKARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA26	DUF2431 domain-containing protein	0.755	369-376	KAGKGKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA42	Diadenosine tetraphosphate synthetase	0.947	136-148	KEAKKKKKSKETK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAE8	SAP domain-containing protein	0.862	601-616	RRRGGGGGGGRGRGRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAE8	SAP domain-containing protein	0.627	231-233	RKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAF9	THO complex subunit 2	0.969	2235-2320	QPPPPPPPPPPPAAGEGERRWAGGRDRDRDRNRDRQRDREYQRESGGGSGGVPHKRRRGDDGGRGEGSGRGGMRTGGDNKRPRRGA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAF9	THO complex subunit 2	0.902	2133-2211	RERERERDRERDRERERREDDGSRSSRREEHRDRNRDYERERSRRSDAGSSSREERFESREASRRGPGSREDNRRRRDR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAF9	THO complex subunit 2	0.795	51-67	RGRGRRQHNRGGRNSIG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAF9	THO complex subunit 2	0.603	9-10	RK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBE0	Uncharacterized protein	0.927	70-87	NKKSVKKTGKPAKKDGKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC00	Ubiquinone biosynthesis protein coq4, mitochondrial	0.86	268-284	IRRMIREQKKREKERLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF00	Cell pattern formation-associated protein stuA	0.902	197-218	SRRARSASPSKKTGSPRKPRQT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF00	Cell pattern formation-associated protein stuA	0.758	271-280	PKKSKSKKTS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF00	Cell pattern formation-associated protein stuA	0.649	407-413	EEKLKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF00	Cell pattern formation-associated protein stuA	0.621	401-405	KRAKV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHA9	RING-type domain-containing protein	0.784	596-605	RIRRRRWRAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI54	NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial	0.98	567-671	RRKNRMGQQARRALWEKKYGSGANHVKKQKEQEKRDRSSGWDPRRGAVDPADGKRGRWGGGRGGGRAAGGGRQGQDRQDRGGRPAPPKPQDNKPLHPSWEAAKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPU4	Replication termination factor 2	0.93	207-218	KKAPGSKKRKKQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPU4	Replication termination factor 2	0.658	275-278	KKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP3	HECT-type E3 ubiquitin transferase	0.951	2837-2874	EREKKLEEERKRREEERAERERQERIAREEEERERKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP3	HECT-type E3 ubiquitin transferase	0.744	3255-3264	AFRKGKGKEN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQP3	HECT-type E3 ubiquitin transferase	0.673	3387-3398	KKGKAEDDKHKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW80	NET domain-containing protein	0.896	143-159	SKRAAAGEEGSKKKKKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW87	Uncharacterized protein	0.994	341-367	RNFSVKKMKGGAKRPGKSKRAAAKGRV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW87	Uncharacterized protein	0.979	298-334	RKRSRTTEKGGPSLKRQKKNEKYGFGGKKRHAKSGDA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW87	Uncharacterized protein	0.936	23-38	KQKKLVRAAKKKKAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW87	Uncharacterized protein	0.908	223-271	AAKKAAAEARKQRDLKKFGKQVQVAKLQQRAKEKRETLEKINALKKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXT1	DNA polymerase	0.876	91-103	RGKAAKRKREEEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXT1	DNA polymerase	0.722	652-667	EKKTPGWHRLGRLKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYD6	J domain-containing protein	0.967	282-293	RQSSKKKKKAKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYD6	J domain-containing protein	0.95	213-226	EKKETPGKRGRKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYD6	J domain-containing protein	0.66	188-197	KKRQQRLKRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYK0	Translocation protein SEC62	0.953	335-343	KKKKKKSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D100	DUF4211 domain-containing protein	0.999	70-97	KPAEKKSKKSRSKSEKRKRKSSKKSKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C994	Uncharacterized protein	0.951	270-281	RFKERKKKHKKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBH9	Uncharacterized protein	0.992	299-336	KGKRKREEDAGYKPKTSGSRSRKKKDDGSAKRPSKRSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CBH9	Uncharacterized protein	0.608	32-33	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFG3	HTH CENPB-type domain-containing protein	0.67	124-130	KERLRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFV4	RING-type domain-containing protein	0.712	833-848	KAGRLMKVIKEKNKHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CMU5	Uncharacterized protein	0.668	466-469	KKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNX5	Clustered mitochondria protein homolog	0.91	1252-1274	RSKQKKRAAASNPKLRGSKKSSA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNX5	Clustered mitochondria protein homolog	0.878	909-915	KKKKKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQS3	Uncharacterized protein	0.996	168-188	KPKKKRSSKSKSKRQKSKRRD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQS3	Uncharacterized protein	0.727	496-504	KKKSKSFKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUP7	Uncharacterized protein	0.733	82-94	PKPKIRNGHRHRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0L4	Urb2 domain-containing protein	0.675	160-166	KKGTKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D167	Sas10 domain-containing protein	0.999	582-613	NKGLAPKRNKDSRNPRVKKRKRFEEKKKKLGS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D167	Sas10 domain-containing protein	0.933	343-370	PKKQSKKTKEPQLSDERKKNKKLSKAER
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D167	Sas10 domain-containing protein	0.715	3-11	KKRKAGGRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7V8	SWIRM domain-containing protein	0.838	220-242	AKRASGTQPRPQRTPRAKRTPRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D1	Uncharacterized protein	0.73	665-684	RKRKQEEERERKEQQAKQPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8D1	Uncharacterized protein	0.665	921-925	KRAKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA72	Uncharacterized protein	0.976	206-250	SHRRGIKAKAEKREERRRLEAKENGIILEKPTPKSKTSVGRRERG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA72	Uncharacterized protein	0.976	274-289	IQKPRRSGKGKTRGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKJ4	Uncharacterized protein	0.805	926-935	RRAPKAKRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKJ5	Phosphatidylinositol 3-kinase VPS34	0.788	228-242	GRKRAIRLKAMKQKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CL03	Fcf2 domain-containing protein	0.763	220-230	KLRAKRNTRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNP8	FHA domain-containing protein	0.996	8-136	SRDRRRPRSPSGSPDAEHSRRRRHRDEHRSSRRDSSRRRSSRSPSSRKSHRRDYEDRPRERRERTDASDDERRRRRHRSPDERRQRRHRDRDSYDDDKERSSRRHRTKSRSRSPRRRRSRSPSSRELAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWG1	Uncharacterized protein	0.995	48-164	PAKQQPKQPKQPSKAKDGPADGGAPAGGEGLSPAELKKRAKAEKQARRAKEKAEREQGAGGGAGGPGAHAAGKKGSAGGGAGGKDAGAGSQQKGQRHRRGSAQAGTPAAAAEQKKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWG9	Uncharacterized protein	0.762	179-205	RSRARRQSTSTRTPSKPKPAATAKPTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWP3	Uncharacterized protein	0.647	107-113	RREAKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYU8	PPR_long domain-containing protein	0.995	347-372	SERRRLTKEERRAASKERRKEKRRRL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ06	Amidohydro-rel domain-containing protein	0.882	974-991	RQRHAHRRTAKPPRSRRH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZ06	Amidohydro-rel domain-containing protein	0.795	903-913	QQRTRRDRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZS1	Uncharacterized protein	0.72	867-876	RRGKPPVRRT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0Q3	60S ribosomal protein L5	0.946	263-293	GSKKSKEEWKAESKKYRQKKLSHAERKARVE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D108	Uncharacterized protein	0.996	32-65	IKPIVEKTEPAPAAKKPKRKAKKSPEPSAAPSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D108	Uncharacterized protein	0.734	264-271	KKIKKKGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D108	Uncharacterized protein	0.666	112-116	KKKNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAH5	Uncharacterized protein	0.915	669-683	LKERKHAKRASRGKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB6	PSP domain-containing protein	0.981	85-102	KLRGKGRPKKKRTAAVGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB6	PSP domain-containing protein	0.899	134-150	SKNQLRRARKKALKAQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB6	PSP domain-containing protein	0.782	685-697	RKRLKNEEKRGKH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEB6	PSP domain-containing protein	0.771	253-258	SKKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGM7	Zn(2)-C6 fungal-type domain-containing protein	0.794	67-74	SRRKRGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGM7	Zn(2)-C6 fungal-type domain-containing protein	0.609	48-50	KPK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CI84	Uncharacterized protein	0.947	766-797	KLRPKPKLTAKDVRDKGARRPRDKLLRDKQVG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJK1	Uncharacterized protein	0.975	4-63	KKQDQPKKKKTVEDKKKGSSAKKQIAQLQAQAKSSKTPDEKRKEAEKAKRAAEKKAAEDA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKH2	Mago-bind domain-containing protein	0.949	90-105	ASNKNAKRREAKKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKH2	Mago-bind domain-containing protein	0.942	147-167	KEKKARNLKKKLRQARDLRDK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE4	Uncharacterized protein	0.994	115-135	KKSRKRKSKGKKDAKADAKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE4	Uncharacterized protein	0.963	1485-1494	RKKRKKHRKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWJ5	Uncharacterized protein	0.975	104-122	KKLGGKRRRARRAGNGARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXP8	Nucleolar protein 58	0.999	458-512	SKKEKKDKKEKKEKKEKKEKKDKSEKKEKKEEKEEKKKKRKHDSDAEPSKKKKKV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXW1	Uncharacterized protein	0.865	15-35	DRKRITDRRAQRNRRERIKLH
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYA8	Uncharacterized protein	0.844	2226-2238	KRFKRLRRRGHAE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C8S6	Uncharacterized protein	0.747	280-289	RTKRYRGRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEJ7	Uncharacterized protein	0.886	750-766	KNRRKKLVKEWEKQKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEJ7	Uncharacterized protein	0.605	696-698	KAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CIJ0	WW domain-containing protein	0.997	256-288	RAERSAKKLSRKEVKMFKEKRREKKEEKRRAWL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ66	RING-type domain-containing protein	0.68	46-54	RRPNCKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUL3	Uncharacterized protein	0.926	61-82	ERSKERARGKRLLRRNSGIRGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVL7	Uncharacterized protein	0.934	52-67	KNKHKRSNPRKSHRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVL7	Uncharacterized protein	0.6	17-17	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW88	Uncharacterized protein	0.923	318-334	RARRRRVRKSVLRPKSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW88	Uncharacterized protein	0.742	86-91	KRRKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYU1	Probable E3 ubiquitin ligase complex SCF subunit sconB	0.779	247-254	KKRRARPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD73	Uncharacterized protein	0.723	412-420	KKKPPPPPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDN7	Dual specificity tyrosine-phosphorylation regulated kinase 2	0.798	1210-1217	SKGRRRRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDU3	Rho-GAP domain-containing protein	0.857	522-536	SKEPRQPNRLKKKRI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CE03	Uncharacterized protein	0.97	63-79	ERPAFKRSRPRRKGRGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFK7	Fungal_trans domain-containing protein	0.603	57-58	RR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGX4	Uncharacterized protein	0.682	783-794	PREEPRPRGSPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHI7	60S ribosomal protein L18	0.995	152-184	GFGPHSHKKPYVRSKGRKFERARGRRRSKGFKV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHZ8	Probable glucan 1,3-beta-glucosidase D	0.988	114-177	RRRDRHRDGDRRRRHRAYEAEGSPPRGAPDHRRHRSRDDRRERAYESEREARRHRRRERGREAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHZ8	Probable glucan 1,3-beta-glucosidase D	0.961	211-229	RSRAKADAKAEKKQRRKRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN92	AAA_16 domain-containing protein	0.779	359-369	NKRAHHRRRLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNS5	40S ribosomal protein S27a	0.995	73-99	LRGGGKKRKKKVYTTPKKIKHKRKKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQJ8	Uncharacterized protein	0.996	86-130	KPSPRRGRPPKKRAEEKAELPAESKKRSAEAPSKKQSRGTAKVAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQJ8	Uncharacterized protein	0.951	143-165	STRKRDHLESIPSEKKRKKGRSR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQJ8	Uncharacterized protein	0.748	205-222	RGAAKGSKGNRRSSLGMR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR28	Mitochondrial zinc maintenance protein 1, mitochondrial	0.845	181-208	RIKKPQPKNLSGVIRTKLEKRWKRIERR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR28	Mitochondrial zinc maintenance protein 1, mitochondrial	0.664	120-132	KANPPKPLSPRQR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR51	Zn(2)-C6 fungal-type domain-containing protein	0.731	64-70	KRRPRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTX0	Uncharacterized protein	0.991	62-89	KKKRKRKEAATLAKIKQSKEFARRKARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTX0	Uncharacterized protein	0.964	154-168	KKAKAKKRGPRTGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVE1	Prolyl-tRNA synthetase	0.977	35-71	NAAKKAAKAAKQASEKAEKKGKQQQQAKAAPKAAKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU2	RPA43_OB domain-containing protein	0.996	397-420	TKTKEPKQEKEKKSKKSSKSKKEK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWU2	RPA43_OB domain-containing protein	0.991	21-72	KERKRKHKTKDTSSSSPSKKKRKHESSAAAEPASPQEKKPKKSKNKEKTKSD
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D058	WD_REPEATS_REGION domain-containing protein	0.864	330-344	ASRPEKKNKEKGRFR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1U0	Uncharacterized protein	0.672	60-64	KTKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C9L2	Uncharacterized protein	0.924	168-180	FRKRDRRRAKNKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAQ8	Uncharacterized protein	0.759	661-671	RERAKGKSARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAQ8	Uncharacterized protein	0.675	722-727	GGRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCP2	Uncharacterized protein	0.934	355-367	RPRAKKPRRPNRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEZ0	Uncharacterized protein	0.864	175-185	RIRRRRRRIPP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFZ1	Uncharacterized protein	0.909	415-444	SRSRRNRTTKSKPSHAGQKKQAKQKATSKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFZ1	Uncharacterized protein	0.881	370-380	PRRRQRPRRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFZ1	Uncharacterized protein	0.753	70-87	TKRNRMASKAKPTSKEPT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHR9	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.999	540-595	KSAKKSAVKGMADDGTKKGKKRKAGVEGGDDDKDTKEPKKKKKKEEPKPKAPKPKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHR9	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.962	492-515	KAKQEKARRKKEARDAANRAKEKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CHR9	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.942	414-430	QGKIKLKKAAKLGGKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKU4	Sterol 3-beta-glucosyltransferase	0.948	117-143	KNEKKALRSPQRPKSPSQERGRRHRKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN68	Uncharacterized protein	0.96	114-150	KPPRRRTVRTRSQAKRTQRSSTKKRLELGRPLNKRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNA6	Uncharacterized protein	0.998	232-268	EVKKKKAKKVKGPNPLSVKKPKKRAAEKPSEKKKDAA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNA6	Uncharacterized protein	0.981	281-295	AAPKPKRRRRHHRSK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNA6	Uncharacterized protein	0.697	154-158	RKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ88	Uncharacterized protein	0.916	527-551	RSKNKAKTPEPAEKRFRPPSPRRRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ88	Uncharacterized protein	0.703	1273-1278	PGRKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQL1	Uncharacterized protein	0.782	32-40	RRYRRRKRE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQL1	Uncharacterized protein	0.725	382-388	RARRKRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQR6	Uncharacterized protein	0.921	63-82	EKKDAKPEAIPHRPRKSKGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR55	Pre-mRNA splicing factor ATP-dependent RNA helicase prp16	0.918	897-910	VVKKPPIKRKPGRA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CRX7	Tyrosyl-tRNA synthetase	0.995	316-342	KKAYPPPPPKVKKEKKQKDKKPKDKAP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXF4	Uncharacterized protein	0.899	329-348	EEESKPRRRLMRGPKSRVSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CXF4	Uncharacterized protein	0.861	455-467	KPKSNRARKPPKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D0B9	Uncharacterized protein	0.785	130-142	RRRGRWVRRPQRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1E9	PUM-HD domain-containing protein	0.998	15-61	NGKRTKTKTAPVVSKKAKSAPVKKSSKPEPKKSAKTNKKDKKPSKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1E9	PUM-HD domain-containing protein	0.88	661-685	KTLKKGKKGLEKAAAESGTEGKKKG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1E9	PUM-HD domain-containing protein	0.831	132-173	ASRESHAKQKALLQERKAAKPNADMIQRSKKLWERLRRKSHV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1H1	Uncharacterized protein	0.925	112-143	GRHSRHHDDRRGHYKYSRSPSSSRSPPRRRRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1H1	Uncharacterized protein	0.697	167-175	ERSRSRGRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0D1I8	FAM192A_Fyv6_N domain-containing protein	0.964	138-159	IPARKRRRDKNKDLLIPGKKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7X1	SAE2 domain-containing protein	0.657	673-681	REKIKERYR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CC40	Pre-mRNA-splicing factor SLU7	0.875	560-578	SEKAKRRKTTGSGRMRHLK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCR1	Methionyl-tRNA synthetase	0.999	576-603	RQKKEEEAAKKKAAKEKKKEKKAKKAPA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCS8	WD_REPEATS_REGION domain-containing protein	0.879	60-76	PKKKTSHMKKRHRQMAG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDF1	Uncharacterized protein	0.996	18-50	GGGKPPGDRGGGGRRNPPPDKPAPPKKRKRAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDF1	Uncharacterized protein	0.988	110-130	GQRRRRRGKRAAPHVRRQRAR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDP3	Nucleolar protein 16	0.893	6-28	QKKKNRSSVPKTKAKRTGQLKNG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDW7	Uncharacterized protein	0.901	239-255	KKHLKKRFGRKFEKIPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CF74	FAD-linked oxidoreductase ATEG_07660	0.643	463-467	RLKRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CSQ6	1,3-beta-D-glucan-UDP glucosyltransferase	0.986	277-294	GKADRKTRKARKAAKKKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CTN6	Zn(2)-C6 fungal-type domain-containing protein	0.829	19-26	RRKKRRAS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYH8	DUF4050 domain-containing protein	0.921	99-109	GRAERRRKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0C7I5	Uncharacterized protein	0.873	6-16	KKRTKRKAAKS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCN9	Ribosome biogenesis ATPase RIX7	0.964	489-514	RHLLRRTGRARAAPRRHALRGVRPRG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CDR8	Uncharacterized protein	0.952	251-281	RKHQRTQDKQDKRERRAMEKQDRRDRRRGRP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEX7	Chitin synthase	0.998	151-182	ERVPSRHRSKKRRSSRKVTKKEAAAERRRRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEX7	Chitin synthase	0.841	49-61	RHHRRRRSHSARR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEX7	Chitin synthase	0.799	75-89	EVRRKRSMVKPERRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CEX7	Chitin synthase	0.636	25-28	RRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFA4	Uncharacterized protein	0.824	235-243	KKGKSKKKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CFA4	Uncharacterized protein	0.685	435-444	GSRRSRRTNK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGC6	Uncharacterized protein	0.915	48-71	RPTKEKPKAKAKAHSEHVESRPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJG4	ATP-dependent DNA helicase PIF1	0.819	288-299	KKVKRNPKARNR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJG4	ATP-dependent DNA helicase PIF1	0.698	173-186	KKQRKMRQQLKKNQ
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKG2	Uncharacterized protein	0.907	150-160	GRRKRRGGRKI
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKY0	Ribosomal_L28e domain-containing protein	0.965	126-150	RRSQKVKKATPARKPRGAQARKAAE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNP9	Uncharacterized protein	0.998	1036-1064	RRPTKPKSNKEKPLKRKPKFPRALRRPKL
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CPR0	Uncharacterized protein	0.852	33-42	RRRLHKKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CUW3	C2H2-type domain-containing protein	0.612	508-510	RRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF4	Uncharacterized protein	0.982	3-37	PKKKGDARGGPKPRDLSKPKLRLNGRQKTAKKPQA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVF4	Uncharacterized protein	0.778	194-205	KKRKEREKTQAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZM8	J domain-containing protein	0.966	62-75	QKRKRLRKERRIKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZM8	J domain-containing protein	0.711	662-667	KKKARK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA97	USP domain-containing protein	0.888	718-738	RTKEDEKQKGKLKSRERIGRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CCA5	Isoleucyl-tRNA synthetase	0.692	1175-1181	KPKKGKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CK78	Lysine--tRNA ligase	0.991	29-58	SELKRRQKMREKEAKKKEKEANAPPKAEKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM36	Uncharacterized protein	0.931	304-313	RKERRRRRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CM36	Uncharacterized protein	0.762	223-233	RRRGKVRPPPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQ41	DDE-1 domain-containing protein	0.819	199-209	GRQRQKKARRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CQT6	Uncharacterized protein	0.683	65-71	RKPRPLR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU52	Protein pxr1	0.999	193-223	SRSEKRREKKEKKDKKEKKEKKDKKDKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU52	Protein pxr1	0.901	175-182	SKKKKKKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU52	Protein pxr1	0.612	273-275	RGR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU52	Protein pxr1	0.601	265-265	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CU52	Protein pxr1	0.601	269-269	R
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CVT0	Eukaryotic translation initiation factor 3 subunit C	0.737	822-840	RGGRGAGRGGQARGGPRFP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW69	AdoMet-dependent rRNA methyltransferase SPB1	0.994	683-725	KEAAAAIKEKLRAINARPIKKVMEAKGRKKMKAAQRLEKLRKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW69	AdoMet-dependent rRNA methyltransferase SPB1	0.992	750-806	RATKKKPKQQVKLVVAKGNNRGISGRPRGVKGKYKIVDSRMKKDIRAQKRLAKKKKN
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW69	AdoMet-dependent rRNA methyltransferase SPB1	0.976	369-388	EKESSRMKKERRKENERKRK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW69	AdoMet-dependent rRNA methyltransferase SPB1	0.759	236-241	KKKRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW69	AdoMet-dependent rRNA methyltransferase SPB1	0.642	7-14	HGKGRLDK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CW69	AdoMet-dependent rRNA methyltransferase SPB1	0.609	19-20	AK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZP1	Uncharacterized protein	0.965	2685-2721	AKSKKNTGDQPKKDSKKDKSETSKDKKTKEEKKTKPV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZP1	Uncharacterized protein	0.953	242-265	RRRARGAPQPAPKPRGPLKPPKGG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZP1	Uncharacterized protein	0.932	80-100	TPKDNKPAPTRKRSKSTPRKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZP1	Uncharacterized protein	0.83	354-396	ASKRRVKSRDEGHVERVKSSSHKAGPKEPGRDSSSSSSRKRSS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZP1	Uncharacterized protein	0.752	1042-1051	PGLKRSKAKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CZP1	Uncharacterized protein	0.63	147-150	AKKE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA85	SNF2-family ATP dependent chromatin remodeling factor snf21	0.995	1152-1222	RKEARVERRRVNKEKRSRKAGGDSSPEPSRESSETPQPKKRGRRGPAPKRKAEELVEETPQPKRKRGRQAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CA85	SNF2-family ATP dependent chromatin remodeling factor snf21	0.604	351-351	K
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAD5	Pre-mRNA splicing factor CWC2	0.993	62-77	PKKKKIIRRKKRPARP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CAD5	Pre-mRNA splicing factor CWC2	0.656	315-318	RKKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CD41	Uncharacterized protein	0.655	51-62	KHKNSPPNKNKP
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGU6	Uncharacterized protein	0.862	300-324	TRRPSRSHRPPTPSPGSRKDGRKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGW5	SRP54 domain-containing protein	0.709	211-219	RVSRRARKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CGW5	SRP54 domain-containing protein	0.671	234-243	RKGKTAKGGK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CJG3	Enhancer of mRNA-decapping protein 3	0.923	222-234	AGLNGRRRKKKTR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKM7	Uncharacterized protein	0.84	1212-1245	PSGPIKRPTQPGSYGGRRGGLGVKRAKAPTGAPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CKM7	Uncharacterized protein	0.649	1200-1207	NKSKEKTG
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CML3	UV-damage endonuclease	0.91	518-538	LPSRARRPASVKKQSTRKRKA
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CML3	UV-damage endonuclease	0.641	421-426	PPRKTK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CML3	UV-damage endonuclease	0.607	475-477	RAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN67	Uncharacterized protein	0.88	272-282	KPKRGRKRAEE
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CN67	Uncharacterized protein	0.615	406-407	KR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNS2	Proteasome subunit alpha type 6	0.999	154-169	KKKKKKEKKKDKKKAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNS2	Proteasome subunit alpha type 6	0.996	37-65	KKASSKLKKSKGDDKSDSKKERKSKKRRR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNS2	Proteasome subunit alpha type 6	0.91	326-341	KQAKAANQPAKKKKKT
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CNS2	Proteasome subunit alpha type 6	0.805	98-108	KKKTKTKTKKR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWH9	Uncharacterized protein	0.982	38-60	GKTKKKSKSGSKAKAKAAKAAAK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CWH9	Uncharacterized protein	0.612	1060-1061	KK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY00	Uncharacterized protein	0.885	134-150	RRPVSPPPRRRRSFRRS
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY00	Uncharacterized protein	0.749	182-192	PRARPRRPSHV
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CY00	Uncharacterized protein	0.744	205-216	PYPRKGKTRMPR
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYV8	60S ribosomal protein L3	0.925	22-42	RKRAARHRGKVKSFPKDDPKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYV8	60S ribosomal protein L3	0.672	241-248	KLPRKTHK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CYV8	60S ribosomal protein L3	0.619	129-131	KKK
UP000007963	Aspergillus terreus (strain NIH 2624 / FGSC A1156)	Q0CR30	Uncharacterized protein	0.925	3-16	KPRPQKNKKKSKSK