ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y4	Protein kinase domain-containing protein	0.895	104-114	KPVKKKKIKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D1	Uncharacterized protein	0.988	203-247	KVKPKKEKKSKEPQKTETKKQRQNRQKAEAAKALREEAEKQRKAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D1	Uncharacterized protein	0.973	35-68	VRGASQRHRLEEKQSHARKEPKEKAKRQRGEAHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T5	zf-met2 domain-containing protein	0.669	12-20	KRARNEKHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q232	Glycosyltransferase family 32 protein	0.927	414-424	GDKKEKKKRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q289	Uncharacterized protein	0.968	14-50	KETRRHKSRSSSHGRSSHGRSERPHRERTHRREKERA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2U9	Uncharacterized protein	0.668	805-812	DGRKNVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q350	Condensin complex subunit 2	0.801	228-234	RKKPKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G8	FNIP_N domain-containing protein	0.992	1169-1193	SKRREKERERRKEREKEGERNRERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G8	FNIP_N domain-containing protein	0.82	323-334	KAKKKRLQPRQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C8	Uncharacterized protein	0.882	476-528	SRAPPQRRSPPERGPERVPERVPERVPERVPERVPERAPEPTRSRSRSRSRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7H3	Tryptophanyl-tRNA synthetase	0.928	458-483	KKLEKQKQIEAKKAQKAKEKAEKAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M0	Uncharacterized protein	0.654	580-585	SRRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z9	Uncharacterized protein	0.768	215-232	RTKERWGPRRQAAREERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q814	C3H1-type domain-containing protein (Fragment)	0.946	897-942	KPRSGLLLPGKARPAAKPAPKPEPNKAEAQKSATKPESTPKPQPAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q814	C3H1-type domain-containing protein (Fragment)	0.65	1013-1018	RKERRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA78	Histone acetyltransferase	0.944	405-428	RSSKAVKRKTKRRLSGPVVPRAPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAK1	Lipase_3 domain-containing protein	0.904	227-242	PPPPPKSKKKSQGKAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAK1	Lipase_3 domain-containing protein	0.657	7-12	KKKVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE03	Uncharacterized protein	0.797	289-312	RRRRRTSKGHTSPSRPWPRASSPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE03	Uncharacterized protein	0.747	680-688	RRRRAPKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF22	Zn(2)-C6 fungal-type domain-containing protein	0.668	14-20	RPHRKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF22	Zn(2)-C6 fungal-type domain-containing protein	0.621	70-73	RGRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV1	Uncharacterized protein	0.738	50-55	KRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH09	Uncharacterized protein	0.768	587-608	RSGHQDAPRPRLRRGDGEGGRM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHR6	Uncharacterized protein	0.838	45-56	VRSRRPRRASRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV3	Uncharacterized protein	0.648	642-645	KRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG4	Uncharacterized protein	0.989	186-206	PQPRPRPRSKKHRTPGRRRAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG4	Uncharacterized protein	0.907	294-311	RKREERESRAKRTARRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG4	Uncharacterized protein	0.721	342-350	KKGKAQRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	0.995	120-145	RVKSKRAKKKSSEKKRKAELKEAAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	0.968	522-534	ARKPKPKKQKRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	0.949	1016-1057	RRRERIGSTVERGSVKGKGKGKEFRPLGSETKASKFSKRQRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	0.946	249-270	RPQGKRPRRDSDSKPRKNRKSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	0.925	882-890	KKRRKGKKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	0.782	65-72	HRRRRRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC2	Uncharacterized protein	0.668	161-165	KKRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT9	SH3 domain-containing protein	0.666	140-146	RKKLARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMI0	Thioredox_DsbH domain-containing protein	0.823	523-538	EKLRAHREKERPRPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN58	Uncharacterized protein	0.745	114-122	PAAARKRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ7	Uncharacterized protein	0.949	997-1011	KSKRASARRKSRARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ7	Uncharacterized protein	0.795	435-443	KKRPSRKRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H4	Protein phosphatase	0.617	54-56	RRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2D4	Uncharacterized protein	0.649	440-447	RTKRMRMG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2D4	Uncharacterized protein	0.602	449-449	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V6	PWWP domain-containing protein	0.985	129-155	KSKSRRKSTGGGAAKGKKLNKKASKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V6	PWWP domain-containing protein	0.913	329-338	KDKKAKKRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V6	PWWP domain-containing protein	0.885	376-392	STKAADSKSAKSKGKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V6	PWWP domain-containing protein	0.793	294-307	KAAKAATPKGKKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B1	IBR domain-containing protein	0.914	175-194	DKRSKKKKEEEEEAEKRFRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q608	Uncharacterized protein	0.924	126-139	EKRRARRQRREMKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R9	Uncharacterized protein (Fragment)	0.998	635-697	RRKLKVRGVESRRTGGKASITTKSSWERRREHKRAQAIEASKRRKRQRREEEKRGGGGGGGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R9	Uncharacterized protein (Fragment)	0.917	48-56	RGKKRKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R9	Uncharacterized protein (Fragment)	0.916	147-168	KMSKKKKEAEDKKSEEKKEDHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V1	PPPDE domain-containing protein	0.878	226-241	RRRGGSGKGKGKAPVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q724	Uncharacterized protein	0.915	1272-1286	AKKSGRKGPKREVRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9L9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.996	855-872	GAKARKKAPAKPKKKSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9L9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.769	1114-1121	KKRKKPVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9L9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.653	541-551	RRRSRTPDRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN0	Uncharacterized protein	0.961	234-269	KRPDSSPKKPGTTAASRKPKPANGAAGRPKTRGGPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB77	Ribosomal_L18e/L15P domain-containing protein	0.977	7-33	KTRKHRGHVSAGKGRVGKHRKHPGGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEX4	DUF676 domain-containing protein	0.995	1179-1195	RKEAKRRKREEKRRRHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEX4	DUF676 domain-containing protein	0.941	695-712	RRRKLIAKRRSHGRAKPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEX4	DUF676 domain-containing protein	0.609	958-960	KRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB6	Lysine--tRNA ligase	0.952	31-61	ELKKRQKQRQKEAEKAAKAANAPPKPSSKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF7	Mitochondrial Rho GTPase	0.971	407-418	TKPRKRRRRPGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK5	Uncharacterized protein	0.847	108-118	RKRKLSKKGRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT9	TPR_MLP1_2 domain-containing protein	0.932	2037-2066	GAGNKRPRDGADGGGPGEGGRGGKRARGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK55	RF_PROK_I domain-containing protein	0.944	167-190	LKKSANEARVKAKKMQKSKKAFRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK63	VanZ domain-containing protein	0.755	120-126	ERKRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB6	zf-C2H2_3 domain-containing protein	0.953	266-284	RKEHNRRHAASSRKRRKTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL94	Uncharacterized protein	0.999	788-806	DSDKEEEKKKKKKKKGGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL94	Uncharacterized protein	0.988	700-716	AKKRLKEKRERRKARER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL94	Uncharacterized protein	0.961	11-30	PHRKKPILKKEVKSLKRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL94	Uncharacterized protein	0.842	776-786	PPRKKAKKWFQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL94	Uncharacterized protein	0.771	627-638	RREKLLKSKKKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA1	Response regulatory domain-containing protein	0.896	558-575	RASSPRPTPATRPKKKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA1	Response regulatory domain-containing protein	0.742	779-787	KKAKAKKNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH6	Uncharacterized protein	0.993	161-173	ERKPKREKRKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH6	Uncharacterized protein	0.673	112-116	SRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH6	Uncharacterized protein	0.602	88-88	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C8	DJ-1_PfpI domain-containing protein	0.994	207-222	KEKKKKEKREERRKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0L6	40S ribosomal protein S30	0.988	12-42	GKVKSQTPKVEKQEKKKVPKGRAGKRLKYTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X1	Uncharacterized protein	0.998	584-625	RRSSRSARRVVSRASGRREDREQGGGEGKERYGRKKRRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X1	Uncharacterized protein	0.694	28-40	RPRATSPRSGRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q117	Uncharacterized protein	0.798	34-48	KRVKRVRSMSRGRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1U1	Uncharacterized protein	0.824	133-147	KVKKVFRGKRDKARF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3J5	Uncharacterized protein	0.798	76-90	RKKRKEYISAPKPRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q568	Fungal transcriptional regulatory-like protein	0.914	628-643	ARKRRARKAQGPGPGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G8	Cir_N domain-containing protein	0.996	177-319	KAKRREEKERRHKHRHSHRSHRHHDDRDDERHSRRRRSDSRDRSRSPRRYDSEEEDRRRRRDSRERRRDRPASMDSRDRRDRRDRREDRGRRSSRERRDGGDRREDGRDRYRSDSRSASPPPRRREYSPDRDERRRRDRSVER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7T4	CN hydrolase domain-containing protein	0.918	129-135	KKKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Q4	Uncharacterized protein	1	111-131	KDKAEKKKKKKKKAKKKKAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF04	Tudor domain-containing protein	0.95	231-266	KPRPKFKKIKATKELEKGKTKWQEFTSKGKFGKVAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGC7	G-patch domain-containing protein	0.984	336-367	KKKAARKKKAVAGGIGSRPGSGTSTPKRPKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGC7	G-patch domain-containing protein	0.669	53-57	RKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT7	BZIP domain-containing protein	0.851	58-71	IAQRNYRKKLKKRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB9	RNA polymerase II subunit A C-terminal domain phosphatase	0.798	760-782	RRRRSKSASPSTGGGGGSSKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB9	RNA polymerase II subunit A C-terminal domain phosphatase	0.62	348-351	KGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJE7	Uncharacterized protein	0.978	79-126	EKERERSRARSNARRGPVSRGRTPRRDPPDTGAGEPVRRQVRKRRSRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKM7	Kinesin motor domain-containing protein	0.86	915-929	GGGKSRKVRKLPGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL1	DH domain-containing protein	0.61	1197-1198	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM35	BZIP domain-containing protein	0.976	150-178	RGSKAADDKRRGNAAALARFRKRKKERER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR6	Uncharacterized protein	0.959	1319-1333	APEKTEKKGRKKKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D7	NADAR domain-containing protein	0.739	4-17	KRSKPQHQKSKRIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B3	Zn(2)-C6 fungal-type domain-containing protein	0.713	602-606	RRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W7	Origin recognition complex subunit 4	0.986	160-173	AGKKKRGRPRKRDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q436	TAF1-like protein	0.991	1004-1023	LEKNKERRKKREKQKKLQQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q436	TAF1-like protein	0.903	498-512	KPPTVKKKKQLKGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q436	TAF1-like protein	0.814	345-354	PKKRRRETPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q436	TAF1-like protein	0.706	1076-1094	RPRNKALSDGGKYPKFRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q455	U2 snRNP auxiliary factor large subunit	0.904	29-55	DRRDRGDTRDRGGGRRRSRSPDYRSGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q455	U2 snRNP auxiliary factor large subunit	0.731	127-148	RRGGGSRRDRDYARDRDRRRSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q455	U2 snRNP auxiliary factor large subunit	0.702	98-110	RDRGDRGARSRRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q455	U2 snRNP auxiliary factor large subunit	0.619	114-118	RRDRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q466	BZIP domain-containing protein	0.814	49-63	PQKRRGPKPDSKPAL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B2	Developmental regulatory protein wetA	0.997	237-290	KKTPVRKAKEAKTPKEARPPKEPKPKTPRSSKKRAEVNGVPGGEGSQSTKRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B3	SAM_MT_RSMB_NOP domain-containing protein	0.882	3-24	RGKKGHRGGGGGGGGRGGGGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B3	SAM_MT_RSMB_NOP domain-containing protein	0.718	481-508	KAKPEESRKQPAPQSSKADGKANAGKRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J7	Uncharacterized protein	0.727	48-56	KGRGKGKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q722	PHD domain-containing protein	0.96	237-278	SKSRSAAAGRNLRLEKVSEKEEKERQRVESANKRKGKGDRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q722	PHD domain-containing protein	0.895	354-364	DKKRSHKKKGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB07	SpoU_sub_bind domain-containing protein	0.831	77-95	ARKRLAEERPSFKIRKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB07	SpoU_sub_bind domain-containing protein	0.757	236-252	RRDRGAGRREDAPRHKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA6	Separase	0.986	1311-1345	KKPTRGGGGGGGRGGRKAAVAKTPGRKAAKGAIRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA6	Separase	0.625	1458-1464	KASSPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK8	Uncharacterized protein	0.953	475-486	PKRRGRPKKAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK8	Uncharacterized protein	0.724	402-411	RSGGGKRGKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK8	Uncharacterized protein	0.605	447-449	RGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX4	RRM domain-containing protein	0.995	95-132	SERDRRRSPPRRRSPSPRRRDYSPRKDDRRDRDRDRDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI23	Uncharacterized protein	0.994	110-126	KPRDRTKRKAKAKKRKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIU6	Uncharacterized protein	0.634	343-349	RSRLSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJY7	1,3-beta-D-glucan-UDP glucosyltransferase	0.981	294-307	KGRSGKRKNKKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF2	Uncharacterized protein	0.994	1740-1755	KDKKKSRKRGRDTRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF2	Uncharacterized protein	0.984	196-245	GKQPPPKSPANRTPQRKPAAQDSKSSARSRRRSPSPKRPATPAKQSLGTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF2	Uncharacterized protein	0.86	91-116	AKRRRIRGATPNNTVRKPKPESPPWK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW9	Uncharacterized protein	0.758	12-27	DKAGKKGGTGKEEVKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW9	Uncharacterized protein	0.698	376-386	RGKEEREKREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF3	Chromosome segregation in meiosis protein	0.926	65-101	KRRPRAPRVKLDEARLLSDKGIPKLRKMAPRLKFKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNE2	Uncharacterized protein	0.954	97-115	GGEKAKKKKVNPKEGGGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX0	Uncharacterized protein	0.838	21-33	RLRKARREAKIKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE2	Uncharacterized protein	0.871	597-620	RRKREIKEHYERTRKKLRWQPPKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q192	BRCT domain-containing protein	0.938	117-143	VRARGRPKKAAEPSAEKPAKATRVTRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q192	BRCT domain-containing protein	0.738	82-91	PTRGRGRPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q192	BRCT domain-containing protein	0.602	1038-1038	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D8	Uncharacterized protein	0.798	206-233	KRTPSRRLSKPPPPNSATGRRSHHARAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M5	RING-CH-type domain-containing protein	0.616	507-509	KRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q702	Uncharacterized protein	0.938	553-577	PSGKILRRLLRDKEREARRAKGAKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q719	AB hydrolase-1 domain-containing protein	0.615	123-126	RGPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q760	Uncharacterized protein	0.607	415-416	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD89	Uncharacterized protein (Fragment)	0.874	421-435	LHRKRARIRERARQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD89	Uncharacterized protein (Fragment)	0.605	809-810	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF36	Uncharacterized protein	0.998	805-819	TKKKNRRKKRKGGKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB0	Uncharacterized protein	0.64	49-53	KQKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH96	Sec3-PIP2_bind domain-containing protein	0.696	462-475	KKRSRGEIAGALRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI67	Uncharacterized protein	0.829	802-811	ERARKRKERD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI67	Uncharacterized protein	0.675	220-225	KKRGRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI67	Uncharacterized protein	0.656	934-944	KKEAEERRERL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI67	Uncharacterized protein	0.637	285-289	KKHKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJP8	Uncharacterized protein	0.993	1068-1111	VPARSKAAGKRGKAKGQTRGGQGQKKTPAKAPTKRARAASAGSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJP8	Uncharacterized protein	0.926	988-1012	VGRRPAKKIKVNVPPPRPRTRQERS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJP8	Uncharacterized protein	0.606	976-977	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA9	Zn(2)-C6 fungal-type domain-containing protein	0.945	9-24	PPKQPKRRSRGGTKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNL7	TauD domain-containing protein	0.89	299-311	RIKKKRRAYEGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD2	HIT-type domain-containing protein	0.945	436-462	RPGPAKRPRRQGADGAGGRGGKRFRSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPL0	Uncharacterized protein	0.791	686-722	GRKLSKERVPLSPSTRLRGRQPKSTATNVARKRGNKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I1	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.75	529-538	KRREKPERKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A2	DNA topoisomerase I	0.989	185-215	APIAKKAKKAAPPPKKGKDTAPAKDAKPVKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A2	DNA topoisomerase I	0.938	120-177	IEKAAAKEAKSIRADAKTKKATPRKSIKEESDDEPLAKPRKRQSNGVSSVKKTNGVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A2	DNA topoisomerase I	0.814	356-371	KKARPAAEKKAEKAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4A6	PPR_long domain-containing protein	0.783	87-100	QARPPKRVPAEKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q573	Nucleolar GTP-binding protein 1	0.9	497-524	KHKLIRNEAKMRKSLKNRALIPRSKQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S3	P/Homo B domain-containing protein	0.91	77-88	KRELARRRKKRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S3	P/Homo B domain-containing protein	0.765	784-793	GGGGKRGRRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q721	G domain-containing protein	0.826	387-401	RKKDKQARKARNEAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7P3	Protein kinase domain-containing protein	0.729	313-337	KRAEKTRESRLKLPESQGHRRQRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F0	Ubiquitin carboxyl-terminal hydrolase	0.758	244-250	KLRRRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H4	Zn(2)-C6 fungal-type domain-containing protein	0.909	22-33	PRRKRRSSKKVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8P6	Uncharacterized protein	0.639	1133-1137	RKGGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9K1	Cut12 domain-containing protein	0.63	521-524	RAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9K1	Cut12 domain-containing protein	0.611	500-503	RRQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB90	IPPc domain-containing protein	0.744	193-209	PSPPPPRRSAELRRERE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB90	IPPc domain-containing protein	0.604	871-871	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN1	Uncharacterized protein	0.946	679-712	PGHYSERPRDRERDRPMPRGRERDRDRYRRDRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN1	Uncharacterized protein	0.676	768-789	RDRDRNRDRDRDLPRRGEEDRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN1	Uncharacterized protein	0.603	675-675	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF02	Protein BFR2	0.699	545-556	KTVDRRASKGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF02	Protein BFR2	0.614	170-173	RIKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK64	Bromo domain-containing protein	0.936	1032-1066	KQRRARPRLGATGKIVSPQKRSPKEQLALAKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK64	Bromo domain-containing protein	0.798	463-479	RGRKAGTKGANKSRKAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK76	CRAL-TRIO domain-containing protein	0.81	296-306	PAKWEKKKKEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN77	Uncharacterized protein	0.838	274-284	RRRRTKRRQRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB1	Uncharacterized protein	0.802	649-658	EKKKAGKRVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC3	Uncharacterized protein	0.922	29-45	KNRVSKKKKDDGPKPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0V0	Uncharacterized protein	0.991	298-317	SRKGRRSPAKKRKSKSPEER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0V0	Uncharacterized protein	0.722	210-217	ADSRKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0W1	Uncharacterized protein	0.958	321-342	GRRAQTRRKPAPGRKPSRTPPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0W1	Uncharacterized protein	0.739	502-511	RRRRQKAAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R2	DNA-directed RNA polymerase subunit	0.876	333-352	GRPVKAIRARLKGKEGRLRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2P5	Uncharacterized protein	0.695	400-411	KRRPKGLSAAPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W6	Uncharacterized protein	0.982	10-33	DKKKRAKKGHYKRECRSPKKEWKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q351	Uncharacterized protein	0.821	902-911	KAKRKQRKHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B4	Uncharacterized protein	0.71	129-139	RRKVVRAGKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X5	G-patch domain-containing protein	0.999	263-327	EKAKKEKKDKKDKVDKRDKKDRKEKKDKKDKKDKKERRRKEKEASESGAETADRISKEKRRREKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X5	G-patch domain-containing protein	0.998	215-235	EGEKKRKKKKEKEKSSRRNAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X5	G-patch domain-containing protein	0.984	177-207	KSKKRKADRGSDREDDQAQKKEKKSKKRKTD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T0	WD_REPEATS_REGION domain-containing protein (Fragment)	0.677	1063-1068	KEKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H6	Uncharacterized protein	0.946	1018-1044	PRGGRGRGRGGARGRGDGPVFRGRGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAB0	AAA domain-containing protein	0.994	18-51	GRDDKDKKKDKPKYEPPPRPTTRIGRKKKKAGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.952	595-614	GKTKGKGRAGGRLKKSKEQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.944	1718-1728	QKKRGGKRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.898	501-515	KERKKDMQRKRRREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.875	341-380	EKGEKEKKQSRKSIKTSRNSDIRSADSTPKMPRRPAPPKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.687	447-458	NRRDIAQRRARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.617	391-393	KRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.614	442-443	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC6	Chromatin-remodeling ATPase INO80	0.607	399-399	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX2	Uncharacterized protein	0.993	98-131	RAKGKAKPTDPHGKPKGKDREKGAGKNNRPRPSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX2	Uncharacterized protein	0.602	465-465	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD84	Uncharacterized protein	0.998	76-110	KPASKKLSNKRKVEKRRRKKSSIVFPMRGPKRNKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ12	Adenine DNA glycosylase (Fragment)	0.872	343-354	ARKFPLRKPKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ12	Adenine DNA glycosylase (Fragment)	0.759	313-326	KEEKRGPKSPAGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJQ3	Kinesin-like protein	0.898	531-554	RASPRRRKVAARKSVSFTPVKKKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJQ3	Kinesin-like protein	0.775	497-505	KRGTPKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLW9	Brix domain-containing protein	0.996	408-441	KRWEQRKKEKEARKKQQKENIEKKRKAKEGKKNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLW9	Brix domain-containing protein	0.879	270-287	RRLNAAEKMLKSKKGKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLW9	Brix domain-containing protein	0.627	48-52	RRSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR2	Uncharacterized protein	0.739	10-18	RPRPRKPPM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY0	Uncharacterized protein	0.695	236-241	RKRKAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY0	Uncharacterized protein	0.647	274-278	GRRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0W8	Fibronectin type-III domain-containing protein	0.996	938-970	SKPEKEKDKESKEKSKAEKKDKAKAKEGKEKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0W8	Fibronectin type-III domain-containing protein	0.946	341-390	KREKRKEQKKKEEQTERLKKDVHATDRAMRNAMQRKGQKEKALKEKQNER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0W8	Fibronectin type-III domain-containing protein	0.669	1152-1156	KKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R1	Uncharacterized protein	0.73	20-28	VSPRRRGRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S0	Anaphase-promoting complex subunit 2	0.945	267-283	GSRRRQIGRKEKGKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE58	Uncharacterized protein	0.605	16-16	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF37	Uncharacterized protein	0.671	235-241	RRRKPTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF37	Uncharacterized protein	0.662	145-152	RLRARRLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH95	Uncharacterized protein	0.907	130-159	KKGLKSKGEAEAASVAGRRKTADPRSKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK7	AAA domain-containing protein	1	400-457	RKEKKEKELKEAEEKRAKEEKEKKEREEKEEKEKEKKKKKRKDKGRKKSSKKTKKSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK7	AAA domain-containing protein	0.941	487-497	KERSKKKRKPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHQ1	BHLH domain-containing protein	0.703	101-114	RRRLRTRDGHERKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHQ1	BHLH domain-containing protein	0.664	334-340	KSKEKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHY8	Protein SQS1	0.756	488-495	RERKKSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHY8	Protein SQS1	0.755	271-279	KRSKARRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHY8	Protein SQS1	0.657	459-463	RKRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI59	Uncharacterized protein	0.987	894-905	KKKRKRRKGGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLS1	Glycosyltransferase family 32 protein	0.999	392-452	KQKEKEEEEKKRKAEEEQRRKAEEEKKKKQKEEEKKKKEAEEAERKKKEEEEASKEKEKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB5	Zn(2)-C6 fungal-type domain-containing protein	0.798	142-148	KRKKRPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ45	Uncharacterized protein	1	331-350	KKKKKKKKNKNKKKKKRERE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ45	Uncharacterized protein	0.993	235-246	SRRRRKKKKRIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ7	Pre-mRNA-splicing factor 38	0.739	145-151	RKLRKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1P2	Glycosyltransferase family 90 protein	0.687	71-81	ARRSNLPKKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E4	HTH La-type RNA-binding domain-containing protein	0.935	141-151	GRKGRKGKKGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E4	HTH La-type RNA-binding domain-containing protein	0.805	344-358	RGPKPRGGAPRGGRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q302	SAC domain-containing protein	0.699	124-129	RRPKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A5	Uncharacterized protein	0.995	69-107	PASKRAGKKLQLGKFKKKDRIAEKGRPPLPGERKAYRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7K6	Uncharacterized protein	0.702	7-15	KTGAKKGPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q1	C2H2 transcription factor	0.905	357-370	KGIKGRGKGRKVKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q1	C2H2 transcription factor	0.677	214-219	SKPKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7U5	Uncharacterized protein	0.908	40-70	EKKKRRSLFGFGKKKTTEAPAKAAPPSSKPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W7	H/ACA ribonucleoprotein complex subunit CBF5	0.999	442-483	RADEEKKKRKKHEGETPEEKAERKRLKKEKKEKKKAEKSKES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E0	Uncharacterized protein	0.999	296-336	GSPPKPAADGAPGKPMPSDKKKEKKKKSEEERKARKEQRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E0	Uncharacterized protein	0.958	239-265	RKGSKANKEQKKKMKERAEGEALKHPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E0	Uncharacterized protein	0.925	464-474	AKKPRGRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q922	Yippee domain-containing protein	0.819	299-310	RRRKSKSGNARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA8	Uncharacterized protein	0.981	940-968	LRRRRSFADVLARAKSSRKERKLKRARSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE17	Uncharacterized protein	0.993	294-326	KAERAGIKPSRAELRMFKEKRRAKKEEKRRAWL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE56	Uncharacterized protein	0.964	625-645	RAERAGKRERRRMWWRRKAGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH6	PNPLA domain-containing protein	0.688	26-31	KPKPKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD9	Uncharacterized protein	0.938	258-271	PPKRKRNPKKAAGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD9	Uncharacterized protein	0.937	129-142	PAKKRKLVKRSKKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD9	Uncharacterized protein	0.914	419-432	RRPAVRKKGPAKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD9	Uncharacterized protein	0.817	87-105	KAKPAQKQSSNARRKRGEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD9	Uncharacterized protein	0.812	219-229	PKRKQKPKTKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJD9	Uncharacterized protein	0.633	165-168	KAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH6	Non-specific serine/threonine protein kinase	0.997	735-759	VKKKKGHRGRRGGVKHRKGGNKDKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMQ1	Aa_trans domain-containing protein	0.862	443-456	RSRGGRGGRWRRKW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP74	Zn(2)-C6 fungal-type domain-containing protein	0.712	31-36	PPRKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q098	R3H domain-containing protein	0.925	14-35	SHRGRGWRGSRFRRGRQHGPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q098	R3H domain-containing protein	0.915	82-101	GRGSGGRGRRGGGRRGTGQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I4	Uncharacterized protein	0.982	223-257	GGSRRIRLDRFGSRARAAWRRKKAEKQQRLKTQRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1V1	Uncharacterized protein	0.826	463-472	KKAEEKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q279	Uncharacterized protein	0.998	339-384	PKPLTKKRSKKKKKVKTWAGSILTRKGKYHYGKKHKRRAPTPTPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q279	Uncharacterized protein	0.779	792-803	EKKTKGSKSKRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Z8	Six-hairpin glycosidase-like protein	0.617	122-125	KLRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D4	RNA helicase	0.891	701-716	KRQRMRKMAKKIEKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M1	Importin subunit alpha	0.772	25-49	LRRRREEQQVEIRKAKREENLAKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V5	ULP_PROTEASE domain-containing protein	0.939	501-514	SKGKRARKAKPGPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q908	Uncharacterized protein	0.975	140-182	PSPAPRRGPPPPRGRPPSTPPPPRTAPPRPSQPPPPLRSILRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q908	Uncharacterized protein	0.73	392-412	EREQRRERELLREAGRRGPVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q908	Uncharacterized protein	0.645	239-244	RPRPRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R9	BZIP domain-containing protein (Fragment)	0.911	109-142	PRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB70	Uncharacterized protein	0.976	633-664	RGRGRGRGRVGKRELGGREEGRRPWWKFWQRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA2	Uncharacterized protein	0.997	49-114	RADKDSRSRDRGRDRREADRGHRRSSRERGRDRERHRSRGDPERDRERDRERERKREKDSERGRHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA2	Uncharacterized protein	0.858	225-235	PLSPPRKRKRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDA2	Uncharacterized protein	0.688	203-219	PRRIKPEPEPAHSARPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN2	Alba domain-containing protein	0.913	13-37	KPHHGKRKLHSDSNERSPKKRRAGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG51	Uncharacterized protein	0.992	115-139	NKTSAKGKATTTKKKKKQPKKPERF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGI1	Ribosomal protein L19	0.972	135-181	KRALVEHIHRAKAEKARERQIKEEMDAKRARTKAARERKLERQAAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGI1	Ribosomal protein L19	0.892	62-83	RARELNLARRIGRHRGFGKRKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLB6	Uncharacterized protein	0.728	341-346	KRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB4	Uncharacterized protein	0.856	339-349	RLKRRRKSRSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB4	Uncharacterized protein	0.608	806-807	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE4	Uncharacterized protein	0.991	739-782	KSGKTKPKIPAPLRKPVSKPKRRPALREISSNATSRPRGPRPHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE4	Uncharacterized protein	0.628	366-368	RKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX5	Trimethylguanosine synthase	0.998	174-190	RSNKKNKKKKKAKKHRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q065	Uncharacterized protein	0.937	44-55	DIRRFKKRRARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D3	Mago-bind domain-containing protein	0.974	123-147	EAEKEKKVRNLKKKLRQAKELKEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D3	Mago-bind domain-containing protein	0.957	87-102	SKNAKRREARKRAKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M8	S1-like domain-containing protein	0.936	3-16	KNKGKGGKNRRRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6X4	Zn(2)-C6 fungal-type domain-containing protein	0.613	90-92	KRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q956	Uncharacterized protein	0.624	210-213	KRDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN8	DUF2431 domain-containing protein	0.854	40-65	PTAKKQKTGHQDEIKGSNKKNKKNKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN8	DUF2431 domain-containing protein	0.689	325-329	KKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV1	SNF5-like protein	0.645	151-156	RPGKRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ2	Uncharacterized protein	0.994	389-549	RSRSASPPADDSRRSYRSSRKERDSEKRRDRDREKDREKDREKDREKDRDGHRHRSHRSHRDREHDRDRDRDRDREKERDRTRDRDRDRDRDRDRDRDRDRDRDRDRDRDRDRERDRDRDRKDRHRDRDRDRDRDRERERDRDRDRESRRDREKDKDRHHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ2	Uncharacterized protein	0.979	287-340	HSGRDRHRERGRDRDMDTSRSRSRTRSRSRSHSRSRSRSRSYDRKEQRRSRRQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ2	Uncharacterized protein	0.881	686-698	DEERKSSRRKGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ2	Uncharacterized protein	0.734	357-368	RHHRSSHRRKHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ2	Uncharacterized protein	0.653	377-381	SKPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT7	Uncharacterized protein	0.939	184-202	KRRNKRARRARLTYMRKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT7	Uncharacterized protein	0.845	216-244	KRSRKVFSSGKAAGAAGGASKKATDSKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF79	Uncharacterized protein	0.991	109-145	RRDRRRSPPNLRRENKNMATRRRRRRLEQQRRGRQAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFJ3	MCU domain-containing protein	0.982	477-489	RKKKRRRVHKRGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFY0	DNA-directed RNA polymerase subunit	0.675	1529-1537	RRKMRLEKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG66	Anaphase-promoting complex subunit 1	0.979	1712-1729	KGKGKAKKGSSGKSKKKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG66	Anaphase-promoting complex subunit 1	0.773	314-320	KKRKAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF2	Uncharacterized protein	0.72	124-135	FRAIVKRERERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF2	Uncharacterized protein	0.649	608-613	RRPNKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB1	Uncharacterized protein	0.699	77-83	SLRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHB1	Uncharacterized protein	0.663	282-297	RRGGGGGGGTGRPGKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI79	Glycosyltransferase family 90 protein	0.723	87-93	RKRRGRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QID2	Chloroperoxidase	0.824	247-257	KHRRRLPRRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ74	DUF2235 domain-containing protein	0.637	338-342	RGRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK32	Uncharacterized protein	0.602	115-115	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK54	RNA cytidine acetyltransferase	0.997	1017-1065	RAAKSGKGAPMVSVKTKAKRKVEETDGHEEKGGDKGHSKSKKAKREKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK54	RNA cytidine acetyltransferase	0.951	70-86	HRKKRENKIKKEIKRGI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK90	PCI domain-containing protein	0.907	18-32	GGKDLKPKGKKASKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNT3	Peptide hydrolase	0.733	476-489	KKRRWDAHRARMLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS4	PNP_UDP_1 domain-containing protein	0.634	175-178	IKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZY6	Uncharacterized protein	0.986	1421-1455	KEGRRLRLEVRRKDLPPLVEEPTPGRRRRKGRKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZY6	Uncharacterized protein	0.95	1770-1830	GWKGGRRPGYLKARGGRSGSSRGSGSGGGFSKRKGSAGRQAGGGDASAGSSRGRPAPGSKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZY6	Uncharacterized protein	0.644	1750-1755	RAKAPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G2	Uncharacterized protein	0.969	551-579	SKNWKWKGKEPSPPKPRSHDTRKTRRSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6N1	Uncharacterized protein	0.645	36-39	KKRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBS2	Ribosomal protein	0.728	94-103	NKNKKLIKKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBW3	Peptidase A1 domain-containing protein	0.953	38-54	RRAPRNPLHRDKRRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX1	Pre-mRNA-splicing factor	0.708	1297-1304	RKKEGKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX1	Pre-mRNA-splicing factor	0.668	774-777	KKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFM3	Chromatin-remodeling complex ATPase-like protein	0.955	1115-1125	GAKAKSKGKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFM3	Chromatin-remodeling complex ATPase-like protein	0.737	135-150	QRKRGGRQGGATSERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFM3	Chromatin-remodeling complex ATPase-like protein	0.681	1071-1080	KKKTKANGVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK4	Uncharacterized protein	0.895	630-646	KAAPKKKENKNAKAKAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL4	Uncharacterized protein	0.986	495-531	KKQRETSQERADRKRAELQKEMERRAAAGPAKKKRKF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIN3	Uncharacterized protein	0.954	42-63	PANRSPPAAVTKRPRGRPRKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL72	SH3 domain-containing protein	0.931	327-340	AAKKEKSKRLPKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL72	SH3 domain-containing protein	0.716	486-490	KKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV2	NUC153 domain-containing protein	0.995	596-610	RAEKLKGKKKKKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV2	NUC153 domain-containing protein	0.976	487-506	KYKRKERERKERKRAMALAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV2	NUC153 domain-containing protein	0.959	656-687	KKLLEEGRKKRKAGPEDSPNGKRDQRDSKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV2	NUC153 domain-containing protein	0.906	541-560	PSKSALRKEERLKKRAAREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV2	NUC153 domain-containing protein	0.823	702-709	KKKVKAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLX8	Rab-GAP TBC domain-containing protein	0.75	871-880	KKNKGRRGQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLX8	Rab-GAP TBC domain-containing protein	0.72	998-1008	KRKERREGIRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLX8	Rab-GAP TBC domain-containing protein	0.711	669-680	PRSAKTKRFIRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP20	Uncharacterized protein	0.92	191-209	KPRRGRKKPEDEEPGKSPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP20	Uncharacterized protein	0.707	300-311	KPKSASRRHGAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP20	Uncharacterized protein	0.647	324-331	AGGKTRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Q8	Uncharacterized protein	0.845	109-127	WRSRRARRLAAQRERREIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E7	Nitrogen permease regulator 3	0.652	473-477	KARKN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.998	4855-4871	AKGKKSKKKKKGKGAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.998	7527-7540	GKKPKKKKKKGKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.997	5284-5298	KKSKKKKGKKGKGKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.997	6165-6180	KQSKKAKKKKKGKGKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.996	4422-4437	SKKSKKSKKKKKGAAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.996	6573-6587	TKKSKKDKKKKKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.996	6811-6828	IKKGKKGKKGKKNKAAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.996	7203-7219	AKKSKKDKKKKGGKGKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.995	5161-5174	KKSKKDKKKKKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.995	7732-7746	KKSEKDKKKKKKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.994	4735-4749	GGKKNKKKKKGKGSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.993	4298-4311	SRKKSKKDKKKKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.993	4603-4616	TKKGKKKKKGKGSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.992	4162-4178	PTKKSKKDKKKAKKAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.992	5530-5545	TKKSKKDKKKKGKGTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.992	6371-6384	KSKKDKKKKKGKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.992	6479-6493	AKKSKKDKKKKGKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.99	3880-3898	KRAAAKREKKDKTAKKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.99	5630-5643	SKKSKKKKKGKGSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.99	6041-6053	SKKSKKKKKKGSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.989	3145-3158	GKKGKKSKSKKKKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.988	7097-7110	KKGKKDKKKKSKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.987	6691-6705	PAKKKGKKDKKKNKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.986	6991-7002	KKGKKKKKSKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.985	5030-5042	ASKKSKKKKKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.984	3217-3229	HASKKSKKKKKKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.983	5902-5911	AKKKKKKKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.981	5816-5826	KKKKGKKGKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.976	3292-3302	SKKSKKKKKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.975	7449-7459	KKSKKGKKKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.973	4063-4073	GKKSKKGKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.966	679-723	REAREIRYKEERRSRDEQRAARSEHERMARSAEKKRDREEKRKLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.965	4-23	HRRRSPESTRRRRAERRRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.957	3762-3771	KTKRKRKKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.924	2714-2722	GKRGKKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.915	88-99	KKVKKRRSFRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.907	7375-7388	AKKAKKDNKRKGSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.889	1465-1475	GKKRKSSRRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.879	3412-3419	KKEKKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.856	3567-3577	PKKSKESKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.814	2634-2643	RKRGKKLGSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.806	774-799	RKPGGLEPEAAKPSREQRRAEREKTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.761	731-743	RSREREERRRLKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.756	8165-8173	KKKGKERRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q360	Uncharacterized protein	0.652	509-513	RRSKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3T0	CBF domain-containing protein	0.909	11-32	KAAGKRKRQENGDVSKKRRKSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3T0	CBF domain-containing protein	0.71	256-261	RKKKHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q643	ATPase, P-type cation-transporter	0.914	242-259	NKKRRKAGRSMNWRKYGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6X6	Uncharacterized protein	0.814	277-302	DKRVRKELRRQESGSSSRSSRKQKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	1	1109-1176	GKKSKKSKTKEKEKEKEKEKEKEKEKEKEKEKEKEKEKEKKKKDKDKGKEKENEKGKGKEKEKEKEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.999	1995-2037	RRRRKRREERERERERERERERERKKERERLREKYRERERRTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.989	701-712	SKKEKKKKKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.988	1751-1843	REARRAARRARRAEREAAERAAAEQAAEEARRAKDEARRERRRRQEQEEEARRQEEKEARRADRRAQRAREEAERYAAELKEAERAERRRRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.971	1877-1905	DEERRLRREARRAAKEAREREDRSSRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.965	803-813	DKKKKKKGKDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.963	757-767	KKEKKKKNKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.955	635-644	KKDKKKKKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.944	951-965	KAKKASSKKKKLNKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.921	1504-1544	KEPKKPSSRSKPEKETSTRKKTSSTTEKVKKTEKPSSRGSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.846	281-288	KKKKKAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.844	470-477	KKGKKKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.821	163-169	AAKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.753	1854-1866	ARRAARHHERRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.719	427-432	TKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.707	551-555	KKKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.651	1370-1378	KSSKKSSGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q741	Uncharacterized protein	0.644	1436-1442	KAEKTKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V7	Adaptin_N domain-containing protein	0.994	700-746	KKKKTKKKGTGTGTGTGKEAKVDEKGDGGEEAVVKAKKKKKKEKAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V7	Adaptin_N domain-containing protein	0.898	768-776	KAKKKKKAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V7	Adaptin_N domain-containing protein	0.687	147-151	RRRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V6	WD_REPEATS_REGION domain-containing protein	0.988	213-229	KRKPKKPPAPPKRRPER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V6	WD_REPEATS_REGION domain-containing protein	0.984	11-58	QKKRKRTAAAETTPKKRLATTKTSSSKPSSKGPANAAAAVPKKKKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB8	Uncharacterized protein	0.736	10-17	IVKKRTKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB8	Uncharacterized protein	0.665	34-46	RKPKGIDNRVRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN2	Uncharacterized protein	0.807	963-969	KPKRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD11	Uncharacterized protein	0.97	292-307	AEWRRKRKAAERRRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI3	Uncharacterized protein	0.84	160-175	KKRPRREQKENAGKQG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI3	Uncharacterized protein	0.773	252-268	RGGGRGHANVSTKRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI3	Uncharacterized protein	0.758	139-145	RKRKRRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QME7	BZIP domain-containing protein	0.955	95-150	KKPVKKRKSWGQVLPEPKTNLPPRKRAKTEDEKEQRRVERVLRNRRAAQSSRERKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN28	ANK_REP_REGION domain-containing protein	0.947	412-424	RERKRAGRKKSKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN28	ANK_REP_REGION domain-containing protein	0.809	1087-1107	RRKSAANTPARMRSPSRPRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPN8	JmjC domain-containing protein	0.997	1417-1442	SRGRGGLRGRGRGRGRGRGRGRGRGM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPN8	JmjC domain-containing protein	0.992	569-581	RPVKKRRKRKAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPN8	JmjC domain-containing protein	0.967	1042-1081	PPKKRGRPRKSDVSGAQSNAPPVPEPEKPARRRGRPPRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPN8	JmjC domain-containing protein	0.958	1131-1149	PRKRGRPRRNPPPEAPAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPN8	JmjC domain-containing protein	0.754	1169-1180	RLKGKKFRIGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPN8	JmjC domain-containing protein	0.611	887-888	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H9	Uncharacterized protein	0.611	238-239	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S5	Uncharacterized protein	0.767	317-331	RREKRKEEVRSRSRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S5	Uncharacterized protein	0.703	290-298	ARKEKSKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q447	Transcription initiation factor IIF subunit beta	0.955	148-175	MEPPAERGKKGAYSRRPIPKKTRIAGKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7K0	GP-PDE domain-containing protein	0.649	364-368	RPKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB19	Uncharacterized protein	0.776	1139-1155	RRLSERRRERRTEELRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB19	Uncharacterized protein	0.715	1064-1074	RRARSAVRRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB19	Uncharacterized protein	0.62	1102-1104	RRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB75	Uncharacterized protein	0.962	4-21	KKFVRRERKRKVLERKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB75	Uncharacterized protein	0.819	51-74	ARLREELRPQGVKVSSKKAKRLEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDM6	Myb_DNA-bind_3 domain-containing protein	0.699	158-166	KRLTKPRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF46	Uncharacterized protein	0.989	294-307	NSKKKKKGRRKSAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF46	Uncharacterized protein	0.965	58-72	PKRGRGRGRPAKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF52	Uncharacterized protein	0.995	1517-1595	GGSGKRARRGKAAGRGQRGGRGGGAGSRDDKAGESRGRGGGGRSGTGASGAGGSRGAKGKGNGKGRGGGGGSSSGGGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFG2	Uncharacterized protein	0.999	558-587	RKRKAEKEERKEAKKRGKEERKAAKAAAKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL8	Carbohydrate-binding module family 48 protein	0.715	694-699	KKKKHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN4	Plus3 domain-containing protein	0.942	187-238	RKPSRTRTKAGESSDKMDTLRRAREERSNRKEQRERENDRRRHRSPSYRRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN4	Plus3 domain-containing protein	0.899	50-67	SARGVAVKKTAAKKKGRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN4	Plus3 domain-containing protein	0.684	173-177	KKRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF6	Calpain catalytic domain-containing protein	0.99	607-669	VKKARKKADQKKASEARQKERHRLWEKRHLNRQITKKQGRKNNQKLEAKQAAREEKRRKAEEL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF6	Calpain catalytic domain-containing protein	0.971	972-986	KKKKEKMMGKKGKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF6	Calpain catalytic domain-containing protein	0.97	33-45	NKKKKKRKLPPQQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKA5	Flap endonuclease 1	0.998	359-395	KAAHKRKLEEQNEAKKKKLKEEKKEKAKSKAKPRGAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLB5	Uncharacterized protein	0.796	1252-1265	KTEGERKLRQRKRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLB5	Uncharacterized protein	0.67	1169-1178	RRLPSWRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNC1	AIP3 domain-containing protein	0.606	961-961	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU0	Uncharacterized protein	0.999	105-143	ERRRREREREDEERTRRNREKREKKKRRKEQAAKEKSKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQF1	Leucine carboxyl methyltransferase 2	0.805	126-133	EKRKRGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q013	Uncharacterized protein	0.963	340-359	RRRHGANHRRRRSSRSHRHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q013	Uncharacterized protein	0.615	127-129	KKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U2	Uncharacterized protein	0.937	433-485	GKGKAVVGRQPPGGLKGGSGKHKEKRWLTAARQGGVNHGEQHRARVKKYKKPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U2	Uncharacterized protein	0.858	193-201	AGEKRKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H4	Uncharacterized protein	0.719	98-110	RRSRSPRKTTRIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N9	Class I unconventional myosin	0.952	971-1002	PTPKGKPVPPRPITKGKLIKPGGPGGRPSRNP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N9	Class I unconventional myosin	0.789	6-31	RAKDKAARAERAAGGGGQAAPSKPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A0	Uncharacterized protein	0.893	1008-1029	RRRLEAGRRSGGKGSGKGGGKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q542	Uncharacterized protein	0.631	673-676	PRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q600	SRP54 domain-containing protein	0.965	230-245	TGRKGKPAKAAKRGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q600	SRP54 domain-containing protein	0.69	206-214	AKMSRRARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q661	Uncharacterized protein	0.836	10-20	RVRRRRRFRVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q839	Uncharacterized protein	0.957	68-83	KLSKKERRKRKQAERE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q995	40S ribosomal protein S24	0.99	103-136	VEKASRQQRKQRKNRQKTLRGTAKVKGAKSKKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY5	Uncharacterized protein	0.98	1044-1058	RRGRKGPKKRKEHEI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY5	Uncharacterized protein	0.948	630-662	SRKKPKKDGRRVSVVEEEIKIEKMAKRKPRGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG12	Non-ribosomal peptide synthetase	0.663	7664-7668	KLRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP9	DBF4-type domain-containing protein	0.919	377-405	RDRGREKDRNRDKGRDRDRDRERTPSKTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI51	Ubiquitinyl hydrolase 1 (Fragment)	0.999	249-275	EKRARSSAAMQRRRKKKPKKERVKAGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI51	Ubiquitinyl hydrolase 1 (Fragment)	0.746	29-37	RSGRARKRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL0	Uncharacterized protein	0.736	75-90	RRRRSHVPPPRSPRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY9	Uncharacterized protein	0.994	698-725	KPKKETKSRPRKSMKGVKKLTKKMKRER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY9	Uncharacterized protein	0.906	645-657	NDKNKKKKTKGGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNM4	Uncharacterized protein	0.993	862-894	PAKKKKAKKAAPQPGPAPAPDAKAKRKTLVKRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNM4	Uncharacterized protein	0.841	681-691	KLSKKPKKPAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNM4	Uncharacterized protein	0.627	908-911	PKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC1	Uncharacterized protein	0.694	153-169	GGAGRGGAHGGGGRGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R4	Fe2OG dioxygenase domain-containing protein	0.947	3-34	RKAAGSADGKNPAKKRPKNTLGREDAKARFRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3R4	Fe2OG dioxygenase domain-containing protein	0.905	517-541	NGKKGTASAVNGESKDKGKGKGKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Y0	Uncharacterized protein	0.749	183-195	GKEEKEKGKERGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q468	Uncharacterized protein	0.83	1753-1774	KGPVPKRSLEKLKAKRESIEKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B3	Uncharacterized protein	0.956	288-339	RGSNTRGRGGRGGGRGRDGKSEGGDNTNGQKNGSNKNGRGRGRGGRGGRGGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y6	Uncharacterized protein	0.936	234-248	RARRRSRPRRRSMSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y6	Uncharacterized protein	0.885	180-208	RRRRGELGRGRYRDRDDRYRRDRRNDRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE8	Uncharacterized protein	0.918	397-422	QKGEKRDPGKLLREEKMRKRIAKELP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE8	Uncharacterized protein	0.772	234-250	SKRDKLLEEKKNRERRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG46	Uncharacterized protein	0.996	205-232	RHRRRRRRRRRFSGAPDPGGNGGDKKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU0	ANK_REP_REGION domain-containing protein	0.998	542-563	RKGKKKKKKSRNEGRAKSRGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU0	ANK_REP_REGION domain-containing protein	0.606	778-783	RSGGPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU0	ANK_REP_REGION domain-containing protein	0.601	820-820	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJI9	Uncharacterized protein	0.978	545-575	RKVVKRGRPKKIRPDMDERRDKAERTRRKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU4	Uncharacterized protein	0.992	721-738	REERRRRRGRPRKTERRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU4	Uncharacterized protein	0.903	662-676	EARRRAAKRRSEREA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP77	Uncharacterized protein	0.934	310-319	PGSKKKGKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF4	Uncharacterized protein	0.959	530-553	PRGGFRRGRGRGRRDYRGGRGGSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF4	Uncharacterized protein	0.609	417-418	GR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ31	DNA-directed RNA polymerase subunit beta	0.637	306-309	KKGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ57	PPIase cyclophilin-type domain-containing protein	0.927	217-229	PLEKKQKKRKGGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ57	PPIase cyclophilin-type domain-containing protein	0.813	504-533	EKRATRHPHGGLSSRGSEWHRDRDRERRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ57	PPIase cyclophilin-type domain-containing protein	0.694	203-210	KRERKVRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ57	PPIase cyclophilin-type domain-containing protein	0.607	379-380	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZJ1	Uncharacterized protein	0.955	334-353	RGRGRGRGGGRGRGGRGGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZJ1	Uncharacterized protein	0.951	242-273	RRRAAEEARRKLEDERAKNRERKLKAMAGKEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q454	DNA-(apurinic or apyrimidinic site) lyase	0.797	383-395	RRRTSKRIKPAGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q454	DNA-(apurinic or apyrimidinic site) lyase	0.602	355-356	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A6	Ribosome biogenesis regulatory protein	0.99	167-202	KEGTSVRGDKRREIRERVKRNERRMRRNQRIAEGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A6	Ribosome biogenesis regulatory protein	0.945	97-126	KPVPAPKPETKWAAFAKRRGIKPKTREQRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G7	PCI domain-containing protein	0.957	205-228	LARKPKKTPEQLEKEKKEREKKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G7	PCI domain-containing protein	0.847	479-489	KAKGKESKRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6J4	Uncharacterized protein	0.904	775-783	VRKRRKKPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP9	Uncharacterized protein	0.886	239-252	RVVRHRARERRKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB61	Ribosomal RNA-processing protein 36	0.991	257-333	RKKAQERKDLERAVLQEHRKREKELVKQGKKPFYLKRSEQKKRALVQQFRGMKKKQVDKVIERRRKKLASKEKKLLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB61	Ribosomal RNA-processing protein 36	0.964	141-172	SKSGSIKKKPEKRSSKHAPVEMSSKKPVSRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBW9	Uncharacterized protein	0.978	1086-1109	GKLKKEEEKRKKKAALAEAREKEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBW9	Uncharacterized protein	0.827	1003-1019	AKVEAKKPPPPPSRKVA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB6	Uncharacterized protein	0.995	431-447	GQRNPRRRMRRRRRRRW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB6	Uncharacterized protein	0.808	67-84	RRPKRNRALAERLKSSSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH8	Glucosidase 2 subunit beta	0.985	159-190	RRLEEERRQSKERSAKRKRTMAKEARELRRRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKQ9	Histone acetyltransferase	0.94	94-123	KLKDAKNKKTGAVSKKSQPSKKTQKRIGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKQ9	Histone acetyltransferase	0.725	465-476	KQREKSRAKQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX1	Uncharacterized protein	0.964	175-202	GKKAKRKARERQQEESRRLAALQKRREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX1	Uncharacterized protein	0.811	262-279	KRKGEEEGDADRKRRKNE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMT5	HNHc domain-containing protein	0.649	395-399	RSRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY2	Type 1 phosphatases regulator	0.989	133-165	HRGRGHGKRSRRRKPSPNAYEKMPRYDKPRKDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND3	Glycosyltransferase family 90 protein	0.939	91-103	GKRRRRRRSGAMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD7	Zn(2)-C6 fungal-type domain-containing protein	0.652	240-244	DRRKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG2	Uncharacterized protein	0.985	589-614	GRRPRRPRTEARRQREKAARERRERE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N8	Uncharacterized protein	0.984	2026-2059	PAGPRPPNPGSNAPKGPPKKPGADPFIRRKPGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N8	Uncharacterized protein	0.889	988-1015	EARAREKAEKAKRDAEAIARAKALRAPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N8	Uncharacterized protein	0.798	1082-1099	MLAEKRGPVKKVKLQRSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N8	Uncharacterized protein	0.619	1077-1080	RRRM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q860	Uncharacterized protein	0.854	46-59	PAAASGKKGKQKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU7	OTU domain-containing protein	0.676	26-33	KKKNATKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU7	OTU domain-containing protein	0.619	139-144	RNRQKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBJ1	Myotubularin phosphatase domain-containing protein	0.922	794-809	RNRPAGNRKRRTEGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD73	Uncharacterized protein	0.91	718-757	KSKKDKKKDSNKDDKKDIYKDDKKDKYKDDKKDKYKDDKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD73	Uncharacterized protein	0.816	513-525	KKKKSEKDDKKKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD73	Uncharacterized protein	0.69	628-639	KKKSEKNDKKDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD73	Uncharacterized protein	0.636	570-573	KKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI6	Uncharacterized protein (Fragment)	0.939	260-277	KATKPFRGRGLRRRDKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE83	PHD-type domain-containing protein	0.644	445-449	RGKKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY1	Uncharacterized protein	0.838	228-254	REERRRERLSRREEMDRARRAEREERL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY1	Uncharacterized protein	0.774	177-190	RERRLEKKRELNEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK2	Uncharacterized protein	0.827	65-73	KEKKRSKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI18	Uncharacterized protein	0.806	324-339	RRLDKGKGPPGPKQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI18	Uncharacterized protein	0.624	516-520	KRHPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL7	Uncharacterized protein	0.716	77-89	KKKADIRVRERRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIX4	Cation_ATPase_N domain-containing protein	0.904	319-335	KERRVRPVKRKPNGKAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIX4	Cation_ATPase_N domain-containing protein	0.89	1113-1127	KRVFLRRRARKRTGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL00	Uncharacterized protein	0.988	771-824	KLVKRRAYKPEPDENGQPIKRIRRKPTPELDENGQPKKRPRGRRPGSRTGTGKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL00	Uncharacterized protein	0.931	188-208	NVPWRKPGQKLAENSKKRKKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL00	Uncharacterized protein	0.628	904-907	RRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMS2	MFS general substrate transporter-like protein	0.678	95-110	RPRAWYKRLFRLRGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND2	HNHc domain-containing protein	0.778	377-383	RGRRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNY3	F-box domain-containing protein	0.725	31-42	RRTERQRRKQQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP92	Alkyl transferase	0.837	342-356	KQKARDERPRRRVKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0P0	Uncharacterized protein (Fragment)	0.855	499-517	RHPLHRPDDRRKRFARPRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q175	Pre-mRNA-splicing factor CWC24	0.912	23-37	KKRGAKGKANIRKRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q175	Pre-mRNA-splicing factor CWC24	0.847	342-355	KLLDKKRERAAKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q175	Pre-mRNA-splicing factor CWC24	0.67	63-67	KRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2V7	Uncharacterized protein	0.621	43-45	KRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E9	Uncharacterized protein	0.984	301-319	DAKARKARERAARRRARKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E9	Uncharacterized protein	0.783	256-266	AKRPPKHRQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q652	Uncharacterized protein	1	643-668	EKRKEMDRKKREAKKKKKKAGKRKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q660	Uncharacterized protein	0.864	222-234	PARKRARLSKGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q660	Uncharacterized protein	0.762	731-737	RRKRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q660	Uncharacterized protein	0.757	16-34	RRRREEEQRRREEEQRRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R3	C2H2-type domain-containing protein	0.965	317-340	RRPRARSKSPSAPAPRSRGGRPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R3	C2H2-type domain-containing protein	0.667	234-241	RRTARRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R3	C2H2-type domain-containing protein	0.66	380-386	RRRSRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M8	Zn(2)-C6 fungal-type domain-containing protein	0.919	157-191	RSPSPNGGRGRRSTSTGGNPASGKKGRSRSSKNRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M8	Zn(2)-C6 fungal-type domain-containing protein	0.867	477-491	KTKSYKAPKPKAKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M8	Zn(2)-C6 fungal-type domain-containing protein	0.85	621-626	NKKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H1	Uncharacterized protein	0.702	425-433	KRRSAGGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI3	Ubiquitinyl hydrolase 1	0.969	989-1016	GRKRGGKHKTYGKGKGRFNKQNRLSRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC64	Uncharacterized protein	0.698	268-283	RKREHGDGNSRRARPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEC8	Uncharacterized protein	0.999	558-611	DRRGRKKKGGVPSPKRCRSPPPKRRPSPAPKARGRSPRKLTDQRSPRLRSPAPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEC8	Uncharacterized protein	0.969	450-466	GRKSPQSRKKKRSKTRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEC8	Uncharacterized protein	0.602	703-703	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB5	Oxidoreductase-like domain-containing protein	0.847	106-116	KKPARRTRKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFB5	Oxidoreductase-like domain-containing protein	0.638	381-387	RLKEKHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW1	SWR1-complex protein 4	0.71	605-611	SAKRQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW1	SWR1-complex protein 4	0.667	62-70	KRRFASRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW1	SWR1-complex protein 4	0.665	529-538	RAKAKEAAKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW1	SWR1-complex protein 4	0.6	541-541	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGF9	40S ribosomal protein S7	0.932	102-125	RRILPRPKRSSRSRNTLKQKRPRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHN0	PlsC domain-containing protein	0.894	736-756	KIREAMRERGELRRRQREKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC5	Uncharacterized protein	0.746	251-258	RRRRRHRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIF9	Uncharacterized protein	0.794	11-25	GKKNGNSPRVRKRQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL39	Uncharacterized protein	0.906	427-440	SKKRKRQSGPKGSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL39	Uncharacterized protein	0.894	490-510	NEKKEVRAKKKEIEEKIKAFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLJ5	Uncharacterized protein	0.955	128-146	HLPRKLSSKKRRKEDRQRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLJ5	Uncharacterized protein	0.891	300-323	RRRARKRQLEQKKLELKIARQAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLJ5	Uncharacterized protein	0.675	8-14	RKSHRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD4	AAA_16 domain-containing protein	0.981	442-459	HGRGRGRGRAKHRKIARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD4	AAA_16 domain-containing protein	0.946	409-421	RRGRRRRHRQRGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M4	MFS domain-containing protein	0.992	243-255	KKKKKKKKQSRPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q7	Zn(2)-C6 fungal-type domain-containing protein	0.936	90-112	RHPRARAEKSKKRDDTKARREGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S3	Uncharacterized protein	0.939	57-73	ARRRWKRKRDEREQGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6L8	Uncharacterized protein	0.991	128-184	PKAVDRRRRRKTNNQGGHRIGNGSGPSGDRRRPTTKRNKNAKRRLGAGSHSGRQKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7B1	Uncharacterized protein	0.877	26-46	KDKTQRRQGKRNEKGQRQKRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L9	Uncharacterized protein	0.997	13-54	APKRKRGRPPLSPSQRKPKPAPTGRPRGRPKGSGTKSAKKTS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L9	Uncharacterized protein	0.975	128-149	QVKRGRGRPKGSGKKQKQMAAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L9	Uncharacterized protein	0.864	71-81	TPRRGRGRPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L9	Uncharacterized protein	0.614	163-164	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN7	Uncharacterized protein	0.754	13-22	KPKNAKKKPI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ4	Uncharacterized protein	0.757	239-248	RAPRRQRRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK9	Uncharacterized protein	0.696	459-463	KRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI95	Uncharacterized protein	0.817	587-613	KGKGKRPAIDPPESGPHPSKRPRTPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC8	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	0.975	70-90	KQLKEQAKALKASGKKKKKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLS3	Uncharacterized protein	0.976	160-179	KKMPKKVTKERKGRRAMKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT6	Uncharacterized protein	0.94	760-777	RQEKEEKRGRSRKRGGTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNX5	Uncharacterized protein	0.666	578-589	GSQPRQGGRFRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNX5	Uncharacterized protein	0.649	28-32	KAKKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNX5	Uncharacterized protein	0.64	570-576	KPQARRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ77	Uncharacterized protein	0.677	726-733	RRRSRSNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1R1	Uncharacterized protein	0.999	153-235	KKEKQSESREERKARRAARRLRKAEKAARKAAEARAAQKAAEKAAKKELKRARKASETKEERRARRAERRARKEERRRKRAEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2H8	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	0.945	26-46	RRAAKHGPRRIRGDINKKKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4S8	C2H2 transcription factor	0.971	367-378	PRGRRRRRRRAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9J0	USP domain-containing protein (Fragment)	0.997	607-640	NKKEERARNKSKTRDREEKKEKGKGKAKNAGKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA48	Poly [ADP-ribose] polymerase	0.746	155-163	KPKRTRGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA48	Poly [ADP-ribose] polymerase	0.611	6-8	GKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV3	Uncharacterized protein	0.956	781-808	KLRRRARSPRKWNLFGRSRGQKPAEKKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV3	Uncharacterized protein	0.941	352-373	AKERKKTKGSSHRPPSPPPRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV3	Uncharacterized protein	0.667	557-564	KKDKPTRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE32	Uncharacterized protein	0.996	270-307	RKLLKRTRADRKKAKRSDRNRLKRIEAHKAWGRSIKRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFU4	Uncharacterized protein	0.71	68-75	ARRREKHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG17	Uncharacterized protein	0.995	276-297	PPPKRRRRSPPPPRRRPLRHRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI75	SEC7 domain-containing protein	0.924	58-86	PPPPPPPPPRAPERERKSNRTRGGGDKDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI75	SEC7 domain-containing protein	0.723	706-722	RKPPRSSEPREKSLRPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC0	Autophagy-related protein 26	0.856	172-192	HGRFRHKSDHRHRRKFSESRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC0	Autophagy-related protein 26	0.661	59-65	RKLQKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPG7	SAP domain-containing protein	0.986	325-339	EKRREGKRRGGRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPW4	Sde2_N_Ubi domain-containing protein	0.849	173-182	RREREKRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPW4	Sde2_N_Ubi domain-containing protein	0.763	126-134	GRMSKRRKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZP5	Protein kinase domain-containing protein	0.686	835-840	RGRKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0J0	Uncharacterized protein	0.765	484-499	KRVSRFKKERAAASSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q162	General substrate transporter	0.888	311-326	RKPIPRKVKKTRSRPN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S1	1-phosphatidylinositol-3-phosphate 5-kinase	0.681	1886-1894	LKSHRKAGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S1	1-phosphatidylinositol-3-phosphate 5-kinase	0.617	1930-1931	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E1	Uncharacterized protein	0.872	630-638	PRKTKKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D2	Uncharacterized protein	0.728	765-777	SAKRVEGGRRREI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A3	Peroxin-1	0.826	241-266	VGGASRKSGKSSTSTARRKSARQEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q875	Uncharacterized protein	0.998	219-231	GKKKKKKKGKRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q875	Uncharacterized protein	0.968	32-57	SKKKAAERKTVDAGKKSGQKRKRSEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q875	Uncharacterized protein	0.909	90-101	NGKGKGKGKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW6	G-patch_2 domain-containing protein	0.863	296-313	YKRERERERERERERERG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW6	G-patch_2 domain-containing protein	0.668	283-287	KKRQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW6	G-patch_2 domain-containing protein	0.658	27-32	KKRTRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS5	Uncharacterized protein	0.958	196-215	RTRRRWPRPRQRRLRLRLRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ5	Tr-type G domain-containing protein	0.986	600-623	ADKQGREDGSERREKPKKPKNRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ5	Tr-type G domain-containing protein	0.931	640-655	RRRKKAEKAERERQRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ5	Tr-type G domain-containing protein	0.609	1041-1043	RER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK79	HRDC domain-containing protein	0.808	703-715	KQAKKQAKKAARE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK79	HRDC domain-containing protein	0.773	737-752	KELKAQARKALRAAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKD7	Uncharacterized protein	0.842	513-526	PSNSRPRKKHDPAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKZ2	Translocation protein SEC62	0.996	336-350	ASKKKKKKKSKKSER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL34	Rab-GAP TBC domain-containing protein	0.757	213-232	KGGRSKATEKRQSRESRPRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QML9	Zn(2)-C6 fungal-type domain-containing protein	0.777	14-22	AKRRRVRKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN53	KOW domain-containing protein	0.749	302-309	KKARRKGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP49	Uncharacterized protein (Fragment)	0.664	370-374	KGKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1C1	Uncharacterized protein	0.751	109-118	RKTRRARRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2G6	Chloride channel protein	0.636	631-634	RRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L6	Uncharacterized protein	0.798	338-346	RRPTRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q515	Protein kinase domain-containing protein	0.608	37-38	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q515	Protein kinase domain-containing protein	0.603	274-274	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q527	J domain-containing protein	0.995	293-365	KRFRQEANAAKNKKRLEREAAEKKAAEEARLKKEAEEKAAKEAEEKAKAEREAAKKAKEAAKNAVKKNKRVLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q527	J domain-containing protein	0.96	256-278	KRHMERKNANARKKKKAEDNARL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q527	J domain-containing protein	0.907	122-139	KRAHRKKVLKHHPDKKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW8	Uncharacterized protein	0.912	307-318	GKPKKGKGKEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS4	Uncharacterized protein	0.991	128-164	KEPKAAKKATGADGKDAPKRDAETQKKDKKRGKKEKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS4	Uncharacterized protein	0.986	5-33	KKRKRNEGHGKRSKAPPASSKRQKSNSGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS4	Uncharacterized protein	0.617	720-722	GRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW0	Uncharacterized protein	0.942	343-358	REKGGRRRRWGRRESR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW0	Uncharacterized protein	0.606	195-195	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK59	Glycosyltransferase family 71 protein	0.997	508-524	EKKVEGKKKKKEKKKKN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH4	Clr5 domain-containing protein	0.628	559-561	KKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN54	Uncharacterized protein	0.788	282-290	RRRRRERQA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC3	Cir_N domain-containing protein	0.998	240-353	ELEKERRREAEERERELRELEKEERRRERKRRKREEEGEEEGKEERYDEKTRRRRRSRERRRDSPDGDSDPARRERSHRHRDDGRGERDRYRSRERERTSRNERDGSDRRKDPH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC3	Cir_N domain-containing protein	0.933	358-394	DRGRDGSRERRRRPEEDDGREWPRRGDGDRARRSHRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC3	Cir_N domain-containing protein	0.768	90-95	RKRKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ95	Uncharacterized protein	0.696	545-553	RKGGRGGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A5	Uncharacterized protein	0.821	1597-1610	KPLIKRTKPEKKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5D9	Uncharacterized protein	0.901	248-262	MRRRRSRSRSRNRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5D9	Uncharacterized protein	0.8	299-314	RGRAEKAGGRERGRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T0	Uncharacterized protein	0.957	824-838	KQRAKKTNKKKAKKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q989	Uncharacterized protein	0.995	140-165	RKSDKKRKQKKSKKHKSEEAEEMPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q989	Uncharacterized protein	0.988	19-37	KHEKKHKKAKSDHKKKRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q989	Uncharacterized protein	0.934	171-183	DGEGKEKKKRKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q989	Uncharacterized protein	0.888	79-86	KKKKKKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q989	Uncharacterized protein	0.602	107-108	HR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9S0	Uncharacterized protein	0.975	48-62	GGGMRKRPKKKRQHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9T0	Uncharacterized protein	0.821	14-28	GPKGRAQRPTKKQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9T0	Uncharacterized protein	0.741	213-223	KARRRLREQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV9	Uncharacterized protein	0.915	78-111	AKKPSKDREKSASSKKALMAASRPAGKHGKTSRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV9	Uncharacterized protein	0.843	260-287	RRASKHEDDRKAMPPPRRPASARPTALA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV9	Uncharacterized protein	0.676	505-516	SRARATSRAKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV9	Uncharacterized protein	0.655	47-53	ARREKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV9	Uncharacterized protein	0.604	289-289	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAY5	Uncharacterized protein	0.782	17-33	RRARKEIEREQKRKEGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB55	Uncharacterized protein	0.661	17-26	RLAKLKSLKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD55	HMA domain-containing protein	0.943	195-210	PSTGSARRRRRRSKES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEC4	Uncharacterized protein	0.999	21-208	EKEEDEKRKQAEHEARARDAKRKEEEKRRLEEEAREKERLQREEESKKLAEAEARKREEEQRRKEEEERKRKRKEEEERQRREEEERKAREEAQRRRLLEEQKKKREEEERRRKEEEEKRLKEEEERKRRQEEERLRREKLEREAAEEARRKREEEERKEQERRERALREEMERRRAAKEADQRRIRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIN5	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.727	52-59	RPRTRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH1	Uncharacterized protein	0.969	116-133	KERVKKRKKYERKQKLRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKH8	SWIB domain-containing protein	0.978	135-161	RVTRGAGTAKTKMKAKATKKKSAKRVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPA8	RRM domain-containing protein	0.995	653-702	GGSAPEKAGEQQPSKRSGRRRGGRGRGDREAKEAKDSSKDGGGGVKKGGD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPA8	RRM domain-containing protein	0.985	203-270	KEKKAAKAKEAAAAKSAKHARQDSQGAKGKNAAPAPEESKKRSRESRSEREKASEKASDKASERPRES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPA8	RRM domain-containing protein	0.723	340-360	AHRKARQEAAKEAAREGAKEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPA8	RRM domain-containing protein	0.701	410-417	KSRNRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ06	Uncharacterized protein	0.912	4-35	KKNEKGGKKDAKKIVEDKTFGMKNKKGAVARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ06	Uncharacterized protein	0.896	48-69	QKRKEAEKKAREQEKKAAEAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZJ7	Cytochrome P450 monooxygenase-like protein	0.758	177-185	KQKHARRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B1	ATP-dependent DNA helicase II subunit 1	0.715	576-587	PAAKRTKVAPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q681	Glutamine--tRNA ligase	0.986	39-60	ELKKRLAKRAKKALKEKNKDAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7D5	RanBD1 domain-containing protein	0.755	365-379	KRPRAPESPAKNKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q896	WD_REPEATS_REGION domain-containing protein	0.712	29-43	SSRAKERRNPSITPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX3	Uncharacterized protein	0.886	192-217	RRMIEAKRRSIRLLRRRMADKRLEMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX3	Uncharacterized protein	0.67	696-701	ARGRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA9	Aa_trans domain-containing protein	0.967	328-338	SRRKRRRKHRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDU3	DNA ligase	0.774	91-100	KKRGRPARPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDU3	DNA ligase	0.761	121-129	SKRPRRGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK6	Uncharacterized protein	0.858	402-415	LAAERERAKKAKRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK6	Uncharacterized protein	0.78	424-444	KAQKKYLERERERELKRSMKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJX7	Uncharacterized protein	0.841	170-197	RRRTYSRHASRSRHRSHSGHRHGGSRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL86	RING-type domain-containing protein	0.667	384-387	KKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN45	GRIP domain-containing protein	0.992	17-36	GPAAASKSKKKGNKKKKGNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNS1	Double-strand break repair protein	0.994	596-632	PKAPAKRAAARTTRATKKAPTKRAAAAKKAPVRSRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I0	Uncharacterized protein	0.712	82-88	KEAKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q287	AAA domain-containing protein	0.976	1348-1379	LAGRRTASGASARSAGGKGKGRAGAGGKGKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q287	AAA domain-containing protein	0.912	11-22	RRRRVRRRRHDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q287	AAA domain-containing protein	0.911	1309-1331	KDKEKEKEKGKEKGNGKEVGGAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	0.992	249-285	TRSRRGSRSRSRSRSRSRSRSRSSSRSRARDKDKDSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	0.954	472-503	RDRRDRSRDRSRDRSRDRSRDRSRDRSRDRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	0.85	663-675	LEKEKRHRRRLER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	0.847	438-460	SPDRRRRSRSRSIVDSTRRRLAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	0.748	567-575	RKKSKKLKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	0.675	423-428	RSRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E2	Uncharacterized protein	0.644	543-551	GGRDRSRHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q618	Uncharacterized protein	1	1530-1581	KSRGIPGKKKKKKGTSKKGNKKKTKGKKGNKKNNHNKKKKKKKRQQKGKRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q618	Uncharacterized protein	0.941	1165-1179	KQKGKKRRNKYRNKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q618	Uncharacterized protein	0.781	1281-1290	KRDRKGKGKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q618	Uncharacterized protein	0.777	1475-1489	RQRLAMHGGKKRPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8P0	Uncharacterized protein	0.935	382-393	RPKKEKKRPTRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR6	Protein kinase domain-containing protein	0.755	1195-1202	SKGRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF7	Uncharacterized protein (Fragment)	0.8	17-38	KKGHYKRECRSPKKEWKPAPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP7	BHLH domain-containing protein	0.683	22-39	KRKRAAESASPDSRRAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT9	Uncharacterized protein	0.984	274-305	RRRRRRRRGHGDESDEKTPAPARRRWWKRRSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGY1	Uncharacterized protein	0.649	316-332	RRRQRELAAERARVERA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHW7	Uncharacterized protein	0.996	385-401	RPKKQSKKKRKKGKGAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ7	Uncharacterized protein	0.864	539-553	GRREKGLQPRKRLKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKG7	Uncharacterized protein	0.621	13-16	KEKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB7	Uncharacterized protein	0.98	65-116	HRNRDRDHRNRDHRDRDHRDRDHRDRDHRDRDHRRRERSRPPETGRTRPAPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q015	Uncharacterized protein	0.977	196-208	AAKRHRRRKRKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2I6	Uncharacterized protein (Fragment)	0.642	218-222	KKKVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N4	SAP30_Sin3_bdg domain-containing protein	0.635	167-172	KKGRPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N9	SET domain-containing protein	0.95	122-137	RKTKRPPSKSHKKKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N9	SET domain-containing protein	0.912	487-499	RANASKSKKRKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C7	Uncharacterized protein	0.922	279-310	RFWRKPASRKAPERRSGQPADGTKQRSKERSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB73	MMtag domain-containing protein	0.998	144-248	DRHRDSDRRHRRRHRSRERDHDRHRDRSRSRHRRRDSLDRDEKDSYRRRRSRSPEYGRHREERRHGSRSRSRDRHHRRRDSRSHGRSRSRDRAERSRHHDRRRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD1	Enhancer of mRNA-decapping protein 3	0.924	389-409	RRGGEGKSAAAGKRSRSRKAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD1	Enhancer of mRNA-decapping protein 3	0.92	198-208	KKKRRQRKPGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG75	Uncharacterized protein	0.923	90-99	RPRRRRGKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHA3	Uncharacterized protein	0.993	872-938	KLGASGSKKSPEKAADKVKEKAKDKDKENEKDKEKEKEQEKEKEKEKKETEKGKGEKEQDKEKEKDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHA3	Uncharacterized protein	0.962	1152-1166	GRKKKQKKDKEKPSN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHA3	Uncharacterized protein	0.669	85-100	KKRAAEQRQKEAQKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHA3	Uncharacterized protein	0.642	1120-1125	RKQRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHL3	Uncharacterized protein	0.999	835-873	KKLDGKDRRHRKGKPKGRSFKVGGKKDPLKTFKVRRKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHL3	Uncharacterized protein	0.968	636-670	KKKKKQKQKSNSNDEAEKKDEGAEQPKKKRRYKKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW8	Non-structural maintenance of chromosomes element 1 homolog	0.606	333-334	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN66	Uncharacterized protein	0.953	911-925	ERKKGRRERRARLHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC4	Vesicular-fusion protein SEC18	0.996	722-816	KGPPPPHPRHHLTAVRHGAARHHYRVRPPDPRARRPGHARAVGRAGRVGRLRRAGRRQPGAEPPPRVLQLGPRRRRHQDHPDHGRNGPPERRARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD0	Nucleolar protein 58	0.998	483-510	PSKKDKKDKKDKKDKKEKKDKSQKSKES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD0	Nucleolar protein 58	0.998	578-608	SKSSKRKHEPEEETPAKEEKPKKKKKKSSKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2F2	Uncharacterized protein	0.975	337-387	RSRRRRMAHSSKPRARKQEEILRGPKLGGSRNARAAMRDLLLKEQASKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2F2	Uncharacterized protein	0.867	253-274	KGRSKNGRLGRDGKPLRSRNRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2F2	Uncharacterized protein	0.73	75-83	RRNARKHKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W5	DUF4187 domain-containing protein	0.926	181-218	GLESERKRKLREAAEAAGERAKRAKEDEAGYRERMRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W5	DUF4187 domain-containing protein	0.805	50-66	RQRLRREAEARARPKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E7	Uncharacterized protein	0.799	236-242	PPKKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E7	Uncharacterized protein	0.737	324-336	RGGKQPSRHKRGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X2	Uncharacterized protein	0.601	37-37	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q401	Uncharacterized protein	0.985	380-396	PKPRRQPKAKKQPRKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q401	Uncharacterized protein	0.931	326-360	SPLPKRRRRREADSPAQQQQPVRKARVGRPAKPSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q401	Uncharacterized protein	0.766	304-314	RKRPRRSLPAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q401	Uncharacterized protein	0.671	160-167	RGRTKGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H2	Uncharacterized protein	0.829	628-643	GRRSGRRPGASSKRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q868	Uncharacterized protein	0.67	544-548	KKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA58	GTP cyclohydrolase 1	0.995	62-92	RRSSVSKPARDFRDKPEPPPKKKKRKTPAPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA58	GTP cyclohydrolase 1	0.758	23-41	RRSKSKNNNNNNGKKRSRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM9	SCA7 domain-containing protein	0.999	177-220	GKTAGKGKKTNVAGKKRKAEGELDKGKAKKKKDEPKPKTAKPKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM9	SCA7 domain-containing protein	0.974	123-149	RIKKEKAQRKKEAREARERLKEAAREE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM9	SCA7 domain-containing protein	0.854	32-47	GKIKLRKPPPKQVKPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY3	60S ribosomal protein L2-like protein	0.886	177-199	KPLLKASRAKHKFAVKRNRWPKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC8	CHY-type domain-containing protein	0.963	660-686	GKGTRDPRLMRRGDKRKYKRLGAQKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.968	1621-1652	KAKAPLSVVPAAGAKKRGRPVGSKNKPKGDDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.965	49-82	GAKAPAKKRPKPDSDAEDDMPKKKKAPAKKANAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.912	1265-1285	RRMGRRTSHKIGAGKGRRPKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.834	1708-1724	PKPAAKRPGRAAAAKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.807	1750-1759	GRGRRGKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.792	24-41	KPKAKAAPKKMATTKPGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.782	1291-1302	PEKKTKARAPKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL36	DNA topoisomerase 2	0.656	425-428	KKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLY4	Uncharacterized protein	0.949	10-26	GGPPGKAKPKRKPNSVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLY4	Uncharacterized protein	0.94	364-375	KHGKRSKKRKAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLY4	Uncharacterized protein	0.936	682-694	PPKPKRSRARKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNW5	Cnn_1N domain-containing protein	0.73	378-387	SQPKSKKEKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ9	Uncharacterized protein	0.998	58-189	ARSPRRRSRSADRFRRERSRERIGGESWRRSRSRARSPPRRSSPRRSPIRRTPPRFVSPRRDDRGLDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRRDDRWDDRRDDRRDGRRDDRRDDRRDER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ9	Uncharacterized protein	0.971	219-276	ERPRSPMRRQFEIRDNRRRSRSPFDRDRLPVHRDRSPPRRSPPPGPRGGGTYRPRSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ9	Uncharacterized protein	0.602	37-37	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD2	PSP domain-containing protein	0.975	618-636	KSRKRQRREEERRGEKGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD2	PSP domain-containing protein	0.943	11-24	MRRAKKKEQKKAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD2	PSP domain-containing protein	0.93	136-146	KLSKKKRKKLN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Q1	60S ribosomal protein L36	0.96	66-86	NGKDKRARKFAKKKLGTFNRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Q1	60S ribosomal protein L36	0.779	18-35	HKTTARVNKPRPSRQKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q1	Uncharacterized protein	0.812	405-416	KRKPPQRRAAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7B6	Uncharacterized protein	0.62	925-928	RRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9B0	Uncharacterized protein	0.752	90-110	ENKRRMFLSKRADEKRPENRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAM5	Uncharacterized protein	0.817	564-579	KRRREWKAPEPRVKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD3	Methionyl-tRNA synthetase	0.992	612-636	IEAEKAAARKAAREKEKEKKKLKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ8	Uncharacterized protein	0.865	168-183	IRIRRRGGHHRRTSKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC93	Dihydroxy-acid and 6-phosphogluconate dehydratase-like protein (Fragment)	0.849	586-600	RRRKEWKPPKMKPMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGH4	BHLH domain-containing protein	0.869	118-129	GRRGKTRARRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGH4	BHLH domain-containing protein	0.648	19-23	RKPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL80	AAA domain-containing protein	0.933	20-38	SKRPRPADAPKPPKPPKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL80	AAA domain-containing protein	0.751	450-456	PGRRKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL80	AAA domain-containing protein	0.62	1012-1014	IKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL8	Uncharacterized protein	0.941	399-425	KGTAAPKPRSTRRAKSAVPTRKSRRNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL8	Uncharacterized protein	0.906	955-973	RPKRKAVSKAQATRRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLL8	Uncharacterized protein	0.865	822-833	KKRKEDEKRRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM79	Ubiquitin carboxyl-terminal hydrolase	0.956	380-410	ERARKRRKRNPTLDNGQGEEKKESAKKDGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMC3	Uncharacterized protein	0.827	287-302	GRSSRRRTRSRDRHAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY6	NUC173 domain-containing protein	0.989	1194-1259	KALREKRGAGGKGRAAGSRAGRGRGVASRVGKGGIAAAVGRRGLGQEKRRGPATYGSRVSKSGSRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY6	NUC173 domain-containing protein	0.956	987-1001	RKTKERSKRKKEAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY6	NUC173 domain-containing protein	0.924	1154-1172	KDVPRRGLRGKLKWNRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY6	NUC173 domain-containing protein	0.784	1097-1108	SRSKKDGKRMKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY6	NUC173 domain-containing protein	0.757	1054-1061	GRKQKKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY6	NUC173 domain-containing protein	0.689	149-155	PKVRKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP73	Uncharacterized protein	0.995	422-529	RRRPRQRKDEQPVQPVRRSARIAAMNKTKANPPPPPAPAPPPQARQSRQRAARAPVGEQPAGRPKTDRSTRAQRRAAASDKPSARSMQAEKPTTARSRGRPKKKTGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP73	Uncharacterized protein	0.601	157-157	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD0	Uncharacterized protein	0.98	128-158	GGHQRRKPPKNSTPKKSSKPARATIRSPRKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD0	Uncharacterized protein	0.962	611-637	SLREKPRPPDAEKITKRTPKKSRKLGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW4	Protein kinase domain-containing protein	0.887	150-160	PSGPKIKKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW4	Protein kinase domain-containing protein	0.759	127-133	SKPRKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW4	Protein kinase domain-containing protein	0.673	409-422	KAKPAPAGKPFAPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I5	DNA polymerase	0.727	282-292	KRRLKRMGKLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1M7	C2H2-type domain-containing protein	0.99	173-196	EEAREREERRRKRKEAEERKRQER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1M7	C2H2-type domain-containing protein	0.733	33-49	REAAEKEERKARWEAKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Z1	Uncharacterized protein	0.869	731-759	RRRKRTLSSRGERAPGRSSLLSTRRRARS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Z1	Uncharacterized protein	0.854	1020-1033	QYRRRLAKKGLRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2R8	Uncharacterized protein	0.956	216-236	TRPRKQSISKRAHHRRRSKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F8	Uncharacterized protein	0.99	198-290	PKGPQQRRRHRHGHPDYFAKELAAAERAKKQAEERRAERERREQERQRRVAERERYRRAMAKAKTPGRDGKVKLGREGKILLEKVKKLVGEGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F8	Uncharacterized protein	0.928	25-66	RKPKKAKHGFRVGPENLPDGPWRRKVTKIKKDLITKAKVKKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Y1	Uncharacterized protein	0.736	16-23	KTNKKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U7	DNA polymerase lambda	0.725	47-58	RKKAGAAAKRMP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q710	Uncharacterized protein	0.942	158-174	KDRESEKERERRRKKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q710	Uncharacterized protein	0.707	333-339	KRRARRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q710	Uncharacterized protein	0.684	11-20	RGRSRSPGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q963	BZIP domain-containing protein	0.968	143-159	PPKKRKVRKTRKESNAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q963	BZIP domain-containing protein	0.609	164-165	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA59	TAFII28 domain-containing protein	0.975	101-115	LKKKRGRKSKAEKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU6	Mcp5_PH domain-containing protein	0.988	21-56	RSSRKSKRSITPPGKKGKSRSPPPVPGDKSERGSKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU6	Mcp5_PH domain-containing protein	0.906	861-897	SRRGSGRSHYRASSIRKVRSAAVMPRSHRNRRRGSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU6	Mcp5_PH domain-containing protein	0.764	1325-1337	RRRSKELRRRTSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU6	Mcp5_PH domain-containing protein	0.669	1122-1127	PKRRAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE9	EH domain-containing protein	0.938	707-743	HHHRRRNKVLGGGNRKHAHHEGSRRRWRDEITPRERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE9	EH domain-containing protein	0.879	372-385	GKAKPKPVPKPKPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC46	Uncharacterized protein (Fragment)	0.82	140-148	KHQKKKKRM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK9	Uncharacterized protein	0.901	158-182	PKRPEKRKASPEPDKGTPAWIKRRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEM0	Uncharacterized protein	0.998	524-558	GRRRGPYGPRKPREGKPRPRRPRDPNKKSNYVPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEM0	Uncharacterized protein	0.994	68-91	PPPRKAGGRKPKPRRTTGPRKAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF26	Uncharacterized protein	0.993	528-549	EEPVKSLPRRKRKREGRRGGPH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF26	Uncharacterized protein	0.775	60-76	PRPDRRKAISREEKARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF54	Uncharacterized protein	0.779	85-95	ERARKHHKRVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFA2	Uncharacterized protein	0.943	239-264	RTRRRTRSRDSRGASRRGRSRSSSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFA2	Uncharacterized protein	0.894	494-511	ARRERSRHSRSRHRSRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFA2	Uncharacterized protein	0.731	92-100	PRPTRRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFA2	Uncharacterized protein	0.707	283-290	PKRGKTRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJB7	Amidohydro-rel domain-containing protein	0.859	19-30	GRPRWRRQKPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP3	Ribosome biogenesis protein NOP53	0.998	285-322	KAKKPRRKTQAERNRIKRRKEEERRLKHEAAMKRKRAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP3	Ribosome biogenesis protein NOP53	0.783	20-29	PSRKGKKAWR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP3	Ribosome biogenesis protein NOP53	0.77	409-423	KVEARRKIPFRKQAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS3	Uncharacterized protein	0.731	926-932	GPRRRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW0	RRM domain-containing protein	0.997	208-292	PHRRGPGGGGGRDSDEEAARRGVDRYRPRGGGGSGRLSRSRSPIGGRGGGGRRRDGGGGGGGGGRRSGARGNRGGGGDRSGRPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW0	RRM domain-containing protein	0.614	26-28	GRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1Y7	HMG box domain-containing protein	0.988	3-26	KAAKGRSGKAEKKRSKKDPNAPKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q440	Vps8 domain-containing protein	0.918	1515-1528	EREAARARRRKREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W9	Uncharacterized protein	0.989	20-44	SRKSRSPGAHRRRRFRSRSRSRSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A7	Rho-GAP domain-containing protein	0.741	244-270	KKSKPKPFNLLGRSRSTKDKDGKESKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A7	Rho-GAP domain-containing protein	0.609	676-678	RIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6A7	Rho-GAP domain-containing protein	0.601	272-272	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY9	Uncharacterized protein	0.808	551-561	RMERARRAKRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC47	Sas10 domain-containing protein	0.998	594-626	KGLTPHRKKEARNPRVKKRKKYEQKQKKLRSVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC47	Sas10 domain-containing protein	0.968	368-395	PKRRAERLSKAEVKANKKKAAEAARKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC47	Sas10 domain-containing protein	0.766	550-568	KKKREDKAARFEALAKARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC47	Sas10 domain-containing protein	0.683	4-9	KRKAPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC47	Sas10 domain-containing protein	0.667	505-509	RRGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCD9	Uncharacterized protein	1	524-548	KEKEKKAAEARKKKRKERKRRRAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCD9	Uncharacterized protein	0.671	572-576	ARRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM54	Uncharacterized protein	0.996	32-49	GKKKKKNKKRSAGAKKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA7	DUF2439 domain-containing protein	0.839	700-708	RPRKKARKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA7	DUF2439 domain-containing protein	0.625	723-731	KPRLAKLSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNR7	Uncharacterized protein (Fragment)	0.954	51-65	RFRKRRARAKGREPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q056	Uncharacterized protein	0.999	310-348	SRKEKKARKREKKEARKAEKEARKADREARRQAGREKRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0P3	Uncharacterized protein	0.709	231-243	RPPRFQKPPKGSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X1	CCHC-type domain-containing protein	0.872	349-364	RNRSPSPGRKARRHRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X1	CCHC-type domain-containing protein	0.633	402-404	RKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X7	Csm1 domain-containing protein	0.977	128-159	PAKPKGARGRPKKAALEAEPQPTGARRGRKPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X7	Csm1 domain-containing protein	0.94	38-73	KKSVMPPKKGSVGRKAANKVTKPASKKTASGSRVRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X7	Csm1 domain-containing protein	0.828	88-99	TGKGPGRRGRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q664	Uncharacterized protein	0.899	657-671	KAKAKAKAKQRSKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q723	Uncharacterized protein	0.987	437-461	QRRAQWERMKKGKHKGRKNSKLPAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q723	Uncharacterized protein	0.625	210-215	RFGRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9F0	RFX-type winged-helix domain-containing protein	0.765	51-58	KPRKRPRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ1	Uncharacterized protein	0.768	374-386	KSKPPPPPPPKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ1	Uncharacterized protein	0.662	282-291	RPPKYAKPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ1	Uncharacterized protein	0.623	164-166	KKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ1	Uncharacterized protein	0.612	168-170	EKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB51	Uncharacterized protein	0.904	777-797	GKSRRSKGKHMVLAGKARKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC19	Uncharacterized protein	0.915	326-341	KQKMMMKERKKKDKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE7	Uncharacterized protein	0.974	53-65	SKGKRKRSKKARG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEP1	Uncharacterized protein	0.977	393-409	KDKKPKEKRKGGNGKKY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ8	Uncharacterized protein	0.848	616-635	RRKVGEALKQDREAKRKRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ8	Uncharacterized protein	0.683	582-590	TKARVHRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI04	Uncharacterized protein	0.709	40-46	RPKTRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIB7	Condensin complex subunit 1	0.743	210-218	GRGKPKSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLR9	Uncharacterized protein	0.912	615-633	ARRRPNPQPKRIKRPEILP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY1	Rab-GAP TBC domain-containing protein	0.99	1106-1146	GVKGKEGKEGKDNKEGKERTEHAKTEKGKDKEKKEKGKGLG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY1	Rab-GAP TBC domain-containing protein	0.846	254-294	GSRRIRKRVLGADRAAAQAKPPEMEPERGSARPPKSPKSPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX6	Uncharacterized protein	0.888	329-355	PSGRNSPLPPPPKGGPPRGGPPRAGST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX6	Uncharacterized protein	0.882	295-306	PRSKKKERPHRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E4	Uncharacterized protein	0.643	298-301	RRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3T5	WD_REPEATS_REGION domain-containing protein	0.998	314-333	KKSLARKKRRKREKLAKEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5C1	Uncharacterized protein	0.94	76-93	SRSEKPSGRRRRRSVPPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P2	Uncharacterized protein	0.845	534-561	GRLGRYKGEQGRGIVKGKERGNREAKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P2	Uncharacterized protein	0.676	102-109	ARRALRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q732	WD_REPEATS_REGION domain-containing protein	0.605	811-811	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q861	Uncharacterized protein	0.91	64-84	RARRARERDRGARGSRRSVGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q861	Uncharacterized protein	0.732	329-345	SSKGKRTDERGKDRDRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8T2	Uncharacterized protein	0.998	114-201	EPPKKKRLTAEEKAAREAEKRKRDEERERKRREKEEADKLKAQQKAAKAEERAAKAADRAEKEQEKRQRAEERERKRREKEEEELRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q934	Zn(2)-C6 fungal-type domain-containing protein	0.902	17-27	ASARKRRRRAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q992	Peptidyl-prolyl cis-trans isomerase	0.943	440-494	NRRRDPKRRSLSPRGGRYRDDRHDRREDVGGSRDDREWPRRDRRDHDRDRRDGKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q992	Peptidyl-prolyl cis-trans isomerase	0.926	345-368	AKRRKAAARRGGGGWGGIKELEKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD70	UDENN domain-containing protein	0.995	171-189	RRAKEERRARRRRKRDREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI49	Threonyl-tRNA synthetase	0.905	17-28	GDKKPKKEKKAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW6	Uncharacterized protein	0.977	1201-1269	AAPAPPAAPASTRRTRSSKLPPPTPVKKLRGAGKPAAEKSPPAEKTEPAEKPAATPSLRTRARSLPKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW6	Uncharacterized protein	0.966	1092-1124	EAKERRKGAALSEKGPEAEEEGGGKGKKGKKVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW6	Uncharacterized protein	0.719	1316-1322	PKRRGKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW6	Uncharacterized protein	0.681	1187-1196	RKAGSGRKSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW6	Uncharacterized protein	0.672	947-950	KKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL37	HTH APSES-type domain-containing protein	0.925	636-653	AAGRGRGRGRGAPPRRES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL37	HTH APSES-type domain-containing protein	0.706	699-707	GRGKGERRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL37	HTH APSES-type domain-containing protein	0.701	799-804	RSKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLC9	1-alkyl-2-acetylglycerophosphocholine esterase	0.887	14-25	PHPAERRRRRRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM67	alpha-1,2-Mannosidase	0.612	97-98	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPW0	Uncharacterized protein	0.682	160-165	KIRKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPZ9	Uncharacterized protein	0.995	55-73	EQKKKKEKKGEKKGPEQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW2	F-box domain-containing protein	0.982	1196-1240	SRRLPSLRRRRSRAGRSAAKNVADAKRRGWSGQSTRSKSTKRGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q189	Uncharacterized protein	0.997	5-47	KKNLKATKKFEKKHLKGVLEKRKAVRKIKQRQQLKEKKKAKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q189	Uncharacterized protein	0.91	208-219	KKKQKKDKKAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q189	Uncharacterized protein	0.851	99-112	KTKSAAKLGKRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q189	Uncharacterized protein	0.773	646-657	LKEGRKPGRGNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q189	Uncharacterized protein	0.671	733-740	REEEKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q255	tRNA-dihydrouridine synthase 3	0.867	103-113	KKDGKRKKQKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2F0	WD_REPEATS_REGION domain-containing protein	0.995	249-259	KKKKKKKKSKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q398	Uncharacterized protein	0.863	425-443	SHDLWKKMKGRDNKGRREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q398	Uncharacterized protein	0.615	419-423	KDKGH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q0	AMP deaminase	0.941	308-319	AARKSKAKKRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q6	Methyltransf_11 domain-containing protein	0.609	46-47	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X7	Uncharacterized protein	0.972	12-71	KKAAGQARKAAAAAAKEEAARAKQEALEAAEWEKGAKKNDKKAAEAAKKAEQARKKAERD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3X7	Uncharacterized protein	0.684	82-96	PGRSGPKNAKTAVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5V1	Uncharacterized protein	0.895	137-149	RVARRRRAKARIG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q822	Uncharacterized protein	0.94	113-167	RNKSREDRERDRAVSSRSRDKDGERKHRSSKSRTSSVTKDEKYAERAKSPRRRSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q822	Uncharacterized protein	0.777	351-358	RSRRRRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J9	Uncharacterized protein	0.824	106-115	GKRARRRQRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.993	701-771	KKAEKKRSGSRLRDLAAGAAAAGAAAIGLKKLNDRKEKGKEKEKDDKDRERDRERNREKERERGRERDRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.99	1111-1196	RRRLSHRERERSRDRDRDRDRSRDDRDESRRRRRRDDDGDSRRRLRRREEEEDERDERGERSRRRWKADERGESSRHAEDKRARGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.987	671-684	RSRRRRRRHSRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.899	1218-1225	RKRRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.866	540-560	RHKSKSRDGKSRSRSRLRTGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.788	568-587	AGAGAKKLYDKHKEKKEEEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.767	448-462	RSRSRSRSRSRPPHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8N3	Uncharacterized protein	0.666	512-517	RKRSKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAB7	T5orf172 domain-containing protein	0.996	322-338	RGSGGRRKKKTKKKKTI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAB7	T5orf172 domain-containing protein	0.786	116-140	QKGSGRPGGKGTQRPAQMARPKPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF5	Uncharacterized protein	0.605	1374-1374	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA5	Uncharacterized protein	0.985	13-33	PLKLKGGAGVTKKKKKKDKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBA5	Uncharacterized protein	0.814	115-130	VKRKRLKELAESKRIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH64	Uncharacterized protein	0.629	1241-1246	KERRTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI8	Zn(2)-C6 fungal-type domain-containing protein	0.973	54-72	KKKFDPKDPLRPRRKKARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ52	Uncharacterized protein	0.954	35-55	RRRRRRKDQSNVGARGRRRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI8	Zn(2)-C6 fungal-type domain-containing protein	0.699	48-53	RRRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM37	Uncharacterized protein	0.704	313-317	RKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH1	40S ribosomal protein S25	0.957	8-24	GAKKQKKKWSKGKVKDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNK9	APH domain-containing protein	0.96	41-57	RRLRRRMRKIARAKGKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD5	Uncharacterized protein	1	158-210	PRRRRRRRWRRRRMLRKQRQMRRTPRRLYEEEKKKKKKKKKKKKKKKKKKRNG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQD5	Zn(2)-C6 fungal-type domain-containing protein	0.649	25-30	KRPHRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q195	Uncharacterized protein	0.846	384-400	LSKRQAKKQRKEAAQAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T7	WD_REPEATS_REGION domain-containing protein	0.891	11-32	KRKREPKDDPALSQKKHRRKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T1	PH domain-containing protein	0.826	358-368	KKDAEKKKKHQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T1	PH domain-containing protein	0.641	335-337	KKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A5	Uncharacterized protein	0.996	64-150	KKLMEKKKRREMELRKQEQRRRERAQFTAQAAAEKKKKEEELMRRQRMERERQRKRKERGHAMSREEMEALRRERVERARRERNRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A5	Uncharacterized protein	0.654	445-449	KKSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T3	XPG_I_2 domain-containing protein	0.97	568-584	KSKKRKRRAPPGGTTKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V6	SAS4 domain-containing protein	0.988	598-611	AHARKKRRDKRLRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V6	SAS4 domain-containing protein	0.957	490-535	AAKRRRSKAAAAGTRAPAARRGAASTATAARRKTAAAAAASRSKPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V6	SAS4 domain-containing protein	0.84	379-396	RRWAREEKRRRAEMLERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V6	SAS4 domain-containing protein	0.778	560-568	SKNRRKGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q759	AAA domain-containing protein	0.992	109-133	KKKVFKKHQGPPKAKKTRANKHRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q759	AAA domain-containing protein	0.992	374-406	KHLKDLKKKARESKMRNKHDRKKELKRIESKRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q759	AAA domain-containing protein	0.991	56-73	KKATSKHSKRRSRRPKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9L2	RNB domain-containing protein	0.821	469-479	KREKEEKKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M2	BRCT domain-containing protein	0.855	386-395	RRRRAKHKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M2	BRCT domain-containing protein	0.794	952-958	GKKRKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ7	J domain-containing protein	0.995	208-237	RLKEAQQRKAEKKQRKEERRAERKGRKEKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ7	J domain-containing protein	0.705	321-330	AKKEEEKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ7	J domain-containing protein	0.687	137-152	ARGRAKMEEMRRLREE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDJ7	J domain-containing protein	0.609	155-158	ARER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE62	Uncharacterized protein	0.702	12-21	KSTPARRRPM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE62	Uncharacterized protein	0.698	72-83	KSKPRNGNKGRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK56	RRM domain-containing protein	0.778	475-497	GWKRDDYRPGRSPSPRRGDPRSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK56	RRM domain-containing protein	0.742	446-462	KKKDDRDRSPDRRGPRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK56	RRM domain-containing protein	0.648	513-519	RRRSRSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKT6	ECM11 domain-containing protein	0.925	202-227	LARERERQREREREREREREREKERQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN89	Required for respiratory growth protein 9, mitochondrial	0.972	229-291	ERKRQERWFRRGKRVWTQWAALGKKPPRKWRAEGIVRDPIWNRPRGPNHKDKAARAEAQRRLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN89	Required for respiratory growth protein 9, mitochondrial	0.945	130-178	KKGKRQSSKPETSEEQSGRPKPKREKEPWMIQKEALKKKFPEGWNPRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNL3	Uncharacterized protein	0.977	180-202	ARRAAALGRGRGRGRGRGGRGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNS7	XPA_C domain-containing protein	0.977	309-334	READKKRRKEAKFKEKLLDLKRKTRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F2	Ribosome production factor 2 homolog	0.886	6-25	KPRNARSKRALEKRAPKIVE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F2	Ribosome production factor 2 homolog	0.837	334-341	KRKRKVKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C4	EF-hand domain-containing protein	0.68	2197-2205	TRKSGGRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3I9	WD_REPEATS_REGION domain-containing protein	0.813	207-213	PKRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3I9	WD_REPEATS_REGION domain-containing protein	0.698	264-268	RKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S5	Small nuclear ribonucleoprotein Sm D1	0.999	85-118	PKPKNKARKEAERGRGRGRGRGMGRGRGRGRGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q452	TOG domain-containing protein	0.773	216-222	GRKRKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7D6	Uncharacterized protein	0.956	124-133	RRRRRRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q979	Uncharacterized protein	0.775	330-338	KSKPRGKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R8	Uncharacterized protein	0.961	1307-1325	QRRARKAQAKEKRKSAKSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW0	Uncharacterized protein (Fragment)	0.683	16-22	RPRKRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV9	Ribonuclease H2 subunit B	0.787	435-450	AEKRRKQEAEEKARKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF80	Uncharacterized protein	0.688	191-201	RKEGGRARVRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ75	Uncharacterized protein	0.872	33-54	LASKAKPKPVPLKLKPTKADRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJT1	Uncharacterized protein	0.983	352-368	RELERRRRRRRRQGSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM33	Protein kinase domain-containing protein	0.659	215-223	PKKEKNDRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM62	DNA-directed RNA polymerase	0.836	1357-1366	KPKRKKERSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM62	DNA-directed RNA polymerase	0.763	500-508	PKSKPRKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM62	DNA-directed RNA polymerase	0.614	1079-1080	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMH0	Amine oxidase	0.908	589-617	RKRRERRRGEEVGGSSSNREGRGNEKKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNU1	Uncharacterized protein	0.997	748-797	LPAKKTSKPKPAKSKKAGGAGGLPGKKATAGPGSGAAKKSASKKAAPKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNU1	Uncharacterized protein	0.615	894-895	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q126	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	0.9	310-330	RRERKRQEGLRRREQLRKDKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q201	CUE domain-containing protein	0.859	147-173	RGGRGADSGRGRGRTTERGGRGGARGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q201	CUE domain-containing protein	0.767	11-30	PRGRGSGRGGRGGFATRGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q201	CUE domain-containing protein	0.668	116-124	PKKDRARLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q215	FAM192A_Fyv6_N domain-containing protein	0.979	189-209	GRKRRKGDAGKEKKRLRGVGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Y0	Uncharacterized protein	0.67	531-535	RRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4W8	Uncharacterized protein	0.871	21-36	IRPRPRRRMPSRPLAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4W8	Uncharacterized protein	0.726	52-62	GTKRNHPKRAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q502	Uncharacterized protein	0.858	689-708	PARHRPSPSATRRPSRRHRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B0	ABC1 domain-containing protein	0.663	56-61	RPKPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH2	Uncharacterized protein	0.732	214-224	RRAWIRKRVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB01	Aspartokinase	0.756	353-359	LRKKPKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD8	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.875	127-145	SKRRKRAHTEDPGRRLRHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEY8	ERF-3	0.812	194-212	APAKEEPKKEESKKEEAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF82	Uncharacterized protein	0.997	642-664	RSVKKPRGKKGSKKEKRQPKHRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF82	Uncharacterized protein	0.745	388-403	KPKALVKTKQKPAKSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF82	Uncharacterized protein	0.726	12-17	RRRKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFM9	Uncharacterized protein	0.628	93-96	RRPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFQ5	Uncharacterized protein	0.784	85-95	SVRSKKPKPGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK26	Uncharacterized protein	0.835	291-304	PKKKPPPPSSRHGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK26	Uncharacterized protein	0.653	562-568	ASVRGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK26	Uncharacterized protein	0.648	599-610	RGKEPPPPPTRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK26	Uncharacterized protein	0.603	560-560	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLT4	Transcriptional adapter 2	0.851	157-170	RKKRRIEERREAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMM5	Uncharacterized protein	0.996	1070-1095	KFKAKKKKKLTKRELKEREVRRRLRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A7	Uncharacterized protein	0.787	136-144	KRKKLRPKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q110	Uncharacterized protein	0.878	211-224	LRKAMRKERRAKIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X1	Uncharacterized protein	0.998	247-275	PVKRKRGRPKGSKATKARKDKGVKKGPKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X1	Uncharacterized protein	0.928	364-377	RKRGRPKGSKNRPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X1	Uncharacterized protein	0.926	581-598	PPPKRQRKGKDARPPSGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X5	CBF domain-containing protein	0.937	37-48	KKERPPKRKRQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X5	CBF domain-containing protein	0.856	957-968	PRRGRRGRLSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1X5	CBF domain-containing protein	0.827	498-508	GRSKKMSKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C8	Ribosomal_L2_C domain-containing protein	0.96	87-126	KGRPFLPLTFPKKGHGKGGRNNSGKITVRHRGGGHKRRIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C8	Ribosomal_L2_C domain-containing protein	0.936	330-379	GGRGKSKGNRHPVSPWGQPAKGGFKTRKKSNVNKWVVTPRARNMGKRRNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C8	Ribosomal_L2_C domain-containing protein	0.603	78-79	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6I5	Uncharacterized protein	0.987	101-176	RPSAAKPPPPPGRRGPPPPPSHRDGAPAPNRRPPPPNHRPTRSQEEALRARKMQEKDGRPDPSRSPQRRQERRPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6I5	Uncharacterized protein	0.979	192-217	RRQRDLRRRERERRHRENRDKKPVSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q827	Uncharacterized protein	0.938	468-500	ARKQKEIRARGNRKANFGRAAQSLRRQRREREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q827	Uncharacterized protein	0.771	574-581	KRGKKKHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q874	B-block_TFIIIC domain-containing protein	0.949	1665-1690	PSSKKRRPQKAPGQVRRMQGRPPKLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q874	B-block_TFIIIC domain-containing protein	0.881	775-790	PRGRGHGAGRGKGKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q874	B-block_TFIIIC domain-containing protein	0.864	548-562	ARKSKPSAKRKLLPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q874	B-block_TFIIIC domain-containing protein	0.856	865-878	RTRKPKGGNKGEKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E5	Autophagy-related protein 2	0.69	1626-1639	RRSKSLKLNRSKRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8T5	Uncharacterized protein	0.739	22-33	PPARRAPRAPRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q959	Uncharacterized protein	0.999	435-663	AKPERGRTRSPSRDSRAHRGRDRSRSKSVDRRRRDARSRSRSRTPRPRDRSRSRRRSRSRFRDRRAERKDDYRDDRRDEYRHSRRDDSRSTRRDDRKEDRRYDYRDRSRSRDRADRRERSRSRLRSARIDDRRDRSRSRRRDPRDRSRSPRPRTERRDRSRSRLRFGRRDRSRSRSRDRDYRDRRERSRSRARSDRDRSRDRNREKDRIKEEDRERRRRSRSRSARPPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q959	Uncharacterized protein	0.998	170-321	RRAERERVRAELKAVEEKKRQLEREIKAREDAKRREAERIAREERRKKEREEDERREKERRERREKERELEREREKEREREREREHESRRERERSRDWDRDRDRDRDRDRDRDHDRDHRSRDRDRGRERDRERDRERDQTRDRRDSRESRAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q959	Uncharacterized protein	0.996	761-846	RPRDRNRDRDRDRDRDRRDRSRDRDGDRARDDRRGTRRHSRSRSRERDRDRSRDRSRDRDRDRDRDRDSHYRRSRRERSVSSRRDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX6	Uncharacterized protein	0.905	1218-1277	KPPPPPRSQPAGAGVGNAKKAVAAAGSSSPRKRTRSEVAAAAAAASRSLRRGVRSSSRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJJ9	Uncharacterized protein	0.977	640-666	KEGKKKWARMGKGKGKGEATGGGERGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF8	Uncharacterized protein	0.826	443-450	KKRKKPNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKQ8	RNA exonuclease 4	0.998	315-332	AKSKPKKGNKGKKTKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKQ8	RNA exonuclease 4	0.978	13-58	AKIKAESASKPAAPKRKADDSVPDQAKEGPKKRRKQQQDRGRKPAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPD1	Ubiquitin-like modifier HUB1	0.992	5-137	PRRRSRSRSRSPPRRPKVSGGFKWKDKRSADTDDRRDDRGLQRGYRDRSPRRDRERDRGFGRDRDRDRDRDRDTRDRSPRRDRSRDRDRERERDRDRDRDRYRRDRSPRSSNNSRPSDRDRDAKPKPKKERPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPK5	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.988	224-278	ARRGERRANSDRKPATRSRAAADPSKPSTRTTSTSTRGRKRKGGRATRRSARAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPK5	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.981	624-652	VKAPGRKRKRDTDEKEPRAKTKKVRLRLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S8	Uncharacterized protein	0.688	934-938	RRKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T5	DRIM domain-containing protein	0.999	2569-2614	KREQRSSKRKIEALTAPEKYGREKRKKLEKKKEKRKARGQEQREHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C5	Phosphatidylserine decarboxylase proenzyme 2	0.992	264-280	EKRRRRLRIKGLKRKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C5	Phosphatidylserine decarboxylase proenzyme 2	0.714	813-821	KKRIRKLLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7C5	Phosphatidylserine decarboxylase proenzyme 2	0.649	152-158	KSKRPGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q945	Fungal_trans domain-containing protein	0.678	609-613	SRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV7	Brix domain-containing protein	0.983	30-60	KKATGKARHEERHRRRKEEAKNPELRRQRLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE20	tRNA-dihydrouridine synthase 3	0.672	490-495	KKERKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE20	tRNA-dihydrouridine synthase 3	0.629	355-357	KKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE20	tRNA-dihydrouridine synthase 3	0.619	509-511	KRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QED0	Patatin-like phospholipase domain-containing protein	0.999	168-194	RVRRDRKDAPPSTRKKKKKTRRKARTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF5	Nucleolar complex-associated protein 3	0.978	350-370	SVKKPKAKKEFRTKRERKLLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF5	Nucleolar complex-associated protein 3	0.96	48-62	KSRKAKKKEAKKNGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF5	Uncharacterized protein	0.999	86-102	AKKTKKKQKKKKKKGKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E8	Uncharacterized protein	0.975	636-735	RRSPARRSPSLRDRDRDRERERERNRDRERDRDRDRDRDRDRDRDRDRDRDRRDYRDRDYRDRDRDRDRERDRDWDRERDRDRDRDRERERDRERDRDRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E8	Uncharacterized protein	0.901	555-593	EKHIRRLKEKEDEAERERQRRRDRPDSYRDRGERSHRSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E8	Uncharacterized protein	0.686	365-372	KRLRRDRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C1	HMG box domain-containing protein	0.963	102-123	PRSTRIEKSTPKRKKERARPLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Y6	DNA helicase	0.753	675-680	RRKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Y6	DNA helicase	0.659	733-739	RRPAGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q476	Uncharacterized protein	0.627	704-708	KSKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4X8	Uncharacterized protein	0.759	26-34	HHHHRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5M7	Uncharacterized protein	0.991	281-313	RKDGREAKSRKGKRGDGRKGIGEVVEKKEKEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5M7	Uncharacterized protein	0.628	82-85	KKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N7	Zn(2)-C6 fungal-type domain-containing protein	0.951	78-89	PPRRRKKKPHER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q728	Uncharacterized protein	0.777	98-111	PAKAREKHLARKKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R2	Telo_bind domain-containing protein	0.782	218-226	KGRGRKRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S1	PINc domain-containing protein	0.971	13-47	ARDLHVKRMIGKRDDRRKEEALKKAEQERKKKEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S1	PINc domain-containing protein	0.6	9-9	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW7	Vacuolar import and degradation protein 21	0.689	245-251	RDRRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW7	Vacuolar import and degradation protein 21	0.623	541-543	RKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCW7	Vacuolar import and degradation protein 21	0.62	261-263	PKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ4	Uncharacterized protein	0.982	1094-1125	PQRRARGTAAPKQDAAPEPIKKRGPKKKEPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ4	Uncharacterized protein	0.928	1243-1254	KPKRARGKKGKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ4	Uncharacterized protein	0.851	26-40	RGRGGIPRGRGAKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ4	Uncharacterized protein	0.821	238-262	KRHRADKSPAPARLSSSRRRNPSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ4	Uncharacterized protein	0.724	213-220	ARGSRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIJ4	Uncharacterized protein	0.676	1016-1022	KPKRVRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG5	Cytochrome c oxidase assembly protein COX20, mitochondrial	0.964	152-187	KQAREKKEKEEQERREREKALAKEREEAEKRRRWWR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA8	Uncharacterized protein	0.893	104-125	RPDKPKRGRQGPLTGPKKLKTN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNG0	Uncharacterized protein	0.657	53-58	YKRRLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ6	Uncharacterized protein	0.995	167-207	REREEREERERREKREEREKREEREKREEREKRQEREKREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ6	Uncharacterized protein	0.882	81-93	AARRRRRQSRRPE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT1	Uncharacterized protein	0.976	598-643	REREKRERERAAKEAREKAAERSRELSRQWAEKQRLKKEAERRKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT1	Uncharacterized protein	0.928	426-456	ISRRKREKREAELRAQEEEERKRREFKARPI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2A9	TRP_N domain-containing protein	0.729	854-861	KKRKDKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G2	Uncharacterized protein	0.945	11-28	SSSKAKSKDKRKEKSVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X1	Uncharacterized protein	0.96	386-436	PPPNPPPRPPVGLPDRSPRPEEGASKFPPPPAPPPRKPPPAPLHLKNAKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X1	Uncharacterized protein	0.906	465-503	RRGRRRTREEDDRERAIQAKKEAEMRSLSKKSKKSSSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X1	Uncharacterized protein	0.802	953-965	RNGERGGGKKKSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q971	Uncharacterized protein	0.753	743-750	KDAKKKKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q971	Uncharacterized protein	0.697	628-635	RKKSKFPH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9K2	Uncharacterized protein	0.853	210-223	RQRSRAKESRKKNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M9	TP6A_N domain-containing protein	0.6	363-363	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9V7	Uncharacterized protein	0.842	99-108	WKRKAKAAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA50	Uncharacterized protein	0.981	441-462	RPAPKVPKRKQKPAASLKRKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA50	Uncharacterized protein	0.927	515-536	KPAKRGARTPRLADIERIKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA61	Uncharacterized protein	0.999	299-346	RKAKFRLRRRKRVVHFKGIKKRKMAKAARRREYRKMVREKRAARMAQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA61	Uncharacterized protein	0.765	69-82	LKSKKTIPKKMGAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAD2	Uncharacterized protein	0.985	11-87	SKNRLAARAAKLRKTRQKASKMGQLARQGGAVAKADARRGARPGLLPTSGPNAAISKKKQRKLEKALRHALRRKAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF2	Uncharacterized protein	0.882	37-51	RRRRSKSSQRHRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP5	Branchpoint-bridging protein	0.982	47-69	AKRGRSPERSEHDGPRRRKKRNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE82	Uncharacterized protein (Fragment)	0.754	601-609	IKDAPKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ2	Uncharacterized protein	0.961	52-91	SKSSRRRNKHRKPSSVPSTSEEKKKVTFEKKPLKSALKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ2	Uncharacterized protein	0.924	604-641	RRPAARPTSSGRAGTAAITTRRRAGWTGPLRRRRIPGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ2	Uncharacterized protein	0.919	250-299	PKKGKQSGKKTENEKKEKQRSDEAAGTKNGNQAKEGGKASGSKEAAGRKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ2	Uncharacterized protein	0.783	17-24	RKKKAKPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ2	Uncharacterized protein	0.777	220-225	PKRKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN6	Phospholipase D	0.975	218-231	KGKQKRRRRMRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN6	Phospholipase D	0.822	550-565	MRKKRSRMPYLGGRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN6	Phospholipase D	0.799	1732-1742	SQKRRRRATTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIM1	Uncharacterized protein	0.823	76-86	PVKKAPRRKPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ03	Kinesin motor domain-containing protein	0.938	650-665	SPLRGKGGKKKGSRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ03	Kinesin motor domain-containing protein	0.789	617-625	GGRRKKERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP1	Ribosome biogenesis protein RLP24	0.916	100-125	RARRERMFYKKRMAGKRAREVAAARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKP1	Ribosome biogenesis protein RLP24	0.869	40-57	FKMKRNPRKLKWTKAYRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY0	Uncharacterized protein	0.952	21-53	PRRSRFDRRSRSPPARKPDSGRDRERSPLSKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMY0	Uncharacterized protein	0.789	809-820	KGGRGRPRLRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q276	PX domain-containing protein	0.934	867-881	RKRRARRQARLRRNA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J8	Peptidase A1 domain-containing protein	0.928	502-513	RKRKERRKEKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J8	Peptidase A1 domain-containing protein	0.826	548-557	KIIRKKRSRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q306	SEC7 domain-containing protein	0.873	1350-1364	KQGRKSGRPGKPEKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q306	SEC7 domain-containing protein	0.815	670-677	RERRRRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D7	Uncharacterized protein	0.99	395-420	AIKKGKAKENQKKGAKKGKAAGNNAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D7	Uncharacterized protein	0.941	364-382	LKRAKEKREEKRREEEAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V9	Uncharacterized protein (Fragment)	0.924	167-185	VREKEKKRREEEKEKQRLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V9	Uncharacterized protein (Fragment)	0.648	34-39	RTKPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6I9	Uncharacterized protein	0.995	1027-1052	TKKKAKLTSSELRKKKKERMARRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCR8	Uncharacterized protein	0.703	247-255	RRQRREAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCR8	Uncharacterized protein	0.685	368-374	KSKSKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDE5	Uncharacterized protein	0.862	396-405	WRRRKGDKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDE5	Uncharacterized protein	0.624	277-280	RRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDZ5	Uncharacterized protein	0.625	48-50	RKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG57	1,3-beta-glucanosyltransferase	0.949	186-206	GGGQHRRRRRRDADARGRVRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG57	1,3-beta-glucanosyltransferase	0.898	115-142	GSSRVRRKGEGGGVRRSMIRGRKTTSSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI11	Protein transport protein SEC24	0.658	48-51	KKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF6	F-box domain-containing protein	0.674	241-245	RRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0M0	Pre-rRNA-processing protein IPI1	0.994	6-28	KKKKEKKKDFQKPKLKVGKPKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1A5	Rif1_N domain-containing protein	0.946	1516-1537	RARVGRPKRKRATSKAQETGAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F1	Deacetylase sirtuin-type domain-containing protein	0.992	452-476	QPSKKAPAKRKSRQPRREPTKPKNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F1	Deacetylase sirtuin-type domain-containing protein	0.828	17-29	PPKRRRIAAPPKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S2	Uncharacterized protein	0.969	843-861	RGRGRGRGRGRGERQRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S2	Uncharacterized protein	0.907	613-652	GPGPGPRPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGPGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1S2	Uncharacterized protein	0.889	773-798	GRRVPRPLLKAVLRAARKGAEKGRGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2H1	Uncharacterized protein	0.998	300-324	RNRRGRAKKGRRRKRGGTWWTKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W0	Nuclear protein localization protein 4	0.668	150-156	GKIPRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W8	Uncharacterized protein	0.903	561-569	GKKKRKRAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Z7	DNA polymerase delta subunit 3	0.926	365-377	GRRRGKRRVMRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3V3	Uncharacterized protein	0.987	706-726	GGKKKDKDKEKKKRNIFGLKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q644	Uncharacterized protein	0.99	250-277	APPAKKRGRPKKQATKPAAPVGRTARKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y8	Uncharacterized protein	0.921	5-29	KERAEERRENKRRPKEVQMRRTKED
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E9	SAE2 domain-containing protein	0.638	249-252	RKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q933	Nucleolar protein 16	0.992	7-26	KRKRRSSRPKIKMPNRRKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP3	Uncharacterized protein	0.988	428-439	RRRRRRRRRLRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCZ2	Uncharacterized protein	0.838	353-368	PKPRKEVAPPRKKLAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA2	Uncharacterized protein	0.935	32-54	QRHKKRRSSPSSTGQRRDKRRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEJ3	W2 domain-containing protein	0.98	144-164	HVPKKTKKDKAERRAARKAKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFY6	Uncharacterized protein	0.636	83-86	RRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHG8	Uncharacterized protein	0.981	300-331	EALRREREEKARKRKQEIEERRKEILERKTKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHX6	DNA polymerase kappa	0.906	596-606	KAKGKKRGRPL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ1	FHA domain-containing protein	0.999	37-123	ESGKRVDRSRSRERDHRRRSRTPESRDRRSRSRDRERRRERDRDRHRDSRRQRSEERRDRRNREHDDDWKERRSGRSPDNRSRRLPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB9	Zn(2)-C6 fungal-type domain-containing protein	0.922	159-170	KQKRPRGRPRKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG9	Uncharacterized protein	0.766	252-262	RVARPKRAPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q077	Uncharacterized protein	0.858	256-293	SDRSRRSHRSHRTSASRRYRESRAKSEVSDRKSSSGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q077	Uncharacterized protein	0.838	355-375	KPKEKKRDMIKQLFKMKKDKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0T6	Uncharacterized protein	0.972	462-531	RRRRSRRQSSELKDYHRREKERERERDRDRDRIYRDRERERERERERDRPSLRERDRAHSESDRHRLAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0T6	Uncharacterized protein	0.927	651-727	RERELMMRERERERDRDRERIRLESRERERERERERFRDDSSGGGGGERWLREGERLPRERNRDRDRDRDRDRERER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q294	Uncharacterized protein	1	464-487	KDKAKKEKEKAKKKEKKKKKSRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5G3	Uncharacterized protein	0.934	199-211	KPKKKKWTLKKRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP8	Uncharacterized protein	0.754	311-324	DRKKLEAMRGKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAP8	Uncharacterized protein	0.705	114-118	KKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ6	eIF2B_5 domain-containing protein	0.965	127-136	KKKKKKKVPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ6	eIF2B_5 domain-containing protein	0.925	96-104	KKKKKKVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAQ6	eIF2B_5 domain-containing protein	0.704	335-341	KRKKMKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV3	PHD-type domain-containing protein	0.934	739-768	LRAAKKPRTGLRVKNSPMKKKNGPSAGIPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV3	PHD-type domain-containing protein	0.902	300-313	RRIRAKKRQGRKDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV3	PHD-type domain-containing protein	0.808	409-415	PRKKRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV3	PHD-type domain-containing protein	0.77	523-534	RRRRSNAPRKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW7	Uncharacterized protein	0.976	188-206	KLERRRQKFERRRRRQKER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW7	Uncharacterized protein	0.746	401-407	RRKKSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG52	CUE domain-containing protein	0.978	643-700	GGRGRGRGRGGRGGSRGGGAAASPGPDSDLARRRKEANKGSRANHNRRDQRARKMARA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG52	CUE domain-containing protein	0.939	297-318	KKPGGGLTKPKRLIKRKIDKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV2	J domain-containing protein	0.995	476-501	KKEKESKKKGKDKKDEKKEKGDRPGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV2	J domain-containing protein	0.804	237-245	KRKDKKHKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI70	Uncharacterized protein	0.621	52-54	RKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIK4	Uncharacterized protein	0.967	712-727	KARARARKKGREPPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E6	BHLH domain-containing protein	0.826	278-286	RRKRRRESH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q578	Spindle pole body component	0.864	785-810	RHRHRHRRRSQSQSRSRSESRSRTRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q674	RNA_ligase domain-containing protein	0.882	586-593	KKRKKNRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ9	Uncharacterized protein	0.978	105-120	VRRRKEAKKKKAAAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ9	Uncharacterized protein	0.966	226-331	RPRERPWERPRERTLTRETTKDRERSEGGVRDWVRERQRKPRTEEAREVSKGRARAEGGLERSERVPRSERYRNHREHGRSHEQPEERPRHHRSRRRNESMQRARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEQ1	Pyr_redox_2 domain-containing protein	0.879	69-79	PPKKRRFRKLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL5	Uncharacterized protein	0.939	299-313	RLRRHRRRRGARTDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL9	RING-type domain-containing protein	0.903	639-647	GGKKKKKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL9	RING-type domain-containing protein	0.778	51-69	RKSQGARKQHRNQRRAGTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL9	RING-type domain-containing protein	0.736	480-487	RRRKRNRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF2	Uncharacterized protein	0.887	834-843	RHPKKRRRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF6	mRNA cap guanine-N7 methyltransferase	0.922	16-54	KKLAPAKKRQRSQSPNRSGSAGTSGEPPRKLKRPGQRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF8	WD_REPEATS_REGION domain-containing protein	0.733	174-180	GKRRKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL93	SUN domain-containing protein	0.919	201-234	RRSPRKPQPRDVRKRARDDEDEARAEKERKERDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL93	SUN domain-containing protein	0.856	408-427	LKRPPRRPGGTTPAPRHERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL93	SUN domain-containing protein	0.736	128-144	RRRSKDQARAARAARAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA6	Uncharacterized protein	0.875	385-398	KKKPPPPPPPPKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA6	Uncharacterized protein	0.768	90-101	KTIKKRENKRLD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMA6	Uncharacterized protein	0.684	103-118	EKAQDKALKLQRKPGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ58	HSF_DOMAIN domain-containing protein	0.865	781-789	RGTKRRRKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ58	HSF_DOMAIN domain-containing protein	0.817	236-247	PKSGNSKKKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ65	Uncharacterized protein	0.745	70-80	RKDRRRRELDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0D6	Tim44 domain-containing protein	0.862	134-142	AGRKKKEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S2	ATP pyrophosphate-lyase	0.751	435-447	HKRRFLGRLRGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q249	E3 ubiquitin-protein ligase	0.991	477-556	KAKSKAASAPAPKPMARPAEKPKALAENGKERPKEAPVPKPKPAPAAKVSPREQKNEKEKDTIRAEVIARPIKPAAKRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q249	E3 ubiquitin-protein ligase	0.984	103-140	RQPKRKPKTTAPKTAKPAGKGEPVAKKAPARGSAKSSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q249	E3 ubiquitin-protein ligase	0.897	635-658	KARERERERERERERERERDREWR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q249	E3 ubiquitin-protein ligase	0.692	422-428	NKKKPLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C6	Uncharacterized protein	0.947	300-329	RGERRLDDRPGPEADEPRARARARRRSRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y5	RING-type domain-containing protein	0.853	177-201	AKPSGKKGVRGITRSITARLRRRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q966	Uncharacterized protein	0.992	875-900	DKDAARLNQPRRKREPKGKSKKSRTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q966	Uncharacterized protein	0.987	279-302	KPRPSRSRSKQPTGRPRGRPRKRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE0	BZIP domain-containing protein (Fragment)	0.758	431-443	GASARFRQRKKER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMM7	RRM domain-containing protein (Fragment)	0.874	192-211	RRKVSPPPPAARRGPRGPPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMM7	RRM domain-containing protein (Fragment)	0.834	55-91	GRYRSWSRGRSLSRTPSRSRTPSRSRTRSRSYSRGRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM6	tRNA(Ile)-2-lysyl-cytidine synthase (Fragment)	0.924	685-721	LGGRRIGRREMRHRLRCLYRWVRLGRAKEAPRRRRMA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM6	tRNA(Ile)-2-lysyl-cytidine synthase (Fragment)	0.837	438-450	REKEKQRRPRRWL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK6	Uncharacterized protein	0.789	179-186	KKARKKPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZR8	Uncharacterized protein	0.997	266-331	KPKNPSPVSAPARRKSQRRSQGSVKSVKSPTKTSMKDPLLPAQARLPSGSRPKRAKSKKSRRKPRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZR8	Uncharacterized protein	0.696	393-400	KPKGKEGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q026	Uncharacterized protein	0.98	349-362	PKKRKPRAHRKRLE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q026	Uncharacterized protein	0.961	216-229	PPKPKRRPMKPRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q026	Uncharacterized protein	0.845	372-383	PFEKSHRRKRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q035	Uncharacterized protein	0.655	463-467	RRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H6	Uncharacterized protein (Fragment)	0.694	35-39	PRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2M4	Uncharacterized protein	0.756	334-340	KKRGKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2M4	Uncharacterized protein	0.749	213-227	PPKPTRRRLVQGRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q413	Uncharacterized protein	0.75	38-46	KGRAKKVRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F8	J domain-containing protein	0.986	426-439	KPGGKASKRKNKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F8	J domain-containing protein	0.979	250-282	RKMRRMQERDAKKEAQGAGRKARRGRPSPAASG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F8	J domain-containing protein	0.847	82-100	AERAKAQKEKNKQNKGKPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F8	J domain-containing protein	0.632	66-69	KKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T5	Uncharacterized protein	0.997	1220-1244	RSKGKGKRTKSAARKGRGKKSRAEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T5	Uncharacterized protein	0.916	1169-1181	PPAPKGGRKRKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T5	Uncharacterized protein	0.902	89-100	QARRRRREGRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V9	Uncharacterized protein	0.763	315-330	LRGRRRAENRGGSDAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V9	Uncharacterized protein	0.74	242-249	RRRHRRSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7T3	Uncharacterized protein	0.914	428-438	RKGRGRPRKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA1	Uncharacterized protein	0.955	210-223	AKKPPTRRKRKIPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ58	Polyketide synthase	0.754	1651-1671	LKLKPFKAHLSRQLARRRPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKA2	USP domain-containing protein	0.761	847-853	KRRKRKW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL38	TPR_REGION domain-containing protein	0.979	124-140	RRRAKGEKKRVKKAAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLV3	Tubulin-tyrosine ligase-like protein	0.872	258-270	SKNKNKSKSKRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPI0	Uncharacterized protein	0.713	42-47	PKKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N9	ENDO3c domain-containing protein	0.793	58-69	KSKRGGKKQPQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E0	Uncharacterized protein	0.918	56-68	KPRKRGRPMKPRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5I9	Uncharacterized protein	0.978	347-382	KKPAPISKSASPTKKIKLGAAKPRLPSPAGKKVKKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5I9	Uncharacterized protein	0.898	287-309	PKKKKIKPNSLTKKVILKAKSSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5I9	Uncharacterized protein	0.778	160-166	GRGKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M2	Protection of telomeres protein 1	0.964	358-403	HKKKRQQIKAIKAAEAAGMKRKASLSSKKEDLPPNSKERRKQKRTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8X8	Fe2OG dioxygenase domain-containing protein	0.697	61-67	KAAKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF8	Uncharacterized protein	0.838	693-704	RSGGRRRGGGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD01	Rho-GAP domain-containing protein	0.913	709-721	KEKKRRWRLSRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD01	Rho-GAP domain-containing protein	0.655	532-536	LRKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE77	DUF2040 domain-containing protein	0.753	11-25	KKAGPAKPAPAPRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE77	DUF2040 domain-containing protein	0.646	70-74	RKKPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH68	CYCLIN domain-containing protein	0.796	220-234	RRRRQKREQEMRERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHD7	Uncharacterized protein (Fragment)	0.825	36-47	REREKRHRKFRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK23	HUN domain-containing protein	0.993	588-648	ERPRRGRGGRGRGSRGGGGTVRGEGSGRGRGGGGPGSRGGTVRKPRITKLEKEQRDREKAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK23	HUN domain-containing protein	0.978	104-127	APKQRRPRKPKDPNAPPVQRKRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK23	HUN domain-containing protein	0.95	75-93	PRKKPGRKPGSTVKPKPPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK23	HUN domain-containing protein	0.736	531-537	KPAKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK89	RING-type domain-containing protein	0.995	366-396	RRGAHASPVGKRKRRASGKPREGRVSRARAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB8	Uncharacterized protein	0.992	37-56	RRTKGASPKRKRSPRPRPRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB8	Uncharacterized protein	0.97	163-209	KRVRPSKDGSSSSGSRGRSPSEEPPPPRPSRRFSKESPPRPRHHKRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB8	Uncharacterized protein	0.807	316-356	RGTRAPSFRKRNSDRERVQDRQSSPPARHERARTRPSPPRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMB8	Uncharacterized protein	0.689	113-127	RHRVDKPKATGGRNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ17	PseudoU_synth_1 domain-containing protein	0.982	65-78	PPKEKKKKAKKASK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q165	Valyl-tRNA synthetase	0.961	26-60	KKNEKKEKAKADKAAKFAAKQEKLKQQQPKKDAAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T4	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.971	729-746	RGHKKKSKGITKKKGPRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3G3	Uncharacterized protein	0.973	128-137	KPKKKKKKER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q585	RRN7-type domain-containing protein	0.755	60-68	RKKKEARHA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5C3	Uncharacterized protein	0.996	233-279	RKKKAKSGKGEIKKGSKAWIIKKKEQMERKGKIVKATSKYTGRKRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Q9	Uncharacterized protein	0.875	1194-1204	RRRRRRFRWVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q867	60S ribosomal protein L36	0.974	69-92	NSKDKRARKLAKKKLGTFGRAKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J7	Uncharacterized protein	0.944	157-167	EKKKKKKEEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J7	Uncharacterized protein	0.81	138-147	RAPRPKGRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8R9	Splicing factor YJU2	0.852	287-305	KRQVKKKKDHAALLGIKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB08	Uncharacterized protein	0.937	1326-1338	KPPGKRGRPRKHP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB08	Uncharacterized protein	0.726	126-132	RRRRLRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB08	Uncharacterized protein	0.627	1195-1199	RGGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC35	DUF4604 domain-containing protein	0.962	189-201	VKAKAKKKAKKIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC35	DUF4604 domain-containing protein	0.735	43-51	RRRPAKPRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH1	Protein kinase domain-containing protein	0.839	128-136	PPRKRRRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT0	SRP40_C domain-containing protein	0.944	452-470	GKGFTKEKNKKKKGSYRGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT0	SRP40_C domain-containing protein	0.905	249-265	PATKKAAAKKETSKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT0	SRP40_C domain-containing protein	0.604	8-8	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL57	Uncharacterized protein	0.958	391-406	NKKKQKTKTKRRLRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL57	Uncharacterized protein	0.706	614-620	RRRQRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL57	Uncharacterized protein	0.675	857-876	GGGGGGRGAAAAAGGRDGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL57	Uncharacterized protein	0.606	36-37	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLC7	Uncharacterized protein	0.743	297-312	RKRALAYRMKQKRARE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU6	Uncharacterized protein	0.901	574-589	RRRNRAARRAQKRQRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ8	Uncharacterized protein	0.763	169-180	PMSRAERRRRIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q158	Uncharacterized protein	0.959	77-185	GRKRSNDAERRGRSKKTDGGRNDEQSRDRSRDRDHRRGRHGTRQDDEEEEGRRSHRKHDDRTPDGGGRRRRRDRSCSPQQRAHKQRDRSPLGSRVEDDRPRHSRSRRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q158	Uncharacterized protein	0.782	242-253	PRSPVRKRGRGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q158	Uncharacterized protein	0.617	53-55	RRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q343	TRP_N domain-containing protein	0.605	623-624	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q460	Uncharacterized protein	0.799	91-121	KEKEKEKEKEKENDEEKEKDEEKAKGSKPAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q460	Uncharacterized protein	0.734	252-258	PKGKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4D8	G-patch domain-containing protein	0.986	196-236	SPPPPPGEKQREEEKKKKKAQLLDAKKVRKMALDDRKKAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U4	Polynucleotide adenylyltransferase	0.963	1151-1165	KKEKKKKGSASKKQI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q635	Ubiquitin-like domain-containing protein (Fragment)	0.691	404-409	RKKKGI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8J1	Uncharacterized protein	0.994	122-155	QKRRHGFLARKRSRTGRNILKRRMAKGRKKLSHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q931	Flavin_Reduct domain-containing protein	0.959	4-40	KKRRRTSNAKSKSLPKATKEPERKGTKTPSSTRTRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C6	Protein kinase domain-containing protein	0.869	478-539	RRDDRRPPPPPRRDDRDVRRHDWGDRRRDYDDRSRNSRTRSRSRSPIRDWDRDRDRERDRDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC9	Usp domain-containing protein	0.761	183-191	KRLKKKEKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV2	Peptidase_M24 domain-containing protein	0.999	387-405	GKNKNKKKKKKKPAKKEAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC57	Uncharacterized protein	0.691	94-103	KRRGGPKTAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX6	Tyrosine--tRNA ligase	0.921	349-363	PPPKKEKKVKNKGTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG35	Uncharacterized protein (Fragment)	0.989	14-33	PKVPKLLKGSKKRPKKRHPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q019	Uncharacterized protein	0.738	682-698	RGRPSRVHSTPKRPAPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N2	Uncharacterized protein	0.814	212-220	PDKRKRKSW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N2	Uncharacterized protein	0.798	1039-1045	KEKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3V8	Uncharacterized protein	0.741	1114-1128	GGGGGGGGRRHGRTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q451	Uncharacterized protein	0.614	373-374	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E2	Methylsterol monooxygenase	0.901	290-304	KRRREKKLAELRAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5P7	Uncharacterized protein	0.997	757-802	EAARRRAAAREEKARAREEARKVKEKLREEKRAARRRLRDEAGKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6L0	Ribonuclease P protein subunit	0.998	51-80	RAARRRAREKKKQQRKKALKPKPLSATQRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W4	Uncharacterized protein	0.865	1171-1213	TKRILREGREKMRLYREQQKEVRRRQQEEKEKADREAKRAAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8K2	WD_REPEATS_REGION domain-containing protein	0.615	177-178	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH7	Transcription elongation factor Spt6	0.991	79-90	RERRKKKKRRRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE26	ING domain-containing protein	0.796	445-454	KAKAQRKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE26	ING domain-containing protein	0.687	192-198	KKVRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEP6	Uncharacterized protein	0.993	604-634	KDDKKKRKEKDKDKKSGGLRGFFSRKDKKTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV7	Uncharacterized protein	0.871	400-421	KKAAELTPKPPKPPAKRSPFDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV7	Uncharacterized protein	0.723	243-250	EPPRRRSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV7	Uncharacterized protein	0.605	423-423	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHY7	Histone H2B	0.993	5-45	ADKKPASKAPANVASKAPEKKDAGKKTAPSGDKKKRSKARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ48	Uncharacterized protein	1	73-117	RRWRVRRQFGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGKGAGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB1	PIPK domain-containing protein	0.806	313-321	KRASKRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKB5	Uncharacterized protein	0.649	252-260	RRHKDVRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL63	Uncharacterized protein	0.91	385-401	DKKRKKLTAGAKSRPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL63	Uncharacterized protein	0.896	278-327	RRALLRAKLKERDRKLSKQKGGWFWWLPGRRVADKPPATSHEKAHHPRHA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QML5	Uncharacterized protein	0.657	148-154	RRPKPIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN33	SPX domain-containing protein	0.642	147-150	DRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNE0	Uncharacterized protein	0.956	127-158	GEKRKRKDRTRGSPTNGWRERPGSPNGGPGRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE9	ULP_PROTEASE domain-containing protein	0.974	924-961	KRKRKEEEERRERERLLEEERRRKEEERRREQAARQRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQE9	ULP_PROTEASE domain-containing protein	0.728	807-820	RRAKTLARPPPRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J5	Uncharacterized protein	0.933	373-410	RRDPLRDSEPRDPRGARRPEPEREDRDRDRDRNRHHRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S9	Uncharacterized protein	0.999	208-283	KKGGAGRDDEPKKKKKKRYGPKGPNPLSVKKPKKKTPAVPPPKPKATAPPRAEEGTIEAPTEKKAKRKRRKKSKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2S9	Uncharacterized protein	0.642	182-187	RPNKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q321	Uncharacterized protein	0.879	150-179	RSRSRSRSRSRSRSSSGSGSGGGGGRKKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q370	Cell division control protein	0.66	28-34	RPRRTPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q392	Uncharacterized protein	0.885	160-173	KKKPKRGLNPKHER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4I7	Uncharacterized protein	0.992	68-97	VGRVLAHGPGRRRWRRRIRGGGGGGRRLGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V1	Uncharacterized protein	0.965	7-24	RKGEKAQGEGRRKKKEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S2	Uncharacterized protein	0.797	1762-1776	KKAGIKRLLSLKKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S2	Uncharacterized protein	0.752	102-108	KRRRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S2	Uncharacterized protein	0.735	727-735	RRAKARAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7F5	Protein FYV4, mitochondrial	0.909	206-231	RGHKVDGGERRRAEIRFKRRVAERKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q803	Uncharacterized protein	0.986	57-89	QKGTKRRAVSKGKRSAGKGAANGAKAKTRAAGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q803	Uncharacterized protein	0.683	923-927	KKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8L8	Thioredoxin domain-containing protein	0.852	6-25	RKRKEAPAPPPPVRRKMTKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF9	Uncharacterized protein	0.993	515-550	KLKKRRVRRRPRQHQKEEEAPKHQEKRAEDRRREHH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAF9	Uncharacterized protein	0.779	581-591	SHRRHRHHRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCB4	Uncharacterized protein	0.879	422-435	GKHHKKTGRRRMRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT4	YL1_C domain-containing protein	0.993	121-164	QARAKRAAERKRKAQDAIPARFRKKVRIEQPAPRPPRPKKKSER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT4	YL1_C domain-containing protein	0.71	201-214	RRKKQLERMERKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV8	SWR1-complex protein 5	0.908	76-86	KGKKRLKKSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF7	Uncharacterized protein	0.982	295-352	RAKREEAIRRDIEEARRLRAENEARERRRLEEERAKREEAEKEKERERERERERERAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF7	Uncharacterized protein	0.801	203-220	RHHHHRSPSRSHSRRRPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI9	Helicase ATP-binding domain-containing protein	0.967	1027-1063	RKDPKRAGVKTSEVSREKKARGGSKGNAPSERPSRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI9	Helicase ATP-binding domain-containing protein	0.885	148-163	PKEGKRRATKKQGSGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC2	AMP-binding domain-containing protein	0.806	77-89	RKLIKIHKEKKKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT4	Uncharacterized protein	0.955	133-153	KVDKRKLEKAERKIAAKQKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ9	Protein kinase domain-containing protein	0.985	351-366	ERKQRRRERKRKEREM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN82	Uncharacterized protein	0.997	51-109	DKYIRQPKPKAARKTAKKTAKAGDDDRKEEKEEEEENDKAPKARSKGATKGKGRPKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNT9	Uncharacterized protein	0.683	73-77	RKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP56	BZIP domain-containing protein	0.83	207-225	KRRRNTAASARFRIKKKQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ91	DDB1- and CUL4-associated factor 13	0.989	389-441	RRIRRHRHLPKVVKKASEIKREELAAIKRREENERKHSNKKFEKRKSEREKAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB3	Uncharacterized protein	0.981	312-358	RRSPSSPKLRQAQGPEPKSRPAAPRRAGKGKDFVIHPPKNPVRKAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQB3	Uncharacterized protein	0.645	234-239	SRRTKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G9	Chitin synthase	0.978	137-178	PRRHRSTKHRAAEAEKSGRTRGKASSGAKHGKISKDLKSKRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J7	Palmitoyltransferase	0.858	91-101	KSTKTKRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2E0	Nop domain-containing protein	0.99	399-424	KAARPLPAPDDKPSRKRGGRRARKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4F3	DUF1713 domain-containing protein	0.999	321-349	KRQRKLKMKKKKYKKLMRKTRNIRRKLDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5B1	Uncharacterized protein	0.761	302-308	KKKKKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5H5	Uncharacterized protein	0.917	112-123	KKKKRPPRQARG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Q8	Uncharacterized protein	0.783	694-704	RYKRKKQAHRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q9	Uncharacterized protein	0.868	356-366	GKKRVKKGKWK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q9	Uncharacterized protein	0.605	249-250	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R9	Uncharacterized protein	0.97	305-329	AAEQRKKDMARQAKKSRKGPAGKPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R9	Uncharacterized protein	0.934	839-850	KGPAKKKKQKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F1	Glycosyltransferase family 8 protein	0.831	354-369	WEKKQKKKEEETKVKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8W2	Uncharacterized protein	0.983	62-86	SKGRKRKQRIEPGAARERRGPKRQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI5	CCHC-type domain-containing protein	0.973	226-257	AERRRPRSSISARREEERRKAQQLAGKRRKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH92	Uncharacterized protein	0.843	182-194	KRSIERPKKRWRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIW4	Uncharacterized protein	0.791	482-502	TKDKKDKTRSTGPKVRNKNAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKC1	Uncharacterized protein	0.635	431-435	KRLKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q220	PHD-type domain-containing protein	0.982	209-242	KTAPAKVPPSERKTKKTKLPPSSRGPGVKRKRTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H3	J domain-containing protein	0.986	221-236	GDGPEKKKKKKLKPIG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H3	J domain-containing protein	0.618	184-186	RRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3M0	C2H2-type domain-containing protein	0.985	126-160	RIKEEKERLKSGRRREPERPRGPREAQEEREKEKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3M0	C2H2-type domain-containing protein	0.726	41-48	RSRRRSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q8	Uncharacterized protein	0.989	153-171	HRLRRPRRPRRRHLVRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4S9	Sister chromatid cohesion protein	0.996	1703-1738	GRGRKRKAQHGGAAGPKKKMARSGSQQPRKRGRPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5X4	Uncharacterized protein	0.992	475-556	KKEEEKKEEEKKEEEKKEEEKKEEEKKEEEKKEEEKKEEEKKEEEKKEEEKKEEEKKEEEKKEEEEKEEEKEKKEKEKKKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9F4	Chromo domain-containing protein	0.908	4-21	RSPAKSTKQKRRGRAAPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU3	Calponin-homology (CH) domain-containing protein	0.94	409-431	GRSLRPGAGDEKKKARSRSRSRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU3	Calponin-homology (CH) domain-containing protein	0.696	266-270	KKRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU3	Calponin-homology (CH) domain-containing protein	0.657	283-287	ERRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG8	HABP4_PAI-RBP1 domain-containing protein	0.993	217-273	KTKRERERKAKQYIEIDNRYKEPERPRGGRGGRGGARGDGGRGRGRGGAPRGGRGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG8	HABP4_PAI-RBP1 domain-containing protein	0.873	79-104	RAKPTDAPQRGGRRGGFRERGDRRPY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ93	Uncharacterized protein	0.962	113-138	PKKRARTNKSSKSAAGGSKRGARAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK70	Component of oligomeric Golgi complex 3	0.98	91-100	PKKKRKRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY6	MFS domain-containing protein	0.642	107-114	KRHHGGRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQF7	Uncharacterized protein	0.957	249-265	WRRKKRLKKAPSDIPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW3	AP_endonuc_2 domain-containing protein	0.997	446-471	KKAEKDARKGAKRGPKAKGKGKGNKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW3	AP_endonuc_2 domain-containing protein	0.874	81-90	KKKPAAKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Q5	Uncharacterized protein	0.999	221-244	RRRPPPPKRKAKGPGRGRRKGKLP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S7	Ubiquitin carboxyl-terminal hydrolase	0.987	615-659	LAKEKKEAKAREKAEEKARKAAEKEQARLAAKERNEAQRRRIEAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0S7	Ubiquitin carboxyl-terminal hydrolase	0.616	683-684	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F0	CDH1-like protein	0.95	1405-1428	GPKHRRLEAEGRQEKKPKDKERPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F0	CDH1-like protein	0.901	1595-1628	RRPRDPYRDDRREERREERRDERRDDRREEPRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F0	CDH1-like protein	0.894	162-181	RRKSSNKRRRLERSQPTSKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F0	CDH1-like protein	0.873	1065-1091	PRKAALKGSKKNAESDRADRLAKKRQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1F0	CDH1-like protein	0.613	1564-1567	RLKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U8	Phosphatidylinositol 4-kinase	0.924	71-85	RSGGRHRRRGRRNSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U8	Phosphatidylinositol 4-kinase	0.901	103-115	ASKFKRSRGKKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4U8	Phosphatidylinositol 4-kinase	0.712	323-328	RKRKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V8	Transcription initiation factor TFIID subunit 2	0.985	1364-1392	RPAEKRPKPPKKRKSDDGDGVDRPKKVAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6V8	Transcription initiation factor TFIID subunit 2	0.661	1510-1517	KKKIIKLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6W2	Uncharacterized protein	0.662	72-77	RRPRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9C0	Uncharacterized protein	0.627	1108-1111	KPKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9Q3	Structure-specific endonuclease subunit SLX1	0.865	301-313	KLLKHRSRRRRAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR0	DUF1279 domain-containing protein	0.885	13-38	RPRLALTRAPLPKPRRPFHSTRPRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR0	DUF1279 domain-containing protein	0.602	207-207	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHN2	Drf_GBD domain-containing protein	0.898	434-467	RAKKDKKRHSRGLSLTIVRGGGNKSNPSSPAKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHN2	Drf_GBD domain-containing protein	0.769	160-176	KPPKSRDTSPTKPKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJT3	Protein kinase domain-containing protein	0.813	257-270	KAQMRRRSRGRAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLQ8	R3H-assoc domain-containing protein	0.922	132-160	PRRPPSRRDSMRRRDALLKGKEGSRQRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLQ8	R3H-assoc domain-containing protein	0.733	211-220	EKQRRRQKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW1	Uncharacterized protein	0.98	549-582	KKEEEKKEEEKKEEEKKEEKEKEKEKEEKKEERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW1	Uncharacterized protein	0.841	626-665	AASKPRAPHAGRLTGRKPHVPQAKPSTGQRVTAHKSPRRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C2	PHD domain-containing protein	0.98	192-215	PPPPKPKKNTKKFRAAQRSSKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2C2	PHD domain-containing protein	0.973	334-382	RAREEERKRLEEEAARRKQEEQRLKMERERERRMMSRERRLREREARRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3S3	Uncharacterized protein	0.679	104-109	TQKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4J9	Zn(2)-C6 fungal-type domain-containing protein	0.917	60-79	KADWLKREVKRKAAHRRERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5F4	Uncharacterized protein	0.938	152-169	RPGPGGKEGHKTRRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6E9	Choline_kin_N domain-containing protein	0.863	139-154	VKQASRRSRRSRLRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6E9	Choline_kin_N domain-containing protein	0.81	210-220	LGRRHRKRSSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S6	Uncharacterized protein	0.756	56-65	QKHRRSKAKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S6	Uncharacterized protein	0.669	292-296	KKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAZ2	Uncharacterized protein	0.993	301-324	DPRRVERKKHGRVKARKRPTWVKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBB2	3'-5' exonuclease domain-containing protein	0.724	127-134	PKPKPKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE22	MI domain-containing protein	0.998	703-976	RSPSRSPSRSRSRTPRRAIDRGRGRGRSVSRTPPRRGRSYSRSRSYTRSISTGRSPSRSPSLSRSRSRSRSRSRSPVRRRAAARGRRSISRTPSRSPSPSRTRDGRGRGRGRSYSRSPSPWSASRSRSRSLSRSPSPARRRGRSYSRSVSRSRSPSRSRSPPRSPSPVAGPAGAAGKRRRGGSYSPSPPPARRQRRYSRSRSRSVERGGGVPGGAGGGGGGRGRGDSYSRSLSRSRTPSRSPLPPPSPSPRGAAGNGRGGGDRRRGGGGAPGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE22	MI domain-containing protein	0.997	27-133	RRRSPSPRRGRSLSRDSRASRDYDRGVSPAPRDASRSPSRDRSPSARSPSPPPPRRRSPSPRDRSRPRSHDRSPARSPPRRRYPPPARRDADRYRPPKKERTPPPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE22	MI domain-containing protein	0.99	992-1040	YRDRGRGRGRSRSPRSPARSPAGPSGGKRRRYYSDSRSRSPGPSKRGRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH1	Uncharacterized protein	0.726	74-89	LSKKKHLTTRARQSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH1	Uncharacterized protein	0.642	67-70	RRKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJW5	DNA mismatch repair protein	0.981	198-216	RTKKRKRGAVKPTGPRKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJW5	DNA mismatch repair protein	0.734	274-282	SGPKPKPKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ8	C2 domain-containing protein	0.918	27-49	PRAINRIRDKLKTKKGKLADRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ8	C2 domain-containing protein	0.901	641-662	WKRRMKRIKNSGGGRGGQKQDG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKV7	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.728	1078-1087	KKKLKGLLRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKV7	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.673	953-960	KTPRRPPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKV7	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.605	915-916	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX7	Uncharacterized protein	0.984	204-217	HAARKRKRRRRQGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMH5	RRM domain-containing protein	0.995	261-347	RRKRRRDTPDPDEGEGRRGERDRERRDDRRRREDRGDDNHRKHRDDHRRRHRDESRDPGERRHRDLEDRRRRDRERSRSRSPRSRRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMH5	RRM domain-containing protein	0.994	187-224	KKEVEEALRREKRRLEKEDRKHRDKERHRHRAHHSRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNU5	Uncharacterized protein	0.883	592-602	AGGRGKRRKLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNU5	Uncharacterized protein	0.791	959-970	LRGKARRERIRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNU5	Uncharacterized protein	0.787	617-626	GGRAKKPKAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP51	Uncharacterized protein	0.816	650-666	KRPRTSPSKNPTPKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR6	Bms1-type G domain-containing protein	0.769	22-50	KPFKSRHATKGQLRDAAKGRIAGEKGQRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ48	Uncharacterized protein	0.741	199-215	ARLRAKVRERERMLRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X8	HMG box domain-containing protein	0.956	282-348	PKKTAATTRKRKSTAAATPAAPEPEPPKSAAATPASPETKKRKRTSKAAEQVVEEPKKSGRKKTKSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X8	HMG box domain-containing protein	0.88	116-130	KKERKKRSHDPNAPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Z6	Uncharacterized protein	0.993	135-152	AKRSKKQRKRGKSKNKAN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E2	CP-type G domain-containing protein	0.998	7-53	KPKKPKSKRTPVRLRHKIEKASAAKQRKARKLAKKNPQWRSKLKKDP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Z7	Uncharacterized protein	0.845	675-691	PRSKSKSRKSIFSRKKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4N7	Uncharacterized protein	0.771	40-49	KPPSPKRAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S3	Ribosome biogenesis protein SLX9	0.98	77-96	AKSSEKSTGTKKKRRRPSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S3	Ribosome biogenesis protein SLX9	0.948	133-157	GKVRHKSLKTRPGALKRKEKLVKGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S3	Ribosome biogenesis protein SLX9	0.812	21-37	PRPSKRPTARQKARARL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q670	ANK_REP_REGION domain-containing protein	0.97	10-34	TLKKPAAKAKTKKPDGKACKGKTKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Q0	WD_REPEATS_REGION domain-containing protein	0.616	412-415	RRPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9M1	DUF4048 domain-containing protein	0.653	64-68	GRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD17	MFS domain-containing protein	0.862	333-343	RHLKEKKKKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW1	DNA replication ATP-dependent helicase/nuclease	0.802	133-140	RKGRKRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGE2	Uncharacterized protein	0.935	311-328	RRRPPGGLPSRPQRKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI68	Uncharacterized protein	0.898	597-611	PASSPVRKRKPKAGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI68	Uncharacterized protein	0.666	214-218	TRRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJG6	DNA polymerase epsilon catalytic subunit	0.601	1298-1298	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ4	Rab-GAP TBC domain-containing protein (Fragment)	0.815	518-535	RRKKRQREAAQMARHAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ13	Uncharacterized protein	0.971	143-171	RRRQAEADAQRRRPGPKRRTSSSRKATKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0J8	Uncharacterized protein	0.948	378-393	ARRSWDRQRKRRRKQH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2I7	WD_REPEATS_REGION domain-containing protein	0.83	137-148	KKHRRRVSRGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2I7	WD_REPEATS_REGION domain-containing protein	0.708	287-296	KKKLRSIRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2P1	Uncharacterized protein	0.998	27-48	SAPAPRRRKNHRGGRRKKQRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E1	Uncharacterized protein	0.75	584-596	KGMRQGRRIRRSV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4E1	Uncharacterized protein	0.634	256-260	KQKRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4P0	AAA domain-containing protein	0.998	60-80	KKDDKKKNDKKKVKKKKDKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5J9	EST1_DNA_bind domain-containing protein	0.962	116-149	AAAEGRKNKSPSPGFKREGSRSRSVSPPKRKARA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Y6	Uncharacterized protein	0.777	18-25	RKKRSRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Y6	Uncharacterized protein	0.743	91-101	RGTKPPKPQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q846	Uncharacterized protein	0.86	562-579	EKEKEKEKERERARDKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI8	Uncharacterized protein	0.882	946-969	GGSGGKDRRGDKRSAHPPPKDPGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC07	Uncharacterized protein	0.815	955-985	RVGRPPAHASKSTEPGGSSKKATGPRSLKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC38	Uncharacterized protein	0.602	134-134	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDG1	Uncharacterized protein	0.983	8-19	RYRRRRRRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDG1	Uncharacterized protein	0.782	366-392	RRPRPRRCRLQSRRTASSSRSRSRSPG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH9	Replication termination factor 2 (Fragment)	0.934	205-217	KKDKSNGKKKRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI31	Uncharacterized protein	0.713	61-71	RGQSRRGKDKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIS1	WD_REPEATS_REGION domain-containing protein	0.903	476-486	PKRRGSRRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIS1	WD_REPEATS_REGION domain-containing protein	0.844	621-638	ARRKSEAKAEARAKAKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKU2	RING-type domain-containing protein	0.869	482-489	RRRRRRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU1	Mannosyltransferase	0.734	14-31	KKQKKEFVHPSAKHARKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU1	Mannosyltransferase	0.734	608-613	LLKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLU1	Mannosyltransferase	0.646	600-606	RRKWGRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMU8	Uncharacterized protein	0.764	154-160	RRKKSKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN80	Ribosomal_L16 domain-containing protein	0.788	69-79	RKKKMMKGRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNP1	Uncharacterized protein	0.966	548-567	KKMRKKKEKEAVKEGAKRES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR7	WD_REPEATS_REGION domain-containing protein	0.958	493-520	NRARGKNGALKKYLRKQRKKNIIDEKRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ81	Uncharacterized protein	0.944	18-39	PRKRAARHRGKVKSFPKDDPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ81	Uncharacterized protein	0.685	237-246	KKLPRKTHKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ81	Uncharacterized protein	0.634	126-128	KKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZN8	Clr5 domain-containing protein	0.798	205-212	TKKRRRHT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D4	Rhomboid domain-containing protein	0.668	546-553	KKKEAKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E6	SLD3 domain-containing protein	0.987	435-449	SKPKKRKNKKPKLGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E6	SLD3 domain-containing protein	0.97	638-673	PPKAKPAKPTSAVKPKPGAPVKRPTTSKRDKDKDKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E6	SLD3 domain-containing protein	0.707	793-800	LKKMKKPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H6	Uncharacterized protein	0.843	256-272	ARRRLSRRKQHESSRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1M2	zf-TFIIIC domain-containing protein	0.806	149-158	KPRRKRQPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J2	SAP domain-containing protein	0.985	537-579	IRPPHRERERRRMGIGRGASSRGGPPPPPPPPPPPRRRTPSPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J2	SAP domain-containing protein	0.748	156-174	RKRRSRSPPPETESSRKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J2	SAP domain-containing protein	0.667	642-659	GGRGARWGGGGGGGGGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B0	Ribosome biogenesis protein NSA2 homolog	0.944	10-36	HRKLHGRRLDHEERARKKAAREGHKQS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B0	Ribosome biogenesis protein NSA2 homolog	0.744	138-149	TGKKTQKKGWKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3B0	Ribosome biogenesis protein NSA2 homolog	0.604	46-48	RAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	0.995	785-841	SAAARKKRKPPVKVIKATGVNRGISGRPRGVKGRYKMVDPRMKKEMRALKRIAKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	0.994	712-762	KPHKPITKEAAAAIKEKLRAYNARPIKKVAEARARKKLKQAQKLEKLKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	0.99	366-386	KDKELAKKKKERRKENERKHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	0.865	612-625	KKMRKEKAARKEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	0.726	648-653	KKKKTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	0.699	488-495	KYRAKKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q895	AdoMet-dependent rRNA methyltransferase SPB1	0.676	6-23	KHGKGRLDKWYKLAKEKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9D1	Uncharacterized protein	0.922	1050-1118	GGGPPPPPPPPLPGKIPGAPPPMAGAPPPPPPPPPPPMPGKVPGAPPPVGGGPPPPPPPPPLPGAKGMP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9D1	Uncharacterized protein	0.851	1608-1620	QRDRRRRARLKDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9D1	Uncharacterized protein	0.846	1755-1773	RRSRRQTADEERRMRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAJ3	Uncharacterized protein	0.992	549-640	KKSAAAAPAAKAQKRVPPTTRNREPSKKVDPVKIAEAAKKVEPSKRETTRREVIRKEEGEKAKNTSKPPAKPRPSRPPITRGRSESRPDEHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAJ3	Uncharacterized protein	0.91	911-930	KKSPVRKRERRTSRVASRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAJ3	Uncharacterized protein	0.706	684-710	PAKRPPSPSAPAAGPSPAPSPSRSPKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAJ3	Uncharacterized protein	0.624	642-646	HSARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU5	Uncharacterized protein	0.959	360-377	TPPASKRKNSKPGRKPKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU5	Uncharacterized protein	0.788	539-564	KGIKAREDRIKTGGRWGRGGAAAGGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC27	Uncharacterized protein	0.951	15-32	APRRGRREKPWPPGKQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC27	Uncharacterized protein	0.87	101-114	RAERRIRNRRVRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDY5	STAS domain-containing protein	0.812	129-141	KKKNWRRRWAAKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE53	F-box domain-containing protein	0.734	696-702	WRRRRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN0	TLC domain-containing protein	0.951	75-91	KRFSKRRKARSALRRAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN0	TLC domain-containing protein	0.683	453-456	KKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF45	Uncharacterized protein (Fragment)	0.693	21-31	RRRPRYHRGSG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI2	Transcription initiation factor IIE subunit beta	0.979	263-283	LKAAQAPKAEKKKKKTQRRTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK05	Uncharacterized protein	0.943	8-53	TRKQIAKKRHGKIEALHEKSRDSKRLHRAQVRDDRLEKLAEARRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKI9	Uncharacterized protein	0.997	32-52	ARRAKRVRKNRKRRSKRSEDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q186	Histone acetyltransferase subunit 3-like protein	0.948	145-158	GERERKSNKKKRKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q186	Histone acetyltransferase subunit 3-like protein	0.793	637-646	MGKKLKKARP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1E4	Homeobox domain-containing protein	0.763	392-400	AGRRKSRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I7	S4 RNA-binding domain-containing protein	0.947	165-179	GRPGRVRRKKAKAAE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1T4	Uncharacterized protein	0.825	232-239	KKRPAKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3I4	Arrestin_C domain-containing protein	0.699	230-236	KRSKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5R5	Bms1-type G domain-containing protein	0.991	1100-1162	RKEQVAKRRAKKEEKREEYRKKIAEIEERLERKEKREKQAYWEREGRKRKSGDVGGGGGKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5R5	Bms1-type G domain-containing protein	0.967	7-26	KPHRASKKSKEKKAKHQAGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q712	Uncharacterized protein	0.986	72-93	SRRGRIRHKDPNRSRSRRRKRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W0	Uncharacterized protein	0.955	468-557	EAKAAAAKKEAEEAEWRKKLEAEAKLKAEIEAREKLEAERKKAEEERLAEEQRKKEEEALKQRLLEEAKAKAKAEEEAEKKKEKAPIKFK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W0	Uncharacterized protein	0.887	781-802	APAPALAPLPPSKHKPKNKARP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W0	Uncharacterized protein	0.768	743-766	KPKSSSTKKYVGPIPPKGARRPDS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W0	Uncharacterized protein	0.74	723-730	KPKRKDKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7W0	Uncharacterized protein	0.606	278-278	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8S8	Uncharacterized protein	0.994	33-92	KKLAPPSPNAVPKARRAKMAEPKLALLPPAEAKARKQAPPQSRPEPAKPRKQAKPKRAGL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8S8	Uncharacterized protein	0.849	322-342	KKLRAKVKSEKELKVDPKKRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBP9	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.822	350-356	KKPRKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH4	Uncharacterized protein	0.998	55-74	GSKNKKDKTKKKKKNKKGEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH4	Uncharacterized protein	0.997	675-753	AKKKAKELGRAELNGIREALKKKGGGKLSNKDKKKLDAKAERTEKKSTGWKKGRAERDGKGAVLNLKKIRKPKAKKGPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH4	Uncharacterized protein	0.994	158-173	RRRREKKKKTKGKEKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH4	Uncharacterized protein	0.845	781-789	QRKRRHRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH4	Uncharacterized protein	0.793	1283-1294	PTPPPPPPRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCH4	Uncharacterized protein	0.692	1226-1234	RKPPPPRPV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDW1	SNF2-family ATP dependent chromatin remodeling factor like protein	0.981	1207-1243	KKRGRKPGSKNQDKRKAEEGDDEPPAKKRRGPQGRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDW1	SNF2-family ATP dependent chromatin remodeling factor like protein	0.932	1164-1181	ARKAARREKRELNKLRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGY8	Cysteinyl-tRNA synthetase	0.875	721-744	EKARQKEEARKAREKAEEEKWAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE2	Uncharacterized protein	0.998	2563-2587	KKRRKRDKEDRKKRSQKERNKKQKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE2	Uncharacterized protein	0.794	2488-2497	ERRAKTRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE2	Uncharacterized protein	0.74	2153-2168	KKRKGGLFSLFRKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE2	Uncharacterized protein	0.618	312-314	RRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNA0	TRAM domain-containing protein	0.946	25-45	HGKRPFQGPQRKGAKHRRKQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ4	DUF4050 domain-containing protein	0.753	176-183	KRARRRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ51	HECT-type E3 ubiquitin transferase	0.996	2856-2906	KEARARQEEKRKREEERKKREEEERKEREAKEAEERAARERKEAEEREREE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ51	HECT-type E3 ubiquitin transferase	0.799	3344-3362	RRRKEAEEEAKKKAEEKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZU6	Uncharacterized protein	0.998	195-231	LRRRRRRRRAFRRALRARSVAAGGPAGRAARGERLRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D2	Uncharacterized protein	0.842	359-368	RRSRRKRRVS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1D2	Uncharacterized protein	0.608	76-77	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3U8	Uncharacterized protein	0.753	192-208	KMERRHSGKSSRRDHSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y4	Uncharacterized protein	0.998	89-110	KTPKRSKPSKRQRKRKARRSRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y4	Uncharacterized protein	0.913	252-311	KAKAEAKAEAKADAEPAEPAAEKPAKKPTQEPAKPAEKLSAKASSKTPKSTSKSKPAASS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y4	Uncharacterized protein	0.885	1307-1316	RAGRKGKRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y4	Uncharacterized protein	0.709	1216-1223	RGRKFRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Y4	Uncharacterized protein	0.649	331-334	AKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE4	Uncharacterized protein	0.967	105-117	KKGDKAAKKKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE4	Uncharacterized protein	0.965	6-57	RKEGPNGASASKSNRAAPESRPSKRAKASESAKAKDDSNKGAKESKPPAKPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE4	Uncharacterized protein	0.88	1753-1791	SKVKGLKPRQAKAWFRRWAKWEEEKGDAKSRERVSAKAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBE4	Uncharacterized protein	0.72	1491-1497	KKTKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ8	RRM domain-containing protein	0.841	185-206	VERGRTVKGWKPRRLGGGLGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ8	RRM domain-containing protein	0.609	180-182	RIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK6	Uncharacterized protein	0.922	319-338	RRRQRERRRDGGRRSNASAH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK6	Uncharacterized protein	0.89	187-210	GRGRSTGRGRRSREASRVRGSGER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK6	Uncharacterized protein	0.719	240-244	RRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGV5	Uncharacterized protein	0.836	138-152	RKRHHVAKGKSKGNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF0	WD_REPEATS_REGION domain-containing protein	0.949	444-471	RAKRVKEKIEKERASRIRGVKKVKVNQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHF0	WD_REPEATS_REGION domain-containing protein	0.8	609-626	KKKNKPQPAPEPSKRQDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QII9	Uncharacterized protein	0.816	150-168	KRRTPRRYKSRAEEIRVKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK17	Nucleolar protein 9	0.999	768-851	GKGVGQELGTKRKTEPKAEGKVDKKGNEKKGGKEEEGKEKRGKKEGEGKEKRDKKEGKATNGENADEDVKKEKKKKKKKGLGKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK17	Nucleolar protein 9	0.976	3-25	KNRKSKRQLIRDEKRAKKRGREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK17	Nucleolar protein 9	0.953	737-760	EGKGKGKAGKAAAKGPVSGGKKST
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN59	Elongator complex protein 1	0.978	1191-1206	SKNRRREEKKRARGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG6	Uncharacterized protein	0.994	490-506	PKPAAKGKKGKKRKGSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG6	Uncharacterized protein	0.962	539-551	PAKRKRGRPRKSD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQG6	Uncharacterized protein	0.869	406-416	PSSARRAKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A5	ELMO domain-containing protein	0.623	318-321	SRKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N6	Alpha-1,3-glucosyltransferase	0.744	9-16	HKPRRKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5M9	Metallophos domain-containing protein	0.706	59-65	SRWRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N3	Fungal_trans domain-containing protein	0.94	85-97	ARKRRRSRKGLDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G4	Uncharacterized protein	0.837	138-148	GRRRRRGWRIA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7S7	Pol_alpha_B_N domain-containing protein	0.662	167-172	KKKSRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7T8	Glycoside hydrolase family 10 protein	0.951	97-111	IREKPKPGFKRKRKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8K8	Uncharacterized protein	0.856	109-141	RAPRLGRAGTRRRPLSTSQRSAVRAPRRRSQRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q970	Peptidase_M14 domain-containing protein	0.721	531-535	KRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB92	CID domain-containing protein (Fragment)	0.686	326-331	KRRRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBT8	Glycosyltransferase family 1 protein	0.966	30-56	KNPPTRKMRKQARKRGKDEDDRFRRFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF19	Polyadenylate-binding protein	0.983	395-441	GKDKENKKEGEQEAKKEGKEEGEKDGEAKEGEKKTEKKPERKLGKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHP8	GFO_IDH_MocA domain-containing protein	0.723	744-760	ARAHHRLARASGRGRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHS0	Methionine aminopeptidase 2	1	82-102	RANKKKRRKRSKKKSKKKSKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJE8	Uncharacterized protein	0.65	128-135	SRHHSRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB2	Kynurenine formamidase	0.871	252-266	GRRRSRRSDARPRRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNG8	Cytochrome b5 heme-binding domain-containing protein	0.796	261-271	KGRKKRVVSGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q011	CENP-T_C domain-containing protein	0.772	489-496	PRKRRKDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A0	Serine/threonine-protein phosphatase 2A activator	0.786	38-49	RIPKLEPRRRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y3	Uncharacterized protein	0.994	807-847	GPRTPIKATARRRRRRRSSEPHRGAAATSTTTAKKKKKKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y3	Uncharacterized protein	0.982	289-319	TKKRGRSPGTGRKSVEGQARRRGRPPKSAKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0Y3	Uncharacterized protein	0.782	924-935	RGQRGSGKGRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J8	Uncharacterized protein	0.916	651-686	PKPKEVKTPKPAKEEKKSVKTTRTTKTTKTSKASAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J8	Uncharacterized protein	0.903	725-758	VKKRKIKTSTGVKRTVSSAGLKAAKGAAKKAAKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J8	Uncharacterized protein	0.838	331-347	KPEAGAPDPAKKPRQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J8	Uncharacterized protein	0.75	249-258	GKRGKKAIEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J8	Uncharacterized protein	0.702	207-219	KPKSARVSKKSSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J8	Uncharacterized protein	0.646	310-313	RKKV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B9	Uncharacterized protein	0.804	95-116	RGGRHGRGPPAPPAPPAPAPKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B9	Uncharacterized protein	0.7	22-29	QRRSRARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q569	Ribosomal RNA-processing protein 8	0.995	157-177	KTKKNKKKKKEKQKGGVDNKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q569	Ribosomal RNA-processing protein 8	0.99	102-116	SEKKQKKKKNKKEKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q569	Ribosomal RNA-processing protein 8	0.912	28-38	APKPARKRKRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q569	Ribosomal RNA-processing protein 8	0.761	419-427	NRKKKGSAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q607	Uncharacterized protein	0.995	1038-1072	GERDAKSSGKPATKGRQRRKAKEKATGKRTAEEIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q673	Uncharacterized protein	0.955	477-492	GRGERNKKKKRFRSLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C3	Metallophos domain-containing protein	0.872	668-709	GRGPSPNKKSHGHGHGHGHGQGHGKGSAARKWGWAGAGRARA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C3	Metallophos domain-containing protein	0.737	733-743	KWKARLKKGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C3	Metallophos domain-containing protein	0.714	241-247	RPRRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q832	Uncharacterized protein	0.97	362-386	MKKKDEEKKKEKEKEETKTKTKTKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q832	Uncharacterized protein	0.955	79-88	KTKKKKKKER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q832	Uncharacterized protein	0.952	40-59	PSKKARRLLKKGKTLPAKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q832	Uncharacterized protein	0.658	459-465	KKKSGQG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.958	574-591	IMRREREAAKAERKKKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.937	962-975	LKEKKRKKVFDKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.916	183-205	RKRQERLAREAEEARKKAERRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.795	1382-1400	RRAALAEAERRREARKFRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.719	248-256	RRPRKASKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.677	1364-1370	RKPAGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.624	107-111	KLKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8D6	MRC1 domain-containing protein	0.617	1081-1084	RMKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAG0	Uncharacterized protein	0.93	481-509	IRRKIRKHQRAKLRQAVTVEPGRRRFKIP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEF2	Uncharacterized protein	0.996	242-320	AAKEEKRRREARENGIILEREVKKTKTTKKKGRGERPVDLPAVGRMRGAELRVSAREARAIAESVRGPAGKGKGKRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN9	U3 small nucleolar ribonucleoprotein protein MPP10	0.99	658-685	EKLRRRRREKERIRKAGGIDANKPVSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN9	U3 small nucleolar ribonucleoprotein protein MPP10	0.975	357-377	PKKKKKPGNVTKRRDSPKPSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN9	U3 small nucleolar ribonucleoprotein protein MPP10	0.687	68-72	KKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFN9	U3 small nucleolar ribonucleoprotein protein MPP10	0.681	280-285	KKPRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGP1	Uncharacterized protein	0.71	29-39	RKDSSRKRVSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHZ0	Uncharacterized protein	0.962	473-489	GKKMGKAKLKREKKAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI38	C2H2-type domain-containing protein	0.912	69-80	RKGKPHKRRLKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC2	Mtf2 domain-containing protein	0.874	316-330	SKRGKNGSSSKRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKJ1	CHCH domain-containing protein	0.757	70-78	KRKMEKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL04	VASt domain-containing protein	0.944	959-972	AAGARGKKRSRKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL04	VASt domain-containing protein	0.866	16-24	IAAKRRRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ32	Uncharacterized protein	0.668	243-247	LRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW8	WLM domain-containing protein	0.963	126-144	SRGRKRKAKKSLTYKEQKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW8	WLM domain-containing protein	0.696	171-186	KKVASKPRVAGSARGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q066	Zn(2)-C6 fungal-type domain-containing protein (Fragment)	0.619	78-80	RKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H8	ATP-dependent DNA helicase	0.955	935-951	RRRRRGGRTARKSHGRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H8	ATP-dependent DNA helicase	0.863	714-728	KKTAAELRKKPAKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2B7	Uncharacterized protein	0.839	5-25	KPKKKSQSDRARDRARVKPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C0	RRF domain-containing protein	0.768	89-103	KKTAKQVLKRQKKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7X4	Uncharacterized protein	0.996	378-402	SGRGRGRGRGNGNGKKKHGRKKSDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B6	Methionine aminopeptidase 2	1	58-74	GAKKKKKKKPKKKKKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q916	N-acetyltransferase domain-containing protein	0.759	244-253	RRRSRRRAFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN5	HATPase_c domain-containing protein	0.923	246-258	KKEKKPKTKKVKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC2	Uncharacterized protein	0.934	121-159	PKTPRTPRAVPRDADPGERSKTWKRLTRVKERIKKLHRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC2	Uncharacterized protein	0.724	1076-1119	KKIHEHESRKGLSSLRARSAAPRGEPPTPSTPPTRSRSADGRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBC2	Uncharacterized protein	0.646	715-720	RPSRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBX4	Protein kinase domain-containing protein	0.784	627-644	KRSGSRRAGAGARGSRGQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC04	Arrestin_C domain-containing protein	0.999	77-133	KTSRGTAARQEKRKRRKREKEEAKQRKKGEKERERQEKERRRADKENSEKQQKRRSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC65	Uncharacterized protein	0.998	1042-1087	KVKRKKRTAGGGGGGGSSRRERDSRSREPRSSTKGRRGRRKKSAGE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC65	Uncharacterized protein	0.987	1095-1121	GGGGGGGGGEKGSRRPPKKRQRLSSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC65	Uncharacterized protein	0.852	983-1007	RRREEERRKAEEAERERQEKIRRER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC65	Uncharacterized protein	0.836	1162-1177	RSARRSRSRSRSRSPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC65	Uncharacterized protein	0.6	1200-1200	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDS9	Uncharacterized protein	0.952	380-395	RRARKRRAKAEKAEEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDS9	Uncharacterized protein	0.751	325-331	KKKPKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV4	Deacetylase sirtuin-type domain-containing protein (Fragment)	0.878	342-360	SRKRKVQRDGTDKKPRRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH74	Palmitoyltransferase	0.988	345-356	RLRRKKKRRARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJS9	Transcription elongation factor SPT5	0.895	123-132	RHRRKRRKDH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJS9	Transcription elongation factor SPT5	0.841	390-405	KRKRPGMPGPRPPQRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJS9	Transcription elongation factor SPT5	0.622	411-414	ARKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK51	Uncharacterized protein	0.947	651-664	SKKKSKGKDKAKKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK51	Uncharacterized protein	0.798	587-595	KAAKKRKHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZV1	Uncharacterized protein	0.773	999-1008	KKKEKEKAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZV1	Uncharacterized protein	0.73	802-810	RKGKKDAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZV1	Uncharacterized protein	0.664	1111-1119	KKKTEKERE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZV1	Uncharacterized protein	0.604	854-855	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0I3	Uncharacterized protein	0.771	664-676	RRERGARPGARRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P8	TLC domain-containing protein	0.766	300-312	RKRFEPPKPGKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Q1	Uncharacterized protein	0.871	308-316	GRRRRRGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M3	SCD domain-containing protein	0.994	1137-1185	ERAAAAAAAGGARKKKTKAKAKAEAASAGAGAAAAAGKPGAGASRKKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7M3	SCD domain-containing protein	0.784	102-112	KSRKPAAKKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q977	Transcription elongation factor 1 homolog	0.884	3-16	KRKSSRKPQAPKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB26	Fork-head domain-containing protein	0.996	560-658	PKKRGPGRPPKNGIMSKREERLRKKAAMELAKKNMPQPPPGDPPVKRKVGRPRKHPLPENAPDRPEKRKYKPRKSKNGEEGEGSDVEKSVKERRREKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHZ9	Autophagy-related protein 9	0.613	118-119	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKX0	Protein SSH4	0.857	60-75	REKRAKKDSLKKRESK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPY2	Uncharacterized protein	0.985	487-515	FKRRKEVKEEPLEKRLRPPSPKRRAKPSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZU4	Uncharacterized protein	0.975	903-916	AREKEARKRKARGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZU4	Uncharacterized protein	0.966	841-885	AKLKAEHKRERKGALRELRKDAAFMRRENLRIKKERDAAYEKKYR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZU4	Uncharacterized protein	0.789	25-41	KKQRRKNAEEQKARPDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1I0	C2H2-type domain-containing protein (Fragment)	0.613	131-134	PRIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q513	Brr6_like_C_C domain-containing protein	0.885	168-181	PRVSRDKVRKRKRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q513	Brr6_like_C_C domain-containing protein	0.829	456-477	RRSPSKGDRGRSPSKGTRVRSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q602	PARP-type domain-containing protein	0.99	156-176	REQKGAKKSKKAGSKRHRGKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q602	PARP-type domain-containing protein	0.989	187-287	EPKRPRKATGKRGREEKHEPDENADEPAPPVKKAKRASKKDSMPEPAAKPENSKKAAGKGKGGARGSAALKEESEPELPPEPTPEKPKKEGRGKRAAKVAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q602	PARP-type domain-containing protein	0.986	360-387	TAAKTKKGRKGSEKKSVPMLKGRARKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q602	PARP-type domain-containing protein	0.973	303-321	PEPAKKKASRSKKVKKEAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M0	Stress response protein NST1	0.999	524-698	RKAKKAKEAQKRKDRAARKREAQAEERARKEAERAAEEAARRAEEARKAEEQRAKAEEKRKKKEAQRKAEEEERQRKEAERLRKIHEREENERKAREAKEREKKAREEARLKEKEAREQKERKERERKERQERERREKEAKEAMEAKEAKEAKEVKEAKEGKDTKEKRKKDEKTA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M0	Stress response protein NST1	0.995	108-123	PASGKSKKSKKKKKKN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M0	Stress response protein NST1	0.954	37-50	NRKKQKRRAKAAAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E5	Uncharacterized protein	0.801	363-394	PPRRPRTSNSPPPHPRGARDMPGASPSRRRQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E5	Uncharacterized protein	0.74	169-184	EEPGRQKARPDIPKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E5	Uncharacterized protein	0.653	158-163	RRPKEE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCP9	C2H2-type domain-containing protein	0.875	224-240	IRREWKAKKKEEEARKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD61	BRCT domain-containing protein	0.721	108-117	RRERERERKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEU5	Uncharacterized protein	0.837	1243-1262	SASRKPPRPVTQRPPRRNKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK9	Uncharacterized protein	0.975	247-264	AKRGPKRASRSGKRARKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGK9	Uncharacterized protein	0.888	297-320	RARKRSRKNIQDKPDGDRRNKARG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ5	Uncharacterized protein	0.732	54-63	KVKSRTRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH01	Transcription factor BYE1	0.999	120-197	EKPWEARRKAYEEQKAEKKKKGPKKGKKRTSDLKEDASQKSKQSPPPLPEPKKEPKGAGLKRKNGEVAQDKDPKKMRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH01	Transcription factor BYE1	0.822	31-41	KRRGGNKKTKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH47	Phytase-like domain-containing protein	0.97	297-322	KRRNTRLLKYALRRTDKKKTKNKKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI03	DUF2013 domain-containing protein	0.931	474-488	KKPPPKIPPPRRKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI03	DUF2013 domain-containing protein	0.817	429-444	SRPKPPPPPRALRPKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE3	Uncharacterized protein	0.991	616-657	RRAKKTKEKPKKPAVLLDKRGLPLDKKARRAELRRRERERPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE3	Uncharacterized protein	0.849	149-157	GRRKRMRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ31	G_PROTEIN_RECEP_F2_4 domain-containing protein	0.725	478-492	RSRRMRSGRRVSAVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.998	483-562	LLKKALKRKEKAKKKSEREWKERTESVKAAIQERQRKREENIRKRREEKLARKAGKKNKGVQTRKKNRPGFEGGFGGGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.992	160-209	KRQKAKEEKKVAKKQKQEEAKRVKEEEAKKMKEENSKKGAKPEKAEKTRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.859	344-371	EARRQKQAQRKAHKQEMRRLAKEEEERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.747	111-120	PGEGLKKKKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.746	39-55	RKKKQTKDQARAAKRGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.664	427-432	KKKGPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.612	470-471	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK03	Uncharacterized protein	0.602	446-446	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLN6	Uncharacterized protein	0.745	286-298	KHRDKPWKTRKNW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN44	RRM domain-containing protein	0.982	368-380	QKKKSKKGKKTKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN44	RRM domain-containing protein	0.97	6-89	RKRKSKPAVAEPEPAAKKTKATKDTPKAEKRKALEEAYPVVVKKQKPSKDVAPKRDVAPKKSALKKEKQSTETKDAPAKSKKAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN44	RRM domain-containing protein	0.652	290-295	KRRAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN44	RRM domain-containing protein	0.645	148-151	KAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR3	Chromo domain-containing protein	0.987	111-129	QARKEKLERHHRRNRKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR3	Chromo domain-containing protein	0.618	174-176	RKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR3	Chromo domain-containing protein	0.615	411-413	KKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR3	Chromo domain-containing protein	0.607	320-320	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR9	Uncharacterized protein	0.996	286-302	KVKKPKKKKSKATRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR9	Uncharacterized protein	0.938	64-84	REAEEAKRKREAKAAAIKKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR9	Uncharacterized protein	0.932	359-372	QRKEALKKRKKLRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR9	Uncharacterized protein	0.902	605-625	KGSGKGKTDKKLKKLAEEKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPR9	Uncharacterized protein	0.855	115-128	QKKRQKKIEAARKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H9	PALP domain-containing protein	0.606	44-45	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1P8	UDG domain-containing protein (Fragment)	0.693	58-68	RRASRSPSKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1U8	ENDO3c domain-containing protein	0.647	283-287	AKKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q379	Carboxylic ester hydrolase	0.836	403-411	KRTKKKKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3E2	Signal recognition particle subunit SRP68	0.703	375-379	KKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Q2	F-box domain-containing protein	0.946	387-400	KKKNKNKNKKGKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5Q2	F-box domain-containing protein	0.776	916-925	KNKNKKGKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q693	Protein kinase domain-containing protein	0.675	405-411	KPKQRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K2	18S rRNA factor 2	0.612	314-316	KKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH5	Uncharacterized protein	0.707	15-22	RRPSKRSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAU4	Uncharacterized protein	0.792	164-173	KGRHRRERRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB23	Uncharacterized protein	0.987	160-213	PAPAAAPTTRRISKRKPSLDKTPPPAEDPVVRKPKSRRKARDSTAEKRPQQRRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB23	Uncharacterized protein	0.952	112-139	VKRSVGKPPKTGPRRRASPPAPAAAPAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB23	Uncharacterized protein	0.808	276-296	EFRKKGGANGGRRSSLGMRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB23	Uncharacterized protein	0.611	41-42	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD77	Uncharacterized protein	0.992	191-200	KKPKKKKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD77	Uncharacterized protein	0.887	166-175	IKPKKKKAGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT3	Uncharacterized protein	0.986	348-362	GKGQKKKKKKSWRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDT3	Uncharacterized protein	0.65	59-64	QRRPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFP3	Amidohydro_3 domain-containing protein	0.643	72-76	KERRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ7	Serine/threonine-protein kinase RIO1	0.999	478-529	EKRRPRGRKFEDKEEKREHKWLVKEERREKRKTKMPKAVKKRLVATTARKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIN6	Uncharacterized protein	0.973	54-85	ARWRRCGRRRWRWRWRGAGWRWWARRRRVRVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJS4	Glycylpeptide N-tetradecanoyltransferase	0.998	59-73	AVKKKKKKGKKKKVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	0.89	2388-2457	HRSHRGEPGPRGDGGSGGGGRGEGGRGGDDYGRGGSSRSNGPPRDSRSSRPGDERGDPRGGDDRARKRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	0.837	1895-1938	HSPREQPRERPPRADSPRRSDRPPTNPPLPDNGRDDRHGRRRHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	0.825	2303-2334	SRREHHRSERSSRPSGRSSRDRTPDREREPKD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	0.789	1788-1830	SDRGRAEPPSRRHDHAPAADRDSRPDSRPDSRPPPRERGAPHG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	0.763	42-56	RGGRGGRNSRRGERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL59	THO complex subunit 2	0.684	2015-2027	PRGRGGRSVARPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLE9	Uncharacterized protein	0.991	348-397	APKEEKEEKEERPKKKAKKALPESNDERLDKEIAERKAKLKKQKKAAASK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLE9	Uncharacterized protein	0.925	188-205	PKVDGKRVPAPKGKKQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLE9	Uncharacterized protein	0.894	318-337	GRKQKAIAEKPNIGKKRKSL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN43	Uncharacterized protein	0.975	39-71	VAARSRRPEDPAEPSPRRRRPRRTDPGVVKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN43	Uncharacterized protein	0.658	8-28	KKKGFWKLFRSKSSAAKDEKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN43	Uncharacterized protein	0.631	31-34	PRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP96	TBP-associated factor 4	0.662	478-483	RKRQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP96	TBP-associated factor 4	0.612	520-521	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP96	TBP-associated factor 4	0.601	524-524	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM2	Uncharacterized protein	0.871	105-115	PKKRRGRPPGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPM2	Uncharacterized protein	0.831	260-269	KPNRKRKAKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ52	40S ribosomal protein S6	0.902	158-202	RREVQPKGEGKKPYTKAPRIQRLVTPQRLQHKRHRIALKRRQAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ52	40S ribosomal protein S6	0.89	219-238	AEAKAQKADLRKRRASSMRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ52	40S ribosomal protein S6	0.753	130-142	KRLGPKRATKIRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ52	40S ribosomal protein S6	0.645	90-93	ERKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q109	TAFII55_N domain-containing protein	0.724	304-312	NRRFRKRLS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G2	DUF1752 domain-containing protein	0.693	402-411	KKRRSVLKKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J6	Uncharacterized protein	0.994	146-177	GTRRRQSARGRGRAGRGRGGRARGGRASGDEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2J6	Uncharacterized protein	0.905	211-230	EGKPSKGQARPRERRERGPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2Y4	Adenylyl cyclase-associated protein	0.934	357-381	RGKSPAPPGTKPKPESMRVKKPPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F1	Exocyst complex component SEC5	0.762	39-47	KKKANRRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H2	ATP-dependent RNA helicase DBP10	0.999	846-926	PGGRHYKHKQEKAPKEADKYRDDYHVRKKRVAEAREKRIGKYKDGEGSRRELKSATDIRKARLLKEKRKEKNARPSKKAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H2	ATP-dependent RNA helicase DBP10	0.877	350-361	KKRKRGSDRPGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K8	PlsC domain-containing protein	0.773	748-756	QKRRRRLEG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K8	PlsC domain-containing protein	0.67	723-732	GKGKAAAPAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6M9	Uncharacterized protein	0.987	15-39	HKQKKPKNNKDQQLERPRRRRRRRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y0	Uncharacterized protein	0.627	248-255	RRRSSHHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q717	Metallophos domain-containing protein	0.999	439-457	SKKKKKKKNKKNKHKDKNG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q717	Metallophos domain-containing protein	0.865	338-351	GKGKKNKDKDGRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q717	Metallophos domain-containing protein	0.692	258-266	KTRRKANAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q980	Uncharacterized protein	0.952	230-252	KKKEEEEELRRRRRRMRDAPRGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9W0	Uncharacterized protein	0.84	201-219	RKVSVKKIPDRPQKKAEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI7	DNA polymerase II subunit 2	0.62	24-27	KRAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB95	Uncharacterized protein	0.912	423-439	KEKKSPKKSKNHNKRDW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBK6	Uncharacterized protein	0.878	356-366	GAGRRKGKSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBK6	Uncharacterized protein	0.859	224-233	KRKRKREAQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBK6	Uncharacterized protein	0.811	711-721	EGERATKRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDL9	Uncharacterized protein	0.943	331-344	AGKKKPPPPPPKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN6	Clustered mitochondria protein homolog	0.995	1255-1286	KKKKPTGGAGGSAGGKKRAGRSNPKRRGGAAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEN6	Clustered mitochondria protein homolog	0.872	914-922	PKKKNKKKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ7	60S ribosomal protein L8	0.916	5-35	SGKKVAPAPFPQGKAGSKKAPKNPLIEKRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ7	60S ribosomal protein L8	0.736	106-125	AEKKERLLREATAIKEGKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ7	60S ribosomal protein L8	0.723	241-253	MGAKAQKRIEKRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL0	Uncharacterized protein	0.994	328-375	AKGKRKRVVDDDPGYRPKGGSSRPTKKKRKSEGPERMPTAKAASRKSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFL0	Uncharacterized protein	0.757	268-286	RRVKGERASRGTGAPRAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX1	Uncharacterized protein	0.867	603-610	EPKKKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX1	Uncharacterized protein	0.834	509-520	VEKRPRGRPRTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX1	Uncharacterized protein	0.643	424-429	KRPLKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG97	A_deaminase domain-containing protein	0.934	14-23	SRRRRRRRRL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE7	Uncharacterized protein	0.971	584-621	RPKNTPPPPRGRKPRVTRRTGVLPTRRSERIAAMKRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIE7	Uncharacterized protein	0.926	640-648	RGARRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT8	Uncharacterized protein	0.79	175-205	NRDYRRRGGNRAAASVPPPPFRPPRTPPPAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT8	Uncharacterized protein	0.687	227-236	RPPLRRGGPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT8	Uncharacterized protein	0.634	157-162	RPRPGS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT8	Uncharacterized protein	0.62	165-169	PGLRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ9	Uncharacterized protein	0.799	278-292	REERKRAYRNKGAKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL09	Uncharacterized protein	0.988	77-99	AQKQAASRARAGKHADKKRKRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZZ2	Phosphatidylinositol 3-kinase VPS34	0.764	167-174	PKKKSRKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q130	Uncharacterized protein	0.892	117-126	REKRTRKKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1N2	PAS domain-containing protein	0.603	556-556	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9U4	Phospholipid-transporting ATPase	0.857	165-175	RQKRRKRGLGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAR7	Pex24p domain-containing protein	0.947	528-548	RRGQWRRRRWVRMVKRKKVAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB57	Uncharacterized protein	0.933	455-468	KDKPNGGKRKPKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBZ5	Uncharacterized protein	0.943	302-324	RMHRTIKRNDRKQQREKRQKAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG7	BZIP domain-containing protein	0.693	40-46	KRKGGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG15	Uncharacterized protein	0.666	443-449	PRKPSRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG15	Uncharacterized protein	0.609	650-652	KSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGH9	Uncharacterized protein	0.825	265-282	RPGKKGKNGAANRSRQPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGH9	Uncharacterized protein	0.694	4-10	KKKTKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLA4	Uncharacterized protein	0.902	281-299	RLPKESKKERAKRLRQEGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLA4	Uncharacterized protein	0.893	364-381	KRLKVLEAGRGTRGKGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLA4	Uncharacterized protein	0.7	257-268	RKIKTAAERRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNC3	Uncharacterized protein	0.998	459-484	KKRELNLKEKLKKQPRRRKKGRGKQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNC3	Uncharacterized protein	0.994	556-604	SKSEGNAEKSEGRRGGRKPRAPKADKEAKAPRQLAQAPASAPPAAPPSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNC3	Uncharacterized protein	0.601	549-549	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q004	Ubiquinone biosynthesis protein COQ4, mitochondrial	0.843	271-283	IRKREREERKRQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q9	Endopolyphosphatase	1	474-496	GKKHKKKKKKKKKHGKKPPSKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q9	Endopolyphosphatase	1	698-723	GKKKKKKKKKGKNKKGKKDRKKKGKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q9	Endopolyphosphatase	0.953	580-596	RRWRKGKHGGKKPTRPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Q9	Endopolyphosphatase	0.926	367-386	PPPKAGKGIDKVGKGKKGKH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8U4	Uncharacterized protein	0.852	48-62	QPRGKKRGRDDGGGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8U4	Uncharacterized protein	0.609	69-69	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9T4	Uncharacterized protein	0.998	111-137	PRRRGRRGRRGMGKGGRGRGRGHRRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBL1	HMG box domain-containing protein	0.82	121-134	KDKPLRIKRGHRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBN9	Uncharacterized protein	0.969	37-70	GRGRGRGRWARPKNTKVTKPAQQKAASGRGRRHK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFF2	Polynucleotide adenylyltransferase	0.662	105-114	RKGRHDGRGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFF2	Polynucleotide adenylyltransferase	0.601	125-125	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFV5	Uncharacterized protein	0.959	335-380	ERKRIKEQRKQEEEKKKEEEEEKVRKEEEEKKKQAEKDGAADSRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJ59	Carrier domain-containing protein (Fragment)	0.836	818-830	ARGRRQGRRRQRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH6	40S ribosomal protein S26	0.899	85-109	RVRSREGRRNRAPPPRVRYNKDGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH6	40S ribosomal protein S26	0.869	3-16	KKRKNNGRNKKGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLI0	Uncharacterized protein	0.679	160-164	KKPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZT9	RED_N domain-containing protein	0.997	512-533	GGGGGGGKSQRKRGKKKKKGDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZT9	RED_N domain-containing protein	0.795	246-269	KTKEGSTLGAKFKKIGEKKTPGVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZT9	RED_N domain-containing protein	0.646	452-463	RKAAEREERLKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F0	PWI domain-containing protein	0.999	368-459	RYSRSPSRTPPRRSRRDSRSSSRGGGGGGGGGGGGRRRRSRSRTRSRGRSASPASSYDSRRRSPRRRPRGGRGDSRRRGGEGDGSPRGGYRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F0	PWI domain-containing protein	0.997	133-247	RREEFERRDRGRGGRGGGGGGGGPGRGGDSWRGRDDRDRGGLGRGRSRSPPRFRERGGRGGRGEPRGGGWTRDVYVPRGSPPRQRGGGRRDGRRWRSRSRSRSRSRSRSRSRTRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0F0	PWI domain-containing protein	0.996	273-357	TRSPTPPRRRRHGRSRSRSRTPLSRRDSHKRYRSPRGRSRSVSSDRGSPSPKRRRYSRSRSWSRGRSRSRSRDESRSLSRTPTRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q148	Uncharacterized protein	0.989	16-50	PREKIHRSKSERKDRGRDRDKDRDREREKERRRDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q148	Uncharacterized protein	0.894	916-925	LRRPKRRRER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1H5	BHLH domain-containing protein	0.971	291-318	KKARKNAAKARPKAGIKQSPISKPLRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4W0	Lon protease homolog, mitochondrial	0.625	149-152	RGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q514	TFIIS N-terminal domain-containing protein	0.994	78-104	AAKRKRTDGETVRKPKEGRRPKKRSRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q514	TFIIS N-terminal domain-containing protein	0.849	163-173	LKNPTKRRRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q514	TFIIS N-terminal domain-containing protein	0.748	117-124	RRPRKARA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q514	TFIIS N-terminal domain-containing protein	0.674	425-431	KGKGGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5I2	Uncharacterized protein	0.931	61-78	RRPPSAAPPKVKKGEKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5N2	F-box domain-containing protein	0.995	226-250	GPRPRPRRPRRTRTRFGWRRPRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U2	ERCC4 domain-containing protein	0.875	107-117	ERPAKKAKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6U2	ERCC4 domain-containing protein	0.667	89-94	KKRAGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q761	Uncharacterized protein	0.981	84-95	RQRKKKKKKHAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q919	TFIIIC_sub6 domain-containing protein	0.962	297-352	RRRRKLQQDHARNARWRDKRREEREMGLGSPERNYIPRTGGRRGWPKRARRAALIR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB40	Uncharacterized protein	0.868	68-80	NRPRMRRRSKTRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF6	Uncharacterized protein	0.771	123-138	KREERKQEKLRERKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBF6	Uncharacterized protein	0.616	240-244	KRASR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX3	DNA polymerase	0.978	162-192	ISKKRDRSAERRKTRPLSPPREARQPAPKKT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCX3	DNA polymerase	0.633	96-99	RKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG06	Translation factor GUF1, mitochondrial	0.925	637-654	TRRKKLLEKQKAGRKRLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH65	Uncharacterized protein	0.627	30-35	RRHRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP61	Protein kinase domain-containing protein	0.729	217-228	RRIEREKRGAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP61	Protein kinase domain-containing protein	0.659	143-146	KKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX4	60S ribosomal protein L27	0.704	55-66	RMSKSRQEKRSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0E1	zf-LYAR domain-containing protein	0.987	182-205	APKAARKKVKDGDRDAKKDKKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0E1	zf-LYAR domain-containing protein	0.987	287-321	SKPKSSSKKRTKSKSSSTPSKKKKGSSKSLEAPKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0E1	zf-LYAR domain-containing protein	0.653	260-266	KSKSKHH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H1	Uncharacterized protein	0.96	817-849	APEERRRAPSPERRRASSLERRLAGRFKKEPRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H1	Uncharacterized protein	0.94	14-47	SRRKKHTGKSKARPANDWPRTDEPRSRASPRWKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H1	Uncharacterized protein	0.749	306-319	RRSRSRSKSARPSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H1	Uncharacterized protein	0.696	75-82	RKQRRRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q434	Uncharacterized protein	0.956	8-19	KGDKKPKKRKRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q434	Uncharacterized protein	0.91	213-255	RFKPRVKASREEKARERISRRELEEAAGRRLEEHEIKMLKKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4K5	Uncharacterized protein	0.973	268-326	GARWRKMLRGEREERRERERKKEMEQFARRRVEEATKQLGAHAQKGKEGPPRPGVRVKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q684	Telomere_reg-2 domain-containing protein	0.678	540-547	PRKPATRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Q8	CP-type G domain-containing protein	0.983	625-641	GKKHFKGGRKGRGKRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R0	20S-pre-rRNA D-site endonuclease NOB1	0.796	459-468	GRNVNAKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX2	Eukaryotic translation initiation factor 3 subunit A	0.996	745-831	FEKRRRDAERELEKAVNQRRKEYRERKLREKREREEKERALREAEERAEREREEERKRQEARKEELARIRKEREEERERAREAQARQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDX2	Eukaryotic translation initiation factor 3 subunit A	0.669	840-846	ARRRAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHD3	Tr-type G domain-containing protein	0.864	224-236	AAARKKKAEEKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ2	DUF676 domain-containing protein	0.983	1388-1429	GKESRGSRWRPSSRRTRFLPIRGARPGRGSGKAKGGSSSRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM64	Uncharacterized protein	0.996	58-87	KARKENLKAEERRRKKWKKRVLSKEEREAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM64	Uncharacterized protein	0.974	491-545	KARPQGRPPKASPPNQQAPAEPSPKQTRRAAKRKSPPEAESPAPKSAKSSRQSTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM64	Uncharacterized protein	0.635	547-553	STRGRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNI6	Uncharacterized protein	0.683	154-164	AAKKALKIWKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ08	RRM domain-containing protein	0.996	175-207	TVKKNTTKDGKGGAAGGKGGKKGGRGRASRPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ08	RRM domain-containing protein	0.916	21-58	QGRRRSARRSAGAAKPAATAPAGGIQKNSKPARGANKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q086	WW domain-containing protein	0.976	516-547	KKAREERRRREKALEERERAVAEEKRRQEKKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q086	WW domain-containing protein	0.709	374-383	KERRAKEEKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q213	Uncharacterized protein	0.946	123-138	PRRRGRGGWRGRGGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q213	Uncharacterized protein	0.876	93-106	VRRRRLGRPPKNRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A9	Uncharacterized protein	0.969	358-381	RRLKREKEERKRKFLEATKAKAGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A9	Uncharacterized protein	0.846	174-195	ERKELKAAEAKKARMAGGKSAI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A9	Uncharacterized protein	0.631	233-237	GKKVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A9	Uncharacterized protein	0.615	31-32	KR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q656	Uncharacterized protein	0.724	328-338	RARRAEQKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9J9	Uncharacterized protein	0.985	40-54	KKVKKIIRRKKRPAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAE0	Uncharacterized protein	0.739	18-28	IAKPRSRLRRF
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBD6	DNA ligase	0.971	711-733	EEKERKAMEMENRKRKPAKRQKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCF9	PUA domain-containing protein	0.999	388-411	RRRKKKKKNKGQRKDGKGKAKGGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEM2	60S ribosomal protein L29	0.915	14-56	RKAHRNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTAKAIKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF32	Uncharacterized protein	0.964	393-421	RKRRDLPASVLHLPKRARPSRPKFAAKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF32	Uncharacterized protein	0.893	276-287	RHRKVPKRKSRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH4	Uncharacterized protein	0.996	129-184	KERKRKHGAGELRGITLANGRKVKRGWTSIDEPKEKKSKKDKEKVVKEKRKKGTKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH4	Uncharacterized protein	0.985	524-549	RSWKRRRKLAGKEKRYRENKARMARA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFH4	Uncharacterized protein	0.833	215-222	KKKKKIKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGG2	Uncharacterized protein (Fragment)	0.625	189-193	RKERR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNB8	Uncharacterized protein	0.672	406-414	RRVRRGSAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNZ6	Uncharacterized protein	0.996	321-416	KPQKPTPGRRGRPPKAGKPSAPPAQAPPRGAKKRRSLDQEGAAEEPSSEPKPKRPRASAAPNAEKPAPKKAAAPARKTPEPPAAAAPKPRGRRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNZ6	Uncharacterized protein	0.992	515-535	RARSRRGGKKAPGRGGRRRSS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNZ6	Uncharacterized protein	0.979	255-281	PAPKKRQGRPPKQKQTAAARAAKPRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ96	U6 snRNA-associated Sm-like protein LSm1	0.811	130-142	KQQDKAKEKKKVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZX8	Uncharacterized protein	0.626	164-167	RPRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2B5	PUM-HD domain-containing protein	0.915	72-105	RRDRVPAKRKENGRNKGHPAERAQTSREAHARQK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2B5	PUM-HD domain-containing protein	0.7	668-675	KKSKSKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2B5	PUM-HD domain-containing protein	0.682	27-33	NRAKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T6	60S ribosomal protein L6	0.708	35-42	KPRKVRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W1	Uncharacterized protein	0.991	79-113	SKRSKSHRSSRHSHHHHRSKSRSRSRSRPRHRSSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7V0	Uncharacterized protein	0.613	23-25	RPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAW0	Uncharacterized protein	0.999	159-193	REKRRKKREQKEREKERRREEKAREKEERRKSRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAW0	Uncharacterized protein	0.939	450-464	KRKKRGGAGARRNRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAW0	Uncharacterized protein	0.887	389-402	EKRARSRSRRRSAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAW0	Uncharacterized protein	0.603	317-319	KGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCK8	Uncharacterized protein	0.998	613-646	PRLVRGKKTNKGGKRRNKSKSGTKRSSQRAKSKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCK8	Uncharacterized protein	0.925	83-95	RQRRSRAKKRKDY
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCK8	Uncharacterized protein	0.666	598-604	MKRVRKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCM9	AAA domain-containing protein	0.947	574-589	QKTKFSDAGRRKRRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCM9	AAA domain-containing protein	0.946	1236-1248	SKKAGLKSRKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCM9	AAA domain-containing protein	0.888	205-237	GSPPKPKEPRPDAKEAHEIEKMVGRRGRKPASK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCM9	AAA domain-containing protein	0.783	738-750	KTKGRKSKQPAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE15	Uncharacterized protein	0.71	453-460	KGKARVKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE15	Uncharacterized protein	0.707	839-850	KRSRNSLRKRDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFD2	Uncharacterized protein	0.99	144-178	EPAESRGPLRTRRGPRPRRGGLAPARHPHPAGRRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFD2	Uncharacterized protein	0.623	126-129	PRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGZ7	Uncharacterized protein	0.924	213-225	PRKRLGTKRKPKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHM9	Uncharacterized protein	0.989	762-773	SKGRRKARGKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMI8	Uncharacterized protein	0.658	63-69	LRRAKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNH7	Uncharacterized protein	0.966	914-935	FEKRKASEDKGKETKKSKKGKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPB7	Uncharacterized protein	0.997	525-590	KAREKKRLAELEQWKKEKAEREAQRANGEDPGSLKRKKNEAWSGKHEHEDAKAARREKKRRKREAQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU9	Uncharacterized protein	0.948	896-910	RRRRKIEARRRKAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPU9	Uncharacterized protein	0.942	1046-1061	FKKSPLKKGKRKSEVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPZ0	Uncharacterized protein	0.887	163-173	PRPKKRKSAPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ29	Ribosomal protein L15	0.965	40-78	SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPAPKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ29	Ribosomal protein L15	0.965	159-193	REARGLTSTGKKSRGLNKGHRYNKTRAGRRKTWKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X2	U3 small nucleolar RNA-associated protein 11	0.892	265-276	TGRRIKVRERKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X2	U3 small nucleolar RNA-associated protein 11	0.857	224-236	KLGRRLKAARKKL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0X2	U3 small nucleolar RNA-associated protein 11	0.825	13-48	HRERAQPLERARLGLLEKKKDYQKRARDYNKKKEVL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q239	tRNA ligase	0.639	651-653	KKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q239	tRNA ligase	0.614	56-59	KNRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B4	S4 RNA-binding domain-containing protein	0.983	257-286	RAKKIMLVKDRYHRAKKKKALRKYLKDLKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6H1	Uncharacterized protein	0.622	587-590	KPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q879	Uncharacterized protein	0.994	416-447	AKRMKSNSFGGKPKKAGKAQRPGKSRRQAMKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q879	Uncharacterized protein	0.971	369-402	SKKRSADGRPQPNPKRQRKDAKYGFGGKKRHIKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q879	Uncharacterized protein	0.884	293-340	KKAAAEARKQRDLKKFGKQVQVQKQLERAKQKRETLEKINLLKKKRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q879	Uncharacterized protein	0.618	27-32	KQKGDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCN8	Uncharacterized protein	0.995	27-66	KKRKSQEKARAERAAELEKRKKANKEKRGVIFKRAEKYVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDD7	zf-C2HC5 domain-containing protein	0.963	77-89	KSRRGPKKKKAPI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI9	Kri1_C domain-containing protein	0.999	434-447	GKKKKKKKKPKKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI9	Kri1_C domain-containing protein	0.999	647-699	GKGKGKGTGANAVAAGSGADKKKGAAEGKPEPVNGIIEGERKKKRKRSKKKKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI9	Kri1_C domain-containing protein	0.998	598-618	EKKRRDRKKLGKKARLRKWRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI9	Kri1_C domain-containing protein	0.996	325-377	RKEELTGRKKKRALEKERKEAEKREREAERARLRRLKIEEASEKLAKIKKAAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI9	Kri1_C domain-containing protein	0.99	500-523	RPAKKRKTSKEIKKERIRAKREAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE9	PH domain-containing protein	0.762	986-1022	KPKPAPVSKKALPSPTKTSKPKTSAFSRVFASPKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE9	PH domain-containing protein	0.659	1332-1338	KKRAEGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFI5	Uncharacterized protein	0.921	8-36	KEPPKLSKGKGKGARRVSNLSEEQRNKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT1	Uncharacterized protein	0.861	302-311	KKKNKEKKRI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIC1	DNA damage-binding protein CMR1	0.943	39-74	PKPAPPKPKRSSTARVKRESVQREPPRPTRQSSRLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJZ8	Eukaryotic translation initiation factor 2A	0.984	522-535	KTGSKKKKRNKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM31	Uncharacterized protein	0.849	490-498	KRKGKPKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN90	WD_REPEATS_REGION domain-containing protein	0.804	1005-1029	SRGRTSGGGAGAGHHRGHRDRKGDR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN90	WD_REPEATS_REGION domain-containing protein	0.684	825-835	RRSPPRPSHRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNJ3	Uncharacterized protein	0.901	429-450	RQRAEREEREKREKREREMREL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPJ8	Uncharacterized protein	0.862	77-90	PKKKTSHMKKRHRQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3H4	Uncharacterized protein	0.65	5-12	RRNRARGN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3L7	Uncharacterized protein	0.965	19-53	AERAAAAKPRFIPKKERERLAAEKAAKEEEERKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3L7	Uncharacterized protein	0.788	146-151	KKKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3L7	Uncharacterized protein	0.704	223-235	RVKKIAERKNFGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q596	Uncharacterized protein	0.927	150-174	ESKRHGTGKGTGTGKGKGKGRESRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q596	Uncharacterized protein	0.862	473-491	KKARAGQRMKAKRLLRQIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q596	Uncharacterized protein	0.629	11-14	RKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q703	Glutamate decarboxylase	0.932	548-571	PRPRVKKREGERLKDVGREAGKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q703	Glutamate decarboxylase	0.898	407-420	GAGPGPRGRRRRVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L7	Uncharacterized protein	0.775	108-127	KRRRDSRRSNETRSRRDNRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R5	Uncharacterized protein	0.985	79-119	ARGRRARARAAAGPNYEEARNKEKKAIEKIKASKKFQKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7R5	Uncharacterized protein	0.943	181-193	DEAARKKKPKRAT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q974	40S ribosomal protein S1	0.956	5-19	KNKRLSKGKKGLKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN2	J domain-containing protein	0.998	157-277	RKARRAASYEKPAKRDDERRERDREERRRRKEEEEFARQREEKREREREKDREREREREREREREREREREREREREREREREREREREREKERERERKVEKKRLERDREKEREKARKRDA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN2	J domain-containing protein	0.919	317-349	DKKRSSSKKHDETRERDRERDREKSSSRRAKSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAN2	J domain-containing protein	0.886	519-528	RRRRRSRRTR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC85	Uncharacterized protein	0.998	146-188	RAKRRGRKADKSAKASSARRKTKRQGRARSRSPWRSAGSARSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD16	Uncharacterized protein	0.687	113-122	ARHRKFGRYR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD35	Uncharacterized protein	0.808	90-97	HRRRRKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ5	Histone acetyltransferase	0.986	968-1021	RAASASVSRPRPRRSAGSRRSNASSRPRTSNSNSKRKPGGTGRGPGRWPKGTKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEZ5	Histone acetyltransferase	0.953	397-414	RPKGQKKRSSRSRRRTSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG13	Uncharacterized protein	0.883	1340-1346	RRKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF0	Uncharacterized protein	0.931	526-550	GKRGGRDRSRSGSRGRGRGWNRGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKF0	Uncharacterized protein	0.883	396-414	RRKQRRKQLGRRQEGTRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN56	AKAP7_NLS domain-containing protein	0.973	262-281	GEGGGSRGKGGRGRRGGKKW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPL5	Zn(2)-C6 fungal-type domain-containing protein	0.822	217-231	RRSKELGRIIKKRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q106	TPT domain-containing protein	0.993	83-94	RDRRRKRRKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2W2	DUF1746 domain-containing protein	0.727	48-54	RQKRRRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T8	Uncharacterized protein	0.782	26-31	KKRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q588	Rab-GAP TBC domain-containing protein	0.719	358-368	KKKAAGKWVWR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q588	Rab-GAP TBC domain-containing protein	0.628	326-329	RGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A0	zf-C2H2_2 domain-containing protein	0.661	331-337	RAERRKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5A0	zf-C2H2_2 domain-containing protein	0.651	76-80	DRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5W5	Uncharacterized protein	0.921	65-73	GRKRKRKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6K3	60S ribosomal export protein NMD3	0.963	413-432	KHYPNRRKNRRRNWKLKRMA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6P4	Purple acid phosphatase	0.794	602-611	KKKPGRRGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7G0	Ribosomal_L28e domain-containing protein	0.999	224-248	KKKKKAGDKRKRGRAVKPAARKRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7G0	Ribosomal_L28e domain-containing protein	0.829	66-84	VPKMAPKIKHREEARERKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8M5	Uncharacterized protein	0.738	74-85	GRPRVLTRKAKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q951	Uncharacterized protein	0.966	439-476	KRVYSLKPPRKARGWEAKRQGPKYRHLWKYTKRIKGIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM2	Cytochrome b561 domain-containing protein	0.871	835-845	RRRRRRLERRD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM2	Cytochrome b561 domain-containing protein	0.865	471-514	KMGKDRRDRREEERLREEEDRRREEEDRRREEEEERRAGRRSSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM2	Cytochrome b561 domain-containing protein	0.788	403-416	GGRRAGGRPPPRPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBM2	Cytochrome b561 domain-containing protein	0.758	265-275	RGRKKHRDAER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC15	Uncharacterized protein	0.794	32-47	WRHRTKSLAPRRGKFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDK0	Uncharacterized protein	0.912	502-513	GGKRKRGKQKLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QED2	Uncharacterized protein	0.624	15-18	RGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG68	C2H2-type domain-containing protein	0.723	181-189	RKHARKHRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG68	C2H2-type domain-containing protein	0.623	265-269	RHGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QG69	Uncharacterized protein	0.953	795-809	QRKAHSKRRWRRRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLK4	Uncharacterized protein	0.993	615-664	QRRTSPSRGRDRSRSRSRGRSQRRSHSRSHSRGRYRSLSRGHSRGRSRAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLK4	Uncharacterized protein	0.966	234-271	RGRSLKSHGSKKSHQHREQNRHGHEKHGKGKSRNERRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLK4	Uncharacterized protein	0.739	501-516	PKRARRWSLHRRDWSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLK4	Uncharacterized protein	0.66	481-486	RRPRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLK4	Uncharacterized protein	0.614	26-27	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM71	Uncharacterized protein	0.958	251-270	LTRFHERPALKRKRLKRERW
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPX9	Uncharacterized protein	0.957	520-539	RASPGARSPEGPRKRARKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW7	DUF4110 domain-containing protein (Fragment)	0.997	3-36	KDKKGKSESKKAKLAEKKLKAEKKAEKKAKMKAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW7	DUF4110 domain-containing protein (Fragment)	0.949	401-432	RKRAGPAGGGGGGGRKGAEQKGAVGGRKGRAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW7	DUF4110 domain-containing protein (Fragment)	0.684	337-341	RRKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZW7	DUF4110 domain-containing protein (Fragment)	0.616	581-583	RKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1C2	Uncharacterized protein (Fragment)	0.953	193-237	KPKEKEEKAKEDGADEREKEGEREKEKEREREREREREREMQRER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q274	Uncharacterized protein	0.809	28-40	PRTRKAKPRTPRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q274	Uncharacterized protein	0.649	90-98	RRPVAPPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2K1	Uncharacterized protein	0.92	163-189	KRTEAEREESRKKRAAIIKERAEKAPI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2K1	Uncharacterized protein	0.772	17-28	KEKEKEKKGLGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2K1	Uncharacterized protein	0.694	196-207	TPKKIVIKRPAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4B6	Lysophospholipase	0.988	804-828	ERKRRRREERERKEKTAEWRRQVRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4L3	Uncharacterized protein	0.819	363-369	RKRKKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6B9	BAH domain-containing protein	0.97	415-432	SSKSASGRKPGRPRKKGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6B9	BAH domain-containing protein	0.945	29-40	KDKEQKKKKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6F0	Uncharacterized protein	0.85	884-901	RVRRFTEKRRVRKSQIRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F7	Ribosomal_L7Ae domain-containing protein	0.998	13-53	KKLKKEKKSKDKSEKKEKKRSESDGIRKEKKDKKKDKARQD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F7	Ribosomal_L7Ae domain-containing protein	0.803	106-123	KKIYKLIKKGAKLKSIHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Z1	Uncharacterized protein (Fragment)	0.729	41-48	SRRKRPGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8Z1	Uncharacterized protein (Fragment)	0.723	62-68	NKKKKLA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q972	Signal recognition particle subunit SRP72	0.999	568-636	RGKKRSREDGAEEEGAGKGKQQAQPAKKRRKRKLPKSYDPDKKPDPERWLPLRDRSSYRPKGKKGKKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q972	Signal recognition particle subunit SRP72	0.997	664-681	KAPAPGGGGGKKKKKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBY5	WHIM1 domain-containing protein	0.834	299-315	EKRRRREYRQMRKEQFR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC53	Urb2 domain-containing protein (Fragment)	0.659	138-141	RKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC87	Uncharacterized protein	0.999	546-570	VKYKRVKPKKRKKRKQGQWTRQRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV1	Midasin	0.809	1591-1605	KRFKSRGGNKKHAKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV1	Midasin	0.746	721-738	KRFAKGRWKEVSKEWRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV1	Midasin	0.629	3212-3216	KKPRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFC6	60S ribosomal protein L13	0.868	186-213	RKARSDARLVGVREKRAREKAEADAAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFC6	60S ribosomal protein L13	0.851	30-49	GKKVTRRLARRAKAAALAPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFS2	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.893	630-645	PSRRGNFHRKRRRYAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFS2	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.885	784-800	KPAEGKVAAKGKFKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZY0	ANK_REP_REGION domain-containing protein	0.976	819-838	REKRLPLRKRSRSWKRSRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZY0	ANK_REP_REGION domain-containing protein	0.704	1224-1228	RRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q278	rRNA-processing protein	0.995	23-116	RKNGKQWHAPKKAFRPGSGLTPYEQRAKARVAQAAAKAKEKELKEEKEAERKRRIQALKEKRAAKEEKERYEQLAAKMHKKRLERLKRKEKRNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3F7	Uncharacterized protein	0.916	118-132	RRRKKSKAAAQAKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q442	RING-type domain-containing protein	0.619	10-12	RRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R4	Pescadillo homolog	0.989	615-656	GKKVDPKTKAKLEAKKALERKKKQEAEELERAKGMLSKKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R4	Pescadillo homolog	0.961	672-690	DMKLRQKRRKLEKEKKAAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R4	Pescadillo homolog	0.618	6-7	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBV6	Diadenosine tetraphosphate synthetase	0.986	124-147	KEARGQKVEEKEEDPKKKKKKSKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC72	Rhodanese domain-containing protein	0.782	937-956	KKASKKRPQLWERLRGAGAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD66	Zn(2)-C6 fungal-type domain-containing protein	0.845	58-67	KKAKARARKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF65	Casein kinase II subunit beta	0.801	304-315	RPPTARRRRPGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHH0	tRNA (guanine-N(7)-)-methyltransferase	0.731	7-15	KKDRRQKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK16	Uncharacterized protein	0.785	561-569	RKTRRKRQE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLP2	Uncharacterized protein	0.976	257-278	GRKTAKGRKPVTGKGRKTKAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLP2	Uncharacterized protein	0.924	420-442	PARGRPKKATTARKVSVQKKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLP2	Uncharacterized protein	0.889	566-576	EKRRRGRPSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLP2	Uncharacterized protein	0.839	488-500	KKGRKAGTRKVSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLP2	Uncharacterized protein	0.813	201-213	PKKGRGRAARSSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMZ9	WD_REPEATS_REGION domain-containing protein	0.698	147-156	PKTPRKDPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN06	Uncharacterized protein	0.904	38-64	KRRAAEQAEEEKRRARLRRDAQKVRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPQ6	PAPA-1 domain-containing protein	0.638	148-153	KRARGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZN9	Uncharacterized protein	0.962	325-375	AARRKFEEREREKEEKYDREMIRKRERRDNKEASRIEKGEAPSRPSMHRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q047	Uncharacterized protein	0.777	74-84	RQRRGPKRQRT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0E4	Uncharacterized protein	0.924	552-561	GKRRKRKLKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0L5	Uncharacterized protein	0.992	7-58	KVKGKAGPRKTWKPPTDRTRKAKRRRDEEDEKEGGEDGSDRPPRRRFKARKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T7	Transcription initiation factor IIF subunit alpha	0.983	12-57	GPARPPVRPHKPTTANPLVARKKPRPKPQFSRPPSKVPGKGLEEKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T7	Transcription initiation factor IIF subunit alpha	0.954	575-611	AKLKKKLKVKPGMRPGATPSGSRAGSPAPAANRAPKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4T7	Transcription initiation factor IIF subunit alpha	0.646	509-514	KGKLKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6E7	PHD-type domain-containing protein	0.996	95-128	KKKKGTAAAVKGPSKRGRPGGAKKTKGGGTKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7E8	Ribos_L4_asso_C domain-containing protein	0.995	184-208	KVKASKKLRAGKGKLRGRRHRQRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QA22	BAR domain-containing protein	0.795	421-435	KKAPPPPPPSRAKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI5	Uncharacterized protein	0.979	1869-1931	KSSKAKQEPKQQQHEQAPPRKEARQEPKQESKKETKEEPKQEPKKENKKGPEEESKQAEKSRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAI5	Uncharacterized protein	0.82	1622-1642	PSKSPTKPPNKSAATKTKKKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH6	DUF4211 domain-containing protein	0.987	217-242	ARPTRARRKPLTKKEKARELLRRKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH6	DUF4211 domain-containing protein	0.919	292-302	KERKAKKKKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH6	DUF4211 domain-containing protein	0.716	25-34	IKTPRKSKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH6	DUF4211 domain-containing protein	0.634	558-561	RPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH8	Uncharacterized protein	0.947	338-372	REREKAEREKAERAEQKRIKKMLEEEEKERRRREA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBH8	Uncharacterized protein	0.826	507-523	PSGRRKSEEERKRVQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC82	54S ribosomal protein L31, mitochondrial	0.807	83-97	RKAKRYRKGIHKLPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QER0	Uncharacterized protein	0.696	40-46	KRRHWRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLG9	Uncharacterized protein	0.886	282-292	RKKAARRKGSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLG9	Uncharacterized protein	0.846	308-330	RRQRGPARPAGPAGSAKHARKPS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM15	Uncharacterized protein	0.986	331-345	PKRRRHHARKRKRSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT7	HECT domain-containing protein	0.81	681-691	SKKQQDKKKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ04	C2H2-type domain-containing protein	0.968	209-232	PRPKPQRPTSEQKARRRPGRKPAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0A3	Homeobox domain-containing protein	0.628	81-85	PKGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2X8	GPI inositol-deacylase	0.645	43-47	DRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q558	FHA domain-containing protein	0.927	621-644	RDEEDKKREAERRARSASRGMRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G8	Uncharacterized protein	0.993	1060-1085	GGKGGGKGGGGGGGQKGQKGKGGKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G8	Uncharacterized protein	0.854	844-857	QPLKRGQRGKAKKI
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G8	Uncharacterized protein	0.823	892-916	RAKREAEAAAAAERRRQAQERAKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6G8	Uncharacterized protein	0.686	988-995	KKGKAIKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T1	Uncharacterized protein	0.999	690-711	GPKRRKKRGGRRPGAGRKKKQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T1	Uncharacterized protein	0.997	780-810	VKKVSKRGGARPGAGRKPKHRPPGAQKPGPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T1	Uncharacterized protein	0.763	880-890	PGSGGTRKKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6T1	Uncharacterized protein	0.66	632-636	KRKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y9	Uncharacterized protein	0.636	270-274	KRFRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8M6	Uncharacterized protein	0.999	22-77	DRRERRDRKDRKDRKRDRSRSRDRSTSPRRHKSRRHDGDESPRRRSRSPRGDRDGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q948	DUF676 domain-containing protein	0.965	511-560	SRKRAEKAYKAALKAYAQAVKKRDRALEVRQKALDKRQRKALKEAKKMEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q948	DUF676 domain-containing protein	0.775	588-597	GKEKPPRRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAC2	Uncharacterized protein	0.698	332-338	RKRHGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB56	Uncharacterized protein	0.998	180-273	GYRAPASRGSRSPSPRRRPSPRRERGGRDSRRHGSPGSHARGRDAHARRAYSPSRSRSPSRRDEERERHGAGRYRDREDRSFQGRRSPSPLPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB56	Uncharacterized protein	0.941	131-158	PAPKRSRTPERRERRRYSPSPSPQHRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB56	Uncharacterized protein	0.624	91-94	ARKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD87	Uncharacterized protein	0.999	676-802	RRQQEEKSRMAKEQKAAGGAGKDGKGKVKGKGNDKKEKGMEQKDGSGRSKGKGSKGRDGKDGKGGKPGKGAKPGKGGKKSAAEAKAGVPPAKQGKKKADEKLALRTKIIARKRMMRKKKAAMRAGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD87	Uncharacterized protein	0.958	567-600	KEGRRLPISKEERERGGEADREAERRRREKGKGV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD87	Uncharacterized protein	0.886	246-262	KAKSPKEKKSEKAKSDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD87	Uncharacterized protein	0.67	478-484	GRRKEDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFU6	Uncharacterized protein	0.97	399-427	SRRARGRSRSRRRERDDAGPTRSPIRGRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH94	HECT domain-containing protein	0.677	99-104	RRRKGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJR3	26S proteasome regulatory subunit RPN2	0.705	924-933	KRRAQKKERA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL20	Uncharacterized protein	0.994	93-106	RHQRRRRKKRKRAN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM19	Uncharacterized protein	0.739	33-47	GSRSRSVSPPKRSKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND6	Protein SDA1	0.981	670-749	LAREGKPAREEHKSTQAIRRAKKDAEGKSTTNREKARKKNFLMTLGKARAKNKRSLVEASRTMRAHIARSKRGGRRRNGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND6	Protein SDA1	0.977	255-287	KHQGTINKKTKKRQKAYEKALEKIKKQERKKHA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND6	Protein SDA1	0.803	623-636	KLDKALGRASKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND6	Protein SDA1	0.641	565-568	KRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP15	Uncharacterized protein	0.66	674-682	RARPFKRVK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF1	Uncharacterized protein	0.988	397-443	RNRGHREGGGYRGRGGYRGRGGYRGEGRGRGRGGQRGGLPSRPRRGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPF1	Uncharacterized protein	0.696	18-23	AKKKAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT3	Uncharacterized protein	0.824	312-343	RAGPKRRSLADLASVKPEKKSARAPLSAKRTP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT3	Uncharacterized protein	0.656	357-370	RKAIKATPLKDAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT3	Uncharacterized protein	0.64	125-133	ARSPPQRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT3	Uncharacterized protein	0.604	119-121	KSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q017	Uncharacterized protein	0.993	8-29	KKRKLQDDEKPRKKHKKHKKVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0N4	Non-specific serine/threonine protein kinase	0.963	1059-1070	KKKRKRRSSKEP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3A6	Uncharacterized protein	0.915	202-214	KKKRRCRRAKRVT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V2	Uncharacterized protein	0.996	201-241	RQKERKRERERERKTAKRRVVWRRRSQSPSRSRSPPPPPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V2	Uncharacterized protein	0.926	281-295	GGRRRRRRQRTTSRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5U1	SAM_MT_RSMB_NOP domain-containing protein	0.998	691-733	SDKAKDKTKDEAKEAKEKSADAREQNKEKPKEKTKKSKGKERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5U1	SAM_MT_RSMB_NOP domain-containing protein	0.974	40-64	RSSKKRRTSTKSDKPAKKRREEASK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5U1	SAM_MT_RSMB_NOP domain-containing protein	0.972	652-683	RAKRNAMRRRGLDPRALKKGQEKKPPKETESK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5U1	SAM_MT_RSMB_NOP domain-containing protein	0.848	74-100	KQANGTKKAPGAPENGVRAAKAKSKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q647	Non-specific serine/threonine protein kinase	0.949	39-76	PSRTPERDLPSRESADGPRRSRSPRGWKRSREDHRDRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q647	Non-specific serine/threonine protein kinase	0.797	154-167	KRARTRSRSPRGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q647	Non-specific serine/threonine protein kinase	0.612	35-37	RGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	0.999	91-116	ASKKKKKKNKKKGEKAAEKAAEPEPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	0.99	149-168	GNKKKKKNKKNKDEKDAKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	0.981	2980-3006	RAKRQEKRERAKEKEAKEKGGIRAAIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	0.975	2751-2790	SPHSRRHRTPEEQAAHEKRKEERRRARELEKAKDGAPSSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	0.907	2905-2937	SRVRRSEERGSRENKDRDRERERERERERERES
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	0.789	2689-2719	RRHSHHSSRHRSHRDSRDGSKDGSRRSHRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7L4	Uncharacterized protein	0.621	2802-2806	PRERS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8E3	DNA replication licensing factor MCM2	0.638	21-25	AGRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8H8	Uncharacterized protein	1	275-345	GRRKKKKKTRPGKKRRIVLRKREKIRREKEAEAERLRMSKEEHLREKKKRLNREKKLKRRQKEREKKMAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9R2	Uncharacterized protein	0.925	256-275	ARRREREKRERQRVLHQKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH8	PH domain-containing protein	0.774	24-30	KRRRKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX8	Uncharacterized protein	0.75	507-518	PLHTRARGRKNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAX8	Uncharacterized protein	0.601	481-481	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB72	Uncharacterized protein	0.61	358-362	KPPPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCK9	Uncharacterized protein	0.992	126-161	SKRGTKSPRRLFRRLRRALRGRPADEAERRPRKEKM
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEG7	Uncharacterized protein	0.988	714-748	RKLRRANDRAAERKRKAEKEQERKEKAEAAAKMPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEG7	Uncharacterized protein	0.83	1042-1052	RPRKATKKKEA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEH2	Uncharacterized protein	0.667	8-13	RKQRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHC9	Uncharacterized protein	0.943	202-213	KKKKDKKTKKSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ5	Protein kinase domain-containing protein	0.909	526-545	RGKKGRGNSPKPKERGVLGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHJ5	Protein kinase domain-containing protein	0.634	322-327	RRQKPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK0	Uncharacterized protein	0.997	434-491	PEKKEGDEAKKAELSKEEQREIARQRRRERELHSREVARAKRIKKIKSKTWRRIHRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK0	Uncharacterized protein	0.896	186-197	RSKGKQAKKKRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK0	Uncharacterized protein	0.856	873-899	EKKKHQGRFVTKVEGVKKKDRKDFRLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK0	Uncharacterized protein	0.717	532-544	KESKWAKLGKKAG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHK0	Uncharacterized protein	0.616	36-38	KKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI24	MI domain-containing protein	0.987	23-66	APKPGQKRGARRVSVTSRKERRKAERQQSRAHRTAAGRNPRPER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI24	MI domain-containing protein	0.729	221-226	KRKRKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C9	FK506-binding protein	0.748	307-318	KKLSKKQQKKLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C9	FK506-binding protein	0.706	144-152	NKNKNKGKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C9	FK506-binding protein	0.687	284-289	KKGKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C9	FK506-binding protein	0.666	108-113	SKKARR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0C9	FK506-binding protein	0.618	363-367	GKGDK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T3	Uncharacterized protein	0.813	110-119	RARRSRGRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2T3	Uncharacterized protein	0.619	88-90	GRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q747	Uncharacterized protein	0.987	593-625	RKKAAKKAKKEAQKAEREAAEKAAKQDPNKKSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHI6	Glycoside hydrolase family 5 protein	0.998	102-162	ARGGGGGRRGERERARGRERQGIAREAEAERERERELRRERRREREREQERERARRRERSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJY3	CRAL-TRIO domain-containing protein	0.721	56-64	KKEKKGRMS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJY3	CRAL-TRIO domain-containing protein	0.618	67-69	SRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK20	Ras-GAP domain-containing protein (Fragment)	0.987	734-762	RPARARSEAGRPPRNAKRQPGRPRPRVRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR5	INCENP_ARK-bind domain-containing protein	0.937	974-1044	AAKRKEQEEREAQRKRETKQEMERKRAAQEEERRQEQQRRAEAERQKEEERKAAQRRAAIEKAKQTKAPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR5	INCENP_ARK-bind domain-containing protein	0.717	736-755	REREKERETEREKEREREMK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR5	INCENP_ARK-bind domain-containing protein	0.669	769-777	KAREKEREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR5	INCENP_ARK-bind domain-containing protein	0.668	71-81	LRGKTPRTARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM58	Uncharacterized protein	0.95	594-619	ERRRGAAMGLEGPGGGVGRGRRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND4	ANK_REP_REGION domain-containing protein	0.815	96-107	PRRQRRKSARSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QND4	ANK_REP_REGION domain-containing protein	0.614	558-559	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N2	Zn(2)-C6 fungal-type domain-containing protein	0.65	53-57	GRPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P2	Uncharacterized protein	0.973	327-391	IHEEKKRKEEEERIKRELELKKLEEEKKAEEERKRKEKEAEEIIAQYKAKEAERIEKEKKEKEAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P2	Uncharacterized protein	0.972	132-151	SSRRHRRRHRYRSRSRARSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P2	Uncharacterized protein	0.606	521-521	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3P2	Uncharacterized protein	0.603	524-524	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q408	SUZ domain-containing protein	0.898	179-195	GRQGHRGRGRGRGGRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q536	Carbohydrate-binding module family 50 protein	0.993	116-148	EKEKKKKEEEERKRREEEERRRKEEEKHHRPQH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q678	Uncharacterized protein	0.999	198-252	REKARLEKLQAREEKKAAEEKAKAKRAREKRKAQQKRRDEEREREKDRIRRERRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6C7	Uncharacterized protein	0.998	199-239	RKKDKKLEAERRKREKERAEKEAKAARKRNTARLSKAPPPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R6	Uncharacterized protein	0.968	175-186	RRPKRRRRRGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R6	Uncharacterized protein	0.939	60-72	ERERSRKKNKKRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6R6	Uncharacterized protein	0.911	237-247	RRPPKRRKEKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y4	Uncharacterized protein	0.996	141-177	EARKRRPRTTRARIRAETAKKLAKLAERKRKKMRERA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y4	Uncharacterized protein	0.957	108-131	MRRRTASHNAKRVPKRLRERARRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y4	Uncharacterized protein	0.744	197-220	AARPKIRRNTLNEPPKPDSKFRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6Y4	Uncharacterized protein	0.71	635-641	RRPKGKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7J8	Endonuclease III homolog	0.805	164-174	RPRGRARKPVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8B4	Uncharacterized protein	0.953	163-172	RRRGRRRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9F6	Elongation of fatty acids protein	0.73	293-302	GKRPSGRKAV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDN3	Uncharacterized protein	0.997	76-96	SRDAPGKKKKKEEKKRNGKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDN3	Uncharacterized protein	0.668	35-40	REKKPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE1	Uncharacterized protein	0.985	128-154	HHHHRHRHRPRSRTRSRARDRERRDRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE1	Uncharacterized protein	0.985	302-355	ARARRERERRRAREEEEAARAVEREMERCLRRGEERRRRRGWRGRWERYLRRWR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE1	Uncharacterized protein	0.967	191-208	HHGRQHRRRRHHRHKHRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEE1	Uncharacterized protein	0.783	73-88	PTKLRFKSKASRSRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGQ1	PseudoU_synth_1 domain-containing protein	0.965	35-79	RGNRGGRERGNDKQKRKHSGFGSAKGPVPDKRERVQNDRNAKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKW6	Uncharacterized protein	0.918	519-536	RARSRSRSRSRSRSRGRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNW1	Uncharacterized protein	0.833	278-289	KKKGKRSAPVLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPG2	Uncharacterized protein	0.863	372-385	KQKGRGKNKKTNKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPG2	Uncharacterized protein	0.632	872-875	EKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2PZK1	Uncharacterized protein	0.649	1044-1048	RQKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q178	Uncharacterized protein	0.785	865-889	PPASSRKSSAKAAGKTAAGDGKKPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q178	Uncharacterized protein	0.656	578-584	RVNARRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q178	Uncharacterized protein	0.608	326-327	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3C5	Exonuclease domain-containing protein	0.803	67-77	GRPVKKHKKVP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q432	Uncharacterized protein	0.826	212-218	KPKKRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q432	Uncharacterized protein	0.791	271-286	RGRRLGASRRDRAKNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q591	Uncharacterized protein	0.833	578-590	KPKTRKVKKQVRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T3	Uncharacterized protein	0.635	310-315	RRRHHH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q610	Ribosomal_L14e domain-containing protein	0.797	122-140	RLKKQRRFEERKALAKIRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q614	Uncharacterized protein	0.781	232-241	PPRPRPRPRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8F9	Uncharacterized protein	0.998	546-606	WKQLKRQQKRARRQLRRERKQQRRQEKRERRQARREQKRAAKEMRREARRRPPPPPPPPPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB65	Protein transport protein sec16	0.997	1868-1933	RTPGPKTRPRRRHPRRPGQHREPPSAPLAPARRLLPRQQKQPAARARARAPLPRPRVRRAPRAADQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB65	Protein transport protein sec16	0.991	1938-1977	PLPAPRRRDRWPCYGRRPTAARLVPRRWVRAPRRRGRRPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB65	Protein transport protein sec16	0.981	1805-1842	RPKPNGPKQPNRPKRGGASPPGSVSARRRTRPARAPAP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB65	Protein transport protein sec16	0.702	1054-1061	LKGKSKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB65	Protein transport protein sec16	0.629	1743-1746	KPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBQ3	SANT domain-containing protein	0.98	231-243	NKKGGRKGRRKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU7	Mitochondrial DNA polymerase catalytic subunit	0.919	481-498	KGKKKNDPPRPAARQKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBU7	Mitochondrial DNA polymerase catalytic subunit	0.772	23-33	RHRAARRRPWH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCA1	Uncharacterized protein	0.967	50-103	GPRLSKAEQRRIEREEQERIRRELEREKQLNRARVLRERKKAKEQQALEEKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDI8	Zn(2)-C6 fungal-type domain-containing protein	0.625	191-195	GKERK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA8	Zn(2)-C6 fungal-type domain-containing protein	0.859	60-67	ARKRKRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH29	Uncharacterized protein	0.874	176-193	RRLSGPPSRKKRNVPKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH88	Zds_C domain-containing protein	0.996	582-616	EDKEKKKREKEKEKEREREREREREEQARKAKARS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QH88	Zds_C domain-containing protein	0.921	658-702	RKKETNRKASEGKKEKEGFFGGLFGVSKKNRDKESSHKKKEHRPL
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK88	DNA replication regulator SLD2	0.973	335-414	KSKTKNSRSATAKNKDKDNKTNNGRSGSGDGDGKDKGEGVVRRAVRKVKATAHANFKRLKLRNSGAKGGPAHNSRFRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QK88	DNA replication regulator SLD2	0.81	243-262	KKRGQKRTTRLVKMRPTRTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN81	Replication factor C subunit 1	0.955	244-259	KPAKKAAKPRAPRAKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN81	Replication factor C subunit 1	0.953	11-36	KSGAPPPKPAAKKEEQTKKPRVKGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN81	Replication factor C subunit 1	0.827	406-451	KQAGKAKQKQEAEEKKIREEAARMEKEEQERKAEAEKEAKKAAAAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN81	Replication factor C subunit 1	0.612	58-59	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPA9	Uncharacterized protein	0.998	156-215	KKLRRSPSKRRKDPSEKSEKERGREREREREKERDKERDKERERERRKEKEKERERERER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPC8	Uncharacterized protein	0.808	262-282	KGHKDKNNKRSLRRLCHKRQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4V5	Uncharacterized protein	0.997	447-463	SKAAEKKKNKKKKRKAD
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Y0	ThrE domain-containing protein	0.88	356-368	SKSRKTAKSKKKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4Y0	ThrE domain-containing protein	0.739	30-38	PPKGKEKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q621	Nascent polypeptide-associated complex subunit beta	0.977	9-35	KKLGASARIGGKGTPRRKVKRAPARSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7Z2	Uncharacterized protein	0.81	87-99	EPPRDRKKEKNIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q940	Topoisomerase 1-associated factor 1	0.996	948-998	RKRTAEDEPPPPPKRKRRRRRGSDEAETDEQREARARARRKKERERARRIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q940	Topoisomerase 1-associated factor 1	0.994	555-569	RSRKRRRRRKKAANK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q940	Topoisomerase 1-associated factor 1	0.946	1123-1138	RRPNKRRRTTQKKKNK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q940	Topoisomerase 1-associated factor 1	0.73	1075-1081	RRGRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q940	Topoisomerase 1-associated factor 1	0.637	337-341	PPRRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC59	Uncharacterized protein	0.997	1098-1146	QAKEAKEARPVKSAKKSSGAATPKPKKIPGKAKRPAREERFIPESERRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC59	Uncharacterized protein	0.997	1356-1406	STRRAKAAPAPKKSKTPPAPKGKAAATKGKAAEKPAPAPARTGGRVTRSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC59	Uncharacterized protein	0.901	1252-1284	PKKKSLAVRGKGGATATRRTRAASARGRGAREK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC59	Uncharacterized protein	0.847	1067-1074	RKKKRKSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA6	Uncharacterized protein	0.95	803-819	KKRRRVKRRDAQAAKVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEA6	Uncharacterized protein	0.778	1109-1115	KKRKARK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF30	Protein kinase domain-containing protein	0.935	204-216	RKRRWRRVRGRKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF30	Protein kinase domain-containing protein	0.782	436-442	LRKRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU6	Uncharacterized protein	0.999	42-72	IEKKKKKKEKRDKKEKKEKRDKKEKKEKKAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGU6	Uncharacterized protein	0.998	96-115	RPAKKDKKKKKDKKDKKDKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIS8	Zn(2)-C6 fungal-type domain-containing protein	0.849	99-114	GRAPRRPRPKDPNAPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJH7	Ubiquitin-like domain-containing protein	0.995	73-99	LRGGAKKRKKKVYTTPKKIKHKRKKTK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR7	J domain-containing protein	0.69	169-178	RPPKPPPREP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKR7	J domain-containing protein	0.645	525-530	RPIKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLD4	AB hydrolase-1 domain-containing protein	0.756	354-364	RKKRSSARASR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLD4	AB hydrolase-1 domain-containing protein	0.722	743-751	QKRVKRDKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLD4	AB hydrolase-1 domain-containing protein	0.654	495-501	KKRSSSK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QLD4	AB hydrolase-1 domain-containing protein	0.606	285-286	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMF9	SWIRM domain-containing protein	0.679	222-231	KPRSPKTKPQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN99	Uncharacterized protein	0.688	4-12	KKRGRERPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QN99	Uncharacterized protein	0.609	162-163	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QP64	Uncharacterized protein	0.995	42-179	RERDKDRRSRDRSRDRSRDRSRDRSRDRSRDRSRDRGHRRRDRSSGRYRNSSSGRDTPRSEAGSHRSRRRSRSRDSGRHSRRHRNDGDYYRGSNRGRGGRSRSRSPSRYYRPPGDDRRDRDDRGYRRRDDDRRGRRHS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPT8	Uncharacterized protein	0.615	192-193	RK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ41	WD_REPEATS_REGION domain-containing protein	0.828	711-721	KKKSKKQSRAS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q062	F-box domain-containing protein	0.885	139-165	WRRIQERAAREEEERKRWRKVVNRRHE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q181	Tyrosine--tRNA ligase	0.624	545-550	KKEKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q659	Uncharacterized protein	0.724	471-487	SPPRKVKLDVPKSKSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7X9	Uncharacterized protein	0.999	139-202	ARRIEAEKKEAERKAKLEETKESLRKKRKRNKGKARKEEEEGESVKEVAATGTKAAKPKKKKRV
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7X9	Uncharacterized protein	0.808	20-68	GGKGSSKQSGSGGITKSKGRAGSKANVPATQVKGRPNLPGLDKDKKKKQ
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q7X9	Uncharacterized protein	0.75	92-98	PRGKKKG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAH4	TPR_REGION domain-containing protein	0.749	107-119	RRRQKQREAREKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE46	rRNA-processing protein EFG1	0.994	19-51	ARKRMKPNRPHKKKQKKPVDMESLAAIKKRARA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE46	rRNA-processing protein EFG1	0.954	220-260	PAKQAANKQHSARKGKKGAQEPGSKGSRSGSTKVEQKHSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QE46	rRNA-processing protein EFG1	0.843	80-97	QRIEEARRKKERSTMIKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX9	DDHD domain-containing protein	0.784	335-367	KKSKEEKRPSTPEGSRSTSKERDGKLSGAFKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFX9	DDHD domain-containing protein	0.682	514-519	KRKPKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHT2	BZIP domain-containing protein	0.617	198-201	RKSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT5	Structure-specific endonuclease subunit SLX4	0.976	364-386	SAKPKASRGTKAKAGKRKEQPPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT5	Structure-specific endonuclease subunit SLX4	0.89	305-317	SPTKPKAPKKRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT5	Structure-specific endonuclease subunit SLX4	0.859	713-723	PMKRPRGRPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT5	Structure-specific endonuclease subunit SLX4	0.767	176-183	KERRPKKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIT5	Structure-specific endonuclease subunit SLX4	0.714	690-698	APSTRRGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKT0	KRR1 small subunit processome component	0.974	277-300	RAAEAERAEKAKQKKEEKKRERER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKT0	KRR1 small subunit processome component	0.911	226-245	KKRTLSKRRKPYKITDKSKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKT0	KRR1 small subunit processome component	0.602	314-314	K
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QMU6	Uncharacterized protein	0.98	76-105	RVKKEYEERQKQKKNKEKKKEEEAKGEAKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1J6	Uncharacterized protein	0.943	551-569	GRKGPAASKRSGRPKKTER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N8	Origin recognition complex subunit 1	0.884	253-279	TPKRARTRDGAVTPGSRRKPGPGSKPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N8	Origin recognition complex subunit 1	0.707	611-616	KKKKMR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3N8	Origin recognition complex subunit 1	0.676	584-590	RKGRKGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S6	Chromo domain-containing protein	0.987	113-136	ARLLAERQGAGPKEKKKKPGRPAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S6	Chromo domain-containing protein	0.81	323-333	RKRKGRAPNGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5S6	Chromo domain-containing protein	0.61	414-415	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8R3	Uncharacterized protein	0.998	342-372	KGAQGKAEKKGKEAAKGKGEEKKEKEKPRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8U6	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.871	545-556	GTGGRKARRKER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8U6	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.707	85-90	RGRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBI1	Phosphodiesterase	0.647	879-882	KKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QBL8	Uncharacterized protein	0.916	337-368	SRKRKSRSATAEPSEEPHHEPERKLKRPRTRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCG2	N-acetyltransferase domain-containing protein	0.686	179-189	RRRVRGQKGGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW2	Uncharacterized protein	0.81	1038-1045	RRGRKKRE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEW2	Uncharacterized protein	0.736	20-26	SRKKRGR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF57	BUD22 domain-containing protein (Fragment)	0.987	146-207	EKKGKGKKGREEKTEDKTDGTRTDGAVKKKEKKKAEQAGEREGREERDKQSGKTEKEKGQKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF57	BUD22 domain-containing protein (Fragment)	0.987	457-499	KKQADNEKKQPTDEKKKKPAPRKRDDTGPLHPSWEAKRKAKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF57	BUD22 domain-containing protein (Fragment)	0.969	378-445	PKRKNRRGQRARQAIWEKKYGDKARHLQKAAKGRDAGWDPKRGAVNGESKPWKRGIRNPLLDKDKAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF57	BUD22 domain-containing protein (Fragment)	0.917	336-348	SPPPKKAKKAKGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFE0	Uncharacterized protein	0.816	125-143	RRRRTRPPHHHHRSSRSGP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGB1	Uncharacterized protein	0.984	30-69	MKERRGRRPGPNRARERRVPSLSPQSPPLPSRRKPRRERN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QGR7	MYND-type zinc finger protein samB	0.995	1160-1213	PRPRPPHRPPRLRRAPAHARHHARAGTPRLPGGRRGPARRGGGIHHGRCGRAKA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI01	AAA domain-containing protein	0.708	434-440	RRRKNHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QL41	Zn(2)-C6 fungal-type domain-containing protein	0.857	126-136	ERKKRGKASRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QM63	tRNA-binding domain-containing protein	0.968	188-205	AAAKKQKKEKKERAPKQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS7	BHLH domain-containing protein	0.906	384-403	KRQRKSGTGKSGAGRKKSPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q251	Uncharacterized protein	0.624	119-121	KRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q309	Uncharacterized protein	0.831	554-570	IRRQRKPGHSNPRKNGG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q309	Uncharacterized protein	0.606	542-543	RR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3Y9	Zn(2)-C6 fungal-type domain-containing protein	0.63	60-62	RRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q631	Uncharacterized protein	0.653	986-991	RPSKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V9	Uncharacterized protein	0.934	190-205	TPGRKRRTAGRKRSPT
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q8V9	Uncharacterized protein	0.804	70-80	AKRRGRPPKSA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV6	Uncharacterized protein	0.977	173-187	RIRMRQKPKKKKAKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV6	Uncharacterized protein	0.944	725-757	KKAKTPPTPSTGLKRRRATRKAASPAETGAKKP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV6	Uncharacterized protein	0.923	462-475	KRKVSKRHSKRKSH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV6	Uncharacterized protein	0.858	212-248	GGGTSSKPPAVRSAPKKRIVSDDNWMKGKKGRSPPRN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QAV6	Uncharacterized protein	0.821	340-350	RVKPIKPRKPK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCP1	JAB_MPN domain-containing protein	0.732	58-76	QKKKEWLRSQRNRFGEKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCP1	JAB_MPN domain-containing protein	0.619	181-185	KRDRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QD28	Uncharacterized protein	0.999	43-106	HKGKEKKKKKEPLVASSPKADRAQERARMAEEREERKKREKEEKKREKERAREERRRETKGKRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV2	AAA domain-containing protein	0.993	34-55	SRRSAKKSRSSKSKGRRKRSNR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV2	AAA domain-containing protein	0.966	393-408	RGRGNRARSRRSRRKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV2	AAA domain-containing protein	0.882	435-446	RSRPRRSRRRSP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV2	AAA domain-containing protein	0.65	1311-1314	ARKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV2	AAA domain-containing protein	0.638	340-349	RRLRQRSGLR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QDV2	AAA domain-containing protein	0.629	456-458	KKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFJ5	Uncharacterized protein	0.672	456-462	ARRLKRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFR6	Cation_ATPase_N domain-containing protein	0.885	1071-1080	RHGRRRRRRS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW3	Mannose-1-phosphate guanylyltransferase	0.71	83-98	KRKRSLSDSPRRERPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFW3	Mannose-1-phosphate guanylyltransferase	0.616	230-232	KRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV5	NIBRIN_BRCT_II domain-containing protein	0.987	502-520	SPKGKPKKGQAKGKGKKIK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV5	NIBRIN_BRCT_II domain-containing protein	0.861	367-380	GPRPGRGRRAGRSR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHV5	NIBRIN_BRCT_II domain-containing protein	0.694	599-607	RKNFKRFRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIA5	Uncharacterized protein	0.951	295-310	LRGKGAKGKTRKGKGA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPP9	Uncharacterized protein	0.889	615-627	SKKGKPKPAKAPP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPP9	Uncharacterized protein	0.682	813-823	KPPTPRMPKRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ93	Uncharacterized protein	0.972	195-227	PRRRGRPRKSGTPTTTRRKRPGTPAKVLRKSTG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ93	Uncharacterized protein	0.935	254-284	RATKRKATSPAKEDNGGAPGSQPRKRGRPRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQ93	Uncharacterized protein	0.705	1657-1667	RHHHRDRRHRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC6	Uncharacterized protein	0.99	745-825	KGGKDREREREKVPDKDRENKNRDKERARDRYRDREKDRERERDRDRDRERDRDRERERDRDRDRDRDRDKERERPRHPAN
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC6	Uncharacterized protein	0.957	421-468	FKLKKANAKRAKELLSLPSKSTKDALKKERSESAEAPPPPAKKRPRPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC6	Uncharacterized protein	0.913	329-348	KHKTAGKASKPEKEKAKRFK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QQC6	Uncharacterized protein	0.813	210-245	PRKRTKSDVGMAKAEQSSRPAKPGTPRGREGAEKPA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H0	PNPLA domain-containing protein	0.992	889-912	RRRARERRAKAHPRRRAKSEELAR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0H0	PNPLA domain-containing protein	0.967	1306-1327	RRKLRAREEERNKKKRNGMKQP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G0	tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial	0.989	1641-1690	RRQRLRNEERRRERIQRWLESRKLTAWVGKLKKRQARKLERMRKERIKLK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G0	tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial	0.828	170-181	RRKGTKGKKAEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G0	tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial	0.706	607-613	REGRKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q1G0	tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial	0.696	565-573	KAERERRRH
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W0	Uncharacterized protein	0.949	140-154	RRRRSRSRRRYSRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q3W0	Uncharacterized protein	0.729	248-256	RRRRSSRVR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q475	Uncharacterized protein	0.812	61-104	KRPPEPPSATSGARKGKETDEERKPSMGAAAPRSGAGKKDSKSE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q4A9	Zn(2)-C6 fungal-type domain-containing protein	0.752	34-41	SKKKQRRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S1	Uncharacterized protein	0.999	422-444	RRGHGKRHRRRLPRRKHRKHRHR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S1	Uncharacterized protein	0.627	367-370	HRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q6S1	Uncharacterized protein	0.603	364-364	R
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q749	Zn(2)-C6 fungal-type domain-containing protein	0.774	292-301	GRHKKEIKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H0	Protein kinase domain-containing protein	0.944	670-713	ALRREKEKKEKERARAAQQQSGSKEEGPPGSSSARDRDRERKRP
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q9H0	Protein kinase domain-containing protein	0.934	270-340	KPAAQKPPPPRPERDRGGFPRNAPTEPASERPRPVAPTGPSDRKVPEPARQPDTTPRTRKVKKIVRRLKEK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QC66	Uncharacterized protein	0.916	92-108	KRRRRVTRRGKSPAASR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCI5	Uncharacterized protein	0.996	152-330	KREEPSEEPKPQPKPPPEPKQQPQPPPPQPASAKPEAPKGAWEKAREEMRRREEERKAKEAEAKKKEETARRLRELREREARERDLKEKLRQEQEAKERERLERELREKVERELREKIERENKEREEARLKEEQRKLEEERARQEKERQAARERERKEREERLARLRREQEEKEKKEKE
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QCY6	HET domain-containing protein	0.833	447-457	WKDRRERKRPR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEK1	Mitochondrial distribution and morphology protein 34	0.929	355-373	RHSKAGRKKKTRVVNLRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV0	Piwi domain-containing protein	0.968	10-82	GGGRGGGRGGRGGQAGEGFRGGGGRGGYPGGGRGGGDGYRGGRGGGGGEFRGGRGGRGDFRGGRGGGGRGGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QEV0	Piwi domain-containing protein	0.885	201-228	KKAKGKPKQASGQQPNAPKDAREAKGKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QI34	Uncharacterized protein	0.835	173-181	RRRMKRRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QIL3	Uncharacterized protein	0.748	287-293	GDKKRKR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJM3	Nucleolar protein 58	0.999	456-488	PAKEKKEKKEKKDKEEKKDKEGKKEKKDKKRKS
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJM3	Nucleolar protein 58	0.987	504-515	EKKKKKKRKSAA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJR8	Uncharacterized protein	1	1461-1488	KGKGKGKRKKKKEKKEKRGAAGWRDVER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QJW8	Uncharacterized protein	0.834	7-20	RNRKSLKKRVDKRA
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPS5	Uncharacterized protein	0.987	323-337	GIRKRGSKRREKKRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U9	Nucleolar protein 12	1	561-608	KRASARDGKPRDLKFKKTKSKAAKAKPKASKKKKKAKAKAGKAGKAGK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U9	Nucleolar protein 12	0.878	460-481	KTARAMEARMSAKLDKKKGGRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U9	Nucleolar protein 12	0.864	515-535	AKLTGKPAGPVNKKRQARKER
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q0U9	Nucleolar protein 12	0.835	149-155	GRKRKRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q143	Uncharacterized protein	0.928	594-606	PPAKRTRTRRKKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N8	Uncharacterized protein	0.986	295-318	GRRGPAAAGRKRGAPGAAKQKRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q2N8	Uncharacterized protein	0.652	262-268	AKLQRRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q555	Uncharacterized protein	0.764	81-87	KKPKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2Q5T8	Uncharacterized protein	0.631	135-140	EKGGRG
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QB47	BZIP domain-containing protein	0.931	76-107	KPAAKRKRENRYKNAPPAVLSRRREQNRASQR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QF25	SET domain-containing protein (Fragment)	0.613	192-193	KK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QFT0	Uncharacterized protein	0.687	473-477	GKRRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QHG5	DNA-(apurinic or apyrimidinic site) lyase	0.986	314-355	EKPKKVVRAKDAIAEDAMPKSKKRKAEKDEIPAKRSRATPKK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QKY5	Uncharacterized protein	0.71	48-57	RIKDAKRRAK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QNF5	Uncharacterized protein	0.977	15-39	TRRRIRRRAAEGRNAGRKLSRPSRK
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPV9	DUF2293 domain-containing protein	0.836	5-26	KRHAPGPGAGDHAKERHKRDRR
UP000007322	Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799)	G2QPV9	DUF2293 domain-containing protein	0.807	315-331	PQKIKKPTREDKRAAKW