ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000006174	Ustilago hordei	I2FPL3	Uncharacterized protein	0.976	170-193	AKSGDKAAAPKKRSRRRSPTPPEA
UP000006174	Ustilago hordei	I2FPL3	Uncharacterized protein	0.601	199-200	PP
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.992	624-637	GKKKRKKSKKNKSK
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.958	188-208	EAKRRKGGVFGRLKRLGRKPK
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.803	1266-1292	PKSRSNSLRRKEGSSGLQRRRPLPAPS
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.756	743-754	RKSRAAKPAKGS
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.747	12-30	SARPGIRHRSRSNGPDRKG
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.703	1241-1258	DEKKGPSLLSRGKGSLRR
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.658	1845-1850	RPARKA
UP000006174	Ustilago hordei	I2FR55	DUF3818 domain-containing protein	0.64	1234-1239	SRRGPV
UP000006174	Ustilago hordei	I2FTH2	Uncharacterized protein	0.874	659-679	RSNRWRGNKPPRPHRASPPPP
UP000006174	Ustilago hordei	I2FTH2	Uncharacterized protein	0.789	393-402	GQGKKKGKNA
UP000006174	Ustilago hordei	I2FUB1	Uncharacterized protein	0.771	91-118	RRRVRIQRQSKAGVKLPVGRSSSRRKAR
UP000006174	Ustilago hordei	I2FYB1	Transcription initiation factor IIF subunit alpha	0.874	165-182	RPAKSKLFKKKVREIHKA
UP000006174	Ustilago hordei	I2FYZ0	Related to TOK1-Voltage-gated, outward-rectifying K+ channel protein of the plasma membrane	0.994	327-354	TKERRRRIRERKERLKEEKREERALKKA
UP000006174	Ustilago hordei	I2FYZ0	Related to TOK1-Voltage-gated, outward-rectifying K+ channel protein of the plasma membrane	0.942	545-562	RGEKRMRRRRSRERMEGG
UP000006174	Ustilago hordei	I2FYZ0	Related to TOK1-Voltage-gated, outward-rectifying K+ channel protein of the plasma membrane	0.905	571-594	ARSRNRRGGRKSEGDLPRPKLSAR
UP000006174	Ustilago hordei	I2FZ08	Related to PDS5-precocious dissociation of sister chromatids	0.997	1203-1228	GGKKRKATTTAAARGKKKAGKSKKRK
UP000006174	Ustilago hordei	I2FZC0	Related to positive effector protein GCN20	0.705	545-566	AKSAKKSGDDNKMRMAKSRQKK
UP000006174	Ustilago hordei	I2FZC0	Related to positive effector protein GCN20	0.661	328-337	RERLREARKL
UP000006174	Ustilago hordei	I2FZC0	Related to positive effector protein GCN20	0.608	135-136	PK
UP000006174	Ustilago hordei	I2FZC8	Uncharacterized protein	0.83	1128-1151	AWAKDGVRDRIRRTKDKVLGKKGR
UP000006174	Ustilago hordei	I2FZC8	Uncharacterized protein	0.642	1106-1117	SKKEALHSRHRG
UP000006174	Ustilago hordei	I2G2W0	Zn(2)-C6 fungal-type domain-containing protein	0.946	143-153	HRGRKPKKRPR
UP000006174	Ustilago hordei	I2G3X1	Related to Ste20-like protein kinase has effect on mating	0.874	573-583	PPPPKRKRGRT
UP000006174	Ustilago hordei	I2G4C3	Related to inner kinetochore protein MIF2	0.956	170-197	NARQETKPRAATASKKGKEKSAPRGRGR
UP000006174	Ustilago hordei	I2G4C3	Related to inner kinetochore protein MIF2	0.932	337-347	PPKKKRGRPPK
UP000006174	Ustilago hordei	I2G4C3	Related to inner kinetochore protein MIF2	0.893	243-258	PPKPKSPAKPAIKKRA
UP000006174	Ustilago hordei	I2G5J8	Uncharacterized protein	0.965	695-722	RKAPSPFSGKRSLEKKGLAKKRSAGRRS
UP000006174	Ustilago hordei	I2G5J8	Uncharacterized protein	0.943	106-137	KMARSLNGKKPTKVYSSKKDRPRAERKASVRK
UP000006174	Ustilago hordei	I2G5J8	Uncharacterized protein	0.897	984-997	RITRREKRERRLKR
UP000006174	Ustilago hordei	I2FMT1	Uncharacterized protein	0.961	203-227	ASPASASRKSPKPSGKTSRKEKKEK
UP000006174	Ustilago hordei	I2FMT1	Uncharacterized protein	0.879	654-663	KTNGKRARRK
UP000006174	Ustilago hordei	I2FMT1	Uncharacterized protein	0.637	295-298	DKKR
UP000006174	Ustilago hordei	I2FMT1	Uncharacterized protein	0.615	563-564	KK
UP000006174	Ustilago hordei	I2FNS6	J domain-containing protein	0.642	326-331	KAFRRR
UP000006174	Ustilago hordei	I2FP74	Related to bumetanide-sensitive Na-K-Cl cotransport protein	0.835	1069-1088	ERRARQAAKRKSQALSPAKA
UP000006174	Ustilago hordei	I2FPE5	RRM domain-containing protein	0.982	738-772	KGKKEDTAGKSGDEKSGRNAKGKKERPVKERGEKG
UP000006174	Ustilago hordei	I2FPE5	RRM domain-containing protein	0.954	791-810	NKNKKKNIGREKKERKVDEK
UP000006174	Ustilago hordei	I2FPE5	RRM domain-containing protein	0.743	572-584	PTKERKERLPRQR
UP000006174	Ustilago hordei	I2FPI0	Zn(2)-C6 fungal-type domain-containing protein	0.963	52-89	KKRGPPKGCDPRGGRKKKLQEPPATTLAKRKAPSSSKK
UP000006174	Ustilago hordei	I2FPI0	Zn(2)-C6 fungal-type domain-containing protein	0.911	936-958	KKGKKGAAQPAKKGAQASAKDKR
UP000006174	Ustilago hordei	I2FQ28	Related to deoxyribodipyrimidine photo-lyase PHR	0.677	169-174	RRKKGK
UP000006174	Ustilago hordei	I2FQZ4	BHLH domain-containing protein	0.993	744-768	KKKSPAKGGAGKKGGGQGRKKKSIK
UP000006174	Ustilago hordei	I2FQZ4	BHLH domain-containing protein	0.94	595-611	KKSKSPSKKKKSTSGSS
UP000006174	Ustilago hordei	I2FRA4	Probable BMS1-GTP-binding protein, required for distinct steps of 40S ribosome biogenesis	0.981	1098-1154	EKEEKRKKKNNENKSEKAKLAAKDEEIRAQKRKAEMKEIYRIQGMKAQSAAKRQKTK
UP000006174	Ustilago hordei	I2FRA4	Probable BMS1-GTP-binding protein, required for distinct steps of 40S ribosome biogenesis	0.803	10-25	AHRKAKTGGKAEKTKT
UP000006174	Ustilago hordei	I2FRA4	Probable BMS1-GTP-binding protein, required for distinct steps of 40S ribosome biogenesis	0.719	183-194	KAKTLKATKKRL
UP000006174	Ustilago hordei	I2FSM0	Uncharacterized protein	0.918	965-982	RARRNRERRRKEDDVERR
UP000006174	Ustilago hordei	I2FTC1	Related to 60S ribosomal protein L28	0.953	124-145	RSQRGRKQPPARKVRGAGPRKT
UP000006174	Ustilago hordei	I2FVV4	Related to Protein-tyrosine phosphatase, receptor type 1	0.803	325-339	RWRKGPLKPKPDAKA
UP000006174	Ustilago hordei	I2FVY9	Related to Splicing factor U2AF-associated protein 2	0.726	110-117	RSKKRPPS
UP000006174	Ustilago hordei	I2FWS2	Related to SRP40-serine-rich protein with a role in pre-ribosome assembly or transport	0.985	612-634	AAKRTAMPRRRRRRRLVLKLKIP
UP000006174	Ustilago hordei	I2FWS2	Related to SRP40-serine-rich protein with a role in pre-ribosome assembly or transport	0.978	543-570	SVKRKSKDPDAVAFGPPKRRGRPPKKHH
UP000006174	Ustilago hordei	I2FWS2	Related to SRP40-serine-rich protein with a role in pre-ribosome assembly or transport	0.732	394-400	KTKRKKR
UP000006174	Ustilago hordei	I2FWS2	Related to SRP40-serine-rich protein with a role in pre-ribosome assembly or transport	0.726	279-286	GRGRPKKH
UP000006174	Ustilago hordei	I2FWS2	Related to SRP40-serine-rich protein with a role in pre-ribosome assembly or transport	0.721	44-50	QKPRRKP
UP000006174	Ustilago hordei	I2FXE7	Zn(2)-C6 fungal-type domain-containing protein	0.623	318-321	RRAK
UP000006174	Ustilago hordei	I2FYE9	Component of oligomeric Golgi complex 8	0.981	1052-1065	GRGGKKNKNKNKKK
UP000006174	Ustilago hordei	I2FYE9	Component of oligomeric Golgi complex 8	0.962	704-785	RARQREEERKRVEEEARRKAEAEAKAKAEAEAKAKAEEEARKQAEAESKAKIEEEARIKAQEERKKAEEEKEARKKAEAEKA
UP000006174	Ustilago hordei	I2FYE9	Component of oligomeric Golgi complex 8	0.757	681-692	KRRMGEAKERKR
UP000006174	Ustilago hordei	I2FZ95	DUF155 domain-containing protein	0.671	130-138	RRLTKRSRA
UP000006174	Ustilago hordei	I2FZM6	Uncharacterized protein	0.944	351-363	IRPKGKRGRKSKA
UP000006174	Ustilago hordei	I2FZM6	Uncharacterized protein	0.861	261-269	PKKRGRKPK
UP000006174	Ustilago hordei	I2FZM6	Uncharacterized protein	0.776	393-399	AKRKRRT
UP000006174	Ustilago hordei	I2G0C3	Related to BCP1-Essential protein involved in nuclear export of cytoskeleton organization protein	0.996	225-251	GARKRKAKLARREAKKAGAKKDAPKAR
UP000006174	Ustilago hordei	I2G0Z9	Conserved uncharacterized protein / related to thiamin pyrophosphokinase	0.68	1026-1033	GKPRERRS
UP000006174	Ustilago hordei	I2G4Y0	Chitin synthase	0.618	277-281	RHKTK
UP000006174	Ustilago hordei	I2G545	Uncharacterized protein	0.969	653-726	GPDRGRGGRILGGGRGGRRGGGSHRGGGGGDGHQTKNATRGRGTGNSGTDRSAKQKEKAGNKARQRGHDKKMSR
UP000006174	Ustilago hordei	I2G566	B30.2/SPRY domain-containing protein	0.686	646-656	AKDKYAAAKKK
UP000006174	Ustilago hordei	I2G566	B30.2/SPRY domain-containing protein	0.653	512-518	RSRGKQP
UP000006174	Ustilago hordei	I2G5Y6	Uncharacterized protein	0.985	180-265	HSKDKLRDDRRNKGHYSKHGSQRHLSGKTERKNHADESRHRPSSHKESREHRHADDHGHKREEWDVERRKRRKEGDREKGNSSRRR
UP000006174	Ustilago hordei	I2FM44	Uncharacterized protein	0.6	1286-1286	R
UP000006174	Ustilago hordei	I2FMH5	Probable 60S ribosomal protein L12	0.803	86-99	KEPPRDRKKEKNIK
UP000006174	Ustilago hordei	I2FMT8	RING-type domain-containing protein	0.678	825-833	RRRGRTPRR
UP000006174	Ustilago hordei	I2FNC2	Uncharacterized protein	0.761	132-143	RRKPRSSSKRAP
UP000006174	Ustilago hordei	I2FP05	UPF0029 domain-containing protein	0.929	140-169	KKSNKTTAKKPAKAKKANGDTTADKTKRPR
UP000006174	Ustilago hordei	I2FP05	UPF0029 domain-containing protein	0.903	104-115	SRRSARRSKRRR
UP000006174	Ustilago hordei	I2FPG7	Uncharacterized protein	0.866	724-737	ERKRRKEEARLRAQ
UP000006174	Ustilago hordei	I2FPL1	Uncharacterized protein	0.989	305-324	PRKEPEKKGKKSKAPKVPKA
UP000006174	Ustilago hordei	I2FPL1	Uncharacterized protein	0.748	143-153	GKQRKTLRRRK
UP000006174	Ustilago hordei	I2FPS2	Uncharacterized protein	0.984	118-152	KRAELERKDEAKTEKNRAKREKKRLAALKAQAAAK
UP000006174	Ustilago hordei	I2FQR2	Glutamyl-tRNA synthetase	0.994	724-755	KKAAAAKARAEKAAAKAKKEQEKAGKKQKKAL
UP000006174	Ustilago hordei	I2FQR2	Glutamyl-tRNA synthetase	0.735	529-542	APKRHTKEMPKHKK
UP000006174	Ustilago hordei	I2FRX9	Uncharacterized protein	0.865	126-143	EKKREERKRQIREEKQEK
UP000006174	Ustilago hordei	I2FT61	Related to cyclin dependent kinase C	0.695	433-446	KRPRSPSGARGNSP
UP000006174	Ustilago hordei	I2FVZ1	Uncharacterized protein	0.942	433-464	PKPKKKQAGSGGGKSGGGGKAANRNADGKGAK
UP000006174	Ustilago hordei	I2FVZ1	Uncharacterized protein	0.78	19-37	RTIPGAPPPAPSKSAKKGK
UP000006174	Ustilago hordei	I2FVZ1	Uncharacterized protein	0.644	512-517	RGGAKR
UP000006174	Ustilago hordei	I2FWE9	Uncharacterized protein	0.626	48-50	KKR
UP000006174	Ustilago hordei	I2FWE9	Uncharacterized protein	0.602	204-205	KK
UP000006174	Ustilago hordei	I2FWJ2	G domain-containing protein	0.997	608-647	QKKMDVLARKRKLMDKGIAVGKSKGTNKPTFKGRAKKKRK
UP000006174	Ustilago hordei	I2FWJ2	G domain-containing protein	0.835	261-273	KKSEKAEKRAKKG
UP000006174	Ustilago hordei	I2FXA1	Uncharacterized protein	0.915	317-335	QKRRGRPPKAAGAQPSRRR
UP000006174	Ustilago hordei	I2FXA1	Uncharacterized protein	0.881	87-101	RKRGRPRGSGPRQRE
UP000006174	Ustilago hordei	I2FY86	Exonuclease 1	0.63	750-754	PRKMP
UP000006174	Ustilago hordei	I2G060	Pex24p domain-containing protein	0.708	535-542	RRRRWLRR
UP000006174	Ustilago hordei	I2G173	Related to ATM1-Mitochondrial inner membrane ABC transporter involved in the maturation of cytosolic iron-sulfur (Fe/S) cluster-containing proteins	0.997	1087-1110	KKKAQNRKKNAKRREKEKQKKSSG
UP000006174	Ustilago hordei	I2G1J4	Phosphatidylserine decarboxylase proenzyme 2	0.985	598-617	VKRPPARPRRSGGKRGGKRG
UP000006174	Ustilago hordei	I2G347	4-hydroxybenzoate polyprenyltransferase, mitochondrial	0.753	606-612	KIRKKKA
UP000006174	Ustilago hordei	I2G4R9	DUF1752 domain-containing protein	0.806	149-165	RAPKASPVKRRIRSERS
UP000006174	Ustilago hordei	I2G4R9	DUF1752 domain-containing protein	0.626	687-690	RRKR
UP000006174	Ustilago hordei	I2FN56	Ribosomal protein	0.713	93-103	NKNKKLVKKLA
UP000006174	Ustilago hordei	I2FQF6	Methionine aminopeptidase 2	1	71-90	AKKKKKNKKKKNKKKSSKAK
UP000006174	Ustilago hordei	I2FT31	Related to CTK1-carboxy-terminal domain (CTD) kinase, alpha subunit	0.78	608-625	KKHSEADTRRVKRPRAEP
UP000006174	Ustilago hordei	I2FT31	Related to CTK1-carboxy-terminal domain (CTD) kinase, alpha subunit	0.714	483-496	RDRRRSPDSHRPRT
UP000006174	Ustilago hordei	I2FU17	Uncharacterized protein	0.749	1068-1074	RRRRRGR
UP000006174	Ustilago hordei	I2FW39	Uncharacterized protein	0.854	15-29	KRFRRHRSSKARRLK
UP000006174	Ustilago hordei	I2FXG4	Non-specific serine/threonine protein kinase	0.991	431-465	ERERLKEKGREKEREREKEKERGDRDRDRERRSRR
UP000006174	Ustilago hordei	I2FY75	Related to DRS1-RNA helicase of the DEAD box family	0.873	840-850	RKKRRSKMMKQ
UP000006174	Ustilago hordei	I2FY75	Related to DRS1-RNA helicase of the DEAD box family	0.821	878-911	RAAKKMQRPTKLGMAPVKVANKSKANKGRTGGGG
UP000006174	Ustilago hordei	I2FY75	Related to DRS1-RNA helicase of the DEAD box family	0.779	91-99	QRKRKEKAH
UP000006174	Ustilago hordei	I2FY75	Related to DRS1-RNA helicase of the DEAD box family	0.602	856-857	RK
UP000006174	Ustilago hordei	I2FY75	Related to DRS1-RNA helicase of the DEAD box family	0.602	934-934	K
UP000006174	Ustilago hordei	I2FYI1	Related to histidine kinase	0.855	1452-1478	KPSKNSKRRLLRHGPVKVKANDPMPAK
UP000006174	Ustilago hordei	I2FZD9	Uncharacterized protein	1	3-29	EKEKKRKREKEKKEKRKKKREKSLRGG
UP000006174	Ustilago hordei	I2FZE8	Uncharacterized protein	0.967	95-124	EKKRRSERRKRAEAAALGHDMIRKARGGEK
UP000006174	Ustilago hordei	I2G0N3	Probable cdk-related kinase 1	0.96	803-834	PKKAKKEAEKAAREAEKARREAQQKAARDRAR
UP000006174	Ustilago hordei	I2G1W1	Uncharacterized protein	0.965	192-213	HPSKSKAKGKSKAKTSKWRAFK
UP000006174	Ustilago hordei	I2G4P2	Nbl1_Borealin_N domain-containing protein	0.738	86-93	SKSKKSKK
UP000006174	Ustilago hordei	I2G4P2	Nbl1_Borealin_N domain-containing protein	0.635	219-223	AKRSK
UP000006174	Ustilago hordei	I2G4W6	Related to Condensin complex subunit 3	0.744	1000-1010	AAAGSKKSRKR
UP000006174	Ustilago hordei	I2G4W6	Related to Condensin complex subunit 3	0.623	588-590	PRK
UP000006174	Ustilago hordei	I2G526	RING-type domain-containing protein	0.917	352-389	GGGGGGRGGGAAAGRGRGGGGASRGGSAAGGRGGGARN
UP000006174	Ustilago hordei	I2G6Y1	Transcription elongation factor 1 homolog	0.87	3-17	KRKSSSKKPGGAKKP
UP000006174	Ustilago hordei	I2FM33	Usp domain-containing protein	0.852	79-107	QKKSKRLSAFGRSGRSISPFRFRSRKRPS
UP000006174	Ustilago hordei	I2FMW1	Related to serine/threonine protein kinase	0.837	496-504	GKKKARPRR
UP000006174	Ustilago hordei	I2FMW1	Related to serine/threonine protein kinase	0.8	97-112	RPKPVSRLEREKKRHH
UP000006174	Ustilago hordei	I2FQA1	Uncharacterized protein	0.816	487-494	KKKKPKGT
UP000006174	Ustilago hordei	I2FSC7	DUF2235 domain-containing protein	0.993	815-836	HKKGKGGKGGKKLKKSETKAKK
UP000006174	Ustilago hordei	I2FSI8	Plus3 domain-containing protein	0.974	195-228	AKSRKKKLPGQTDAKSAKLSELRKKRKEKVAGVS
UP000006174	Ustilago hordei	I2FSI8	Plus3 domain-containing protein	0.962	141-163	KAAAGATKKKRVVRGGKGGRGRG
UP000006174	Ustilago hordei	I2FVH0	Probable SEC7-component of non-clathrin vesicle coat	0.762	2019-2034	KKEEERRRKIVDGKEK
UP000006174	Ustilago hordei	I2FXP6	Related to DUS3-member of dihydrouridine synthase family	0.984	96-135	GKKLKGAARKRARREEAAALAASQPSGKKSKAGEKGGQNK
UP000006174	Ustilago hordei	I2FY12	Related to translation initiation factor IF-2, mitochondrial	0.615	241-242	KK
UP000006174	Ustilago hordei	I2FY12	Related to translation initiation factor IF-2, mitochondrial	0.601	113-113	K
UP000006174	Ustilago hordei	I2FZS6	Probable KEX2-endoproteinase of late golgi compartment	0.821	874-885	RRGGGRREKARR
UP000006174	Ustilago hordei	I2G1P4	Uncharacterized protein	0.734	179-189	RRKSLRKANKE
UP000006174	Ustilago hordei	I2G4U1	Probable 40S ribosomal protein S16	0.928	124-144	RSEPKKFGGRGARARRQKSYR
UP000006174	Ustilago hordei	I2G563	Related to DBP8-ATP-dependent RNA helicase	0.995	289-323	IKPSSERDRRLKAKREAERERKAENERKKGKRPRA
UP000006174	Ustilago hordei	I2G563	Related to DBP8-ATP-dependent RNA helicase	0.939	505-525	NKEKQLARIKAEKRAMKKAKR
UP000006174	Ustilago hordei	I2FLZ4	Ribosome assembly protein 3	0.943	6-23	SKSGKASAGPRRRRQRKT
UP000006174	Ustilago hordei	I2FMK9	Related to DNA-directed RNA polymerase II regulator	0.846	337-346	RRLRKRRRTG
UP000006174	Ustilago hordei	I2FMK9	Related to DNA-directed RNA polymerase II regulator	0.637	488-491	KGKK
UP000006174	Ustilago hordei	I2FP18	Uncharacterized protein	0.899	177-195	KGSRRQQKKQAKRQAKKLT
UP000006174	Ustilago hordei	I2FPD8	Probable RPL2A-ribosomal protein L8.e	0.793	177-193	PLLKAGRAHHKFKVKRN
UP000006174	Ustilago hordei	I2FRH2	Homeobox domain-containing protein	0.694	561-568	RSPRKRDR
UP000006174	Ustilago hordei	I2FTN8	Related to Nuclear pore complex protein Nup214	0.649	1699-1703	RQRRR
UP000006174	Ustilago hordei	I2FU97	Uncharacterized protein	0.893	417-449	SRKESPIRRRPRGDGQPKDPAAAQSSPSKKSKK
UP000006174	Ustilago hordei	I2FX83	Uncharacterized protein	0.926	437-458	RERRERLRAEAGWTGKRRRKAP
UP000006174	Ustilago hordei	I2FX83	Uncharacterized protein	0.799	475-482	KRRGRKHK
UP000006174	Ustilago hordei	I2FX83	Uncharacterized protein	0.793	16-24	KRPRGRPRK
UP000006174	Ustilago hordei	I2FX83	Uncharacterized protein	0.687	357-362	KRRGRW
UP000006174	Ustilago hordei	I2FYH4	Probable RAD16-nucleotide excision repair protein	0.826	360-377	QRKARLRSEKHQARLKKK
UP000006174	Ustilago hordei	I2FYH4	Probable RAD16-nucleotide excision repair protein	0.775	219-228	SAKGKGKGKA
UP000006174	Ustilago hordei	I2FZ92	Uncharacterized protein	0.96	515-539	ATARGRPGMRRGPKRAPGNPNAKPK
UP000006174	Ustilago hordei	I2FZH1	Uncharacterized protein	0.996	211-249	KEERERKKAEDKEKKDQKKREKEERKQIKEELKRERNEV
UP000006174	Ustilago hordei	I2FZK2	Uncharacterized protein	0.876	837-844	RRRRKKRQ
UP000006174	Ustilago hordei	I2FZK2	Uncharacterized protein	0.85	710-730	KKSIKSNRKRDESDRKPRPRS
UP000006174	Ustilago hordei	I2G0B5	Uncharacterized protein	0.778	143-150	KRSRKPRK
UP000006174	Ustilago hordei	I2G2Y4	Uncharacterized protein	0.636	394-399	SRRASK
UP000006174	Ustilago hordei	I2G2Y4	Uncharacterized protein	0.617	386-388	PRK
UP000006174	Ustilago hordei	I2G3V9	Uncharacterized protein	0.905	142-151	SKRKRRKAFR
UP000006174	Ustilago hordei	I2G3V9	Uncharacterized protein	0.786	344-352	RKRLKRKHL
UP000006174	Ustilago hordei	I2G5D6	DUF2013 domain-containing protein	0.856	859-875	GGGRRRPPPPPPPPPPP
UP000006174	Ustilago hordei	I2G5X1	Polynucleotide adenylyltransferase	0.936	52-73	VRKGKKRKSDEREDDGRTKKER
UP000006174	Ustilago hordei	I2FLW8	Uncharacterized protein	0.805	151-159	SAPRRRKKL
UP000006174	Ustilago hordei	I2FNR6	Related to RPC34-DNA-directed RNA polymerase III, 34 KD subunit	0.998	339-388	IGGKRKRSSSKSSSRKKSKSSKSSSSKSKSKKSSSRSSSRSRSRSRSRSR
UP000006174	Ustilago hordei	I2FNR6	Related to RPC34-DNA-directed RNA polymerase III, 34 KD subunit	0.958	415-429	RRKSNSKKKRRSNGK
UP000006174	Ustilago hordei	I2FNR6	Related to RPC34-DNA-directed RNA polymerase III, 34 KD subunit	0.956	315-327	KKKSKAKKERKSD
UP000006174	Ustilago hordei	I2FQ92	Uncharacterized protein	0.772	378-392	RHRKPESAEKRQRKA
UP000006174	Ustilago hordei	I2FQ92	Uncharacterized protein	0.658	628-632	RARRR
UP000006174	Ustilago hordei	I2FR88	Uncharacterized protein	0.719	382-392	KKQNKGKGRGK
UP000006174	Ustilago hordei	I2FT57	Uncharacterized protein	0.979	542-558	AIRRRDKARLKRRRGRG
UP000006174	Ustilago hordei	I2FUF6	Related to SPN1-Spt6-interacting putative elongation factor	0.962	126-136	RKKKKKRHHSP
UP000006174	Ustilago hordei	I2FUF6	Related to SPN1-Spt6-interacting putative elongation factor	0.922	182-192	RAGKKKAPRKR
UP000006174	Ustilago hordei	I2FYR1	Ribonucloprotein	0.964	80-113	MSKKLFKLTKKASKSRGHVKRGVKEVVKALRKGE
UP000006174	Ustilago hordei	I2FYR1	Ribonucloprotein	0.835	7-15	KKEKKSKRK
UP000006174	Ustilago hordei	I2FYR1	Ribonucloprotein	0.808	34-44	SSKKDKKEKKI
UP000006174	Ustilago hordei	I2FZR7	Protein kinase domain-containing protein	0.619	519-524	KGAIKR
UP000006174	Ustilago hordei	I2FZR7	Protein kinase domain-containing protein	0.608	104-105	RK
UP000006174	Ustilago hordei	I2G2I6	Zn(2)-C6 fungal-type domain-containing protein	0.874	53-64	DPRIPRGRKRPK
UP000006174	Ustilago hordei	I2G4L6	Zn(2)-C6 fungal-type domain-containing protein	0.879	738-749	AEKSRKKRQRLR
UP000006174	Ustilago hordei	I2G582	ELYS domain-containing protein	0.802	874-891	VKRRTRRTAAGGKGSVRR
UP000006174	Ustilago hordei	I2G582	ELYS domain-containing protein	0.678	917-927	KRRGGAGGRRT
UP000006174	Ustilago hordei	I2G582	ELYS domain-containing protein	0.669	747-755	RRTRKAASP
UP000006174	Ustilago hordei	I2G5H0	Protein kinase domain-containing protein	0.98	286-316	EDRTSKKKDKKPSSKSHPTRSRTKEAPKPNF
UP000006174	Ustilago hordei	I2FLW9	WD_REPEATS_REGION domain-containing protein	0.877	533-546	KRRKLAKARKDERT
UP000006174	Ustilago hordei	I2FLW9	WD_REPEATS_REGION domain-containing protein	0.643	19-24	VKKGPA
UP000006174	Ustilago hordei	I2FMT4	Related to Serine/threonine-protein kinase CBK1	0.811	1050-1060	RRRLKHKKSAR
UP000006174	Ustilago hordei	I2FPL5	60S ribosomal export protein NMD3	0.909	407-422	PERKKRSKNRTWKLKS
UP000006174	Ustilago hordei	I2FPL5	60S ribosomal export protein NMD3	0.628	485-489	KRLRK
UP000006174	Ustilago hordei	I2FPM4	JmjC domain-containing protein	0.669	124-131	KPATPRKK
UP000006174	Ustilago hordei	I2FPP2	Related to SRP40-serine-rich protein with a role in pre-ribosome assembly or transport	0.738	968-977	QRQRHRHRRR
UP000006174	Ustilago hordei	I2FQ19	PLD phosphodiesterase domain-containing protein	0.947	212-225	QKRRKRRALEARRK
UP000006174	Ustilago hordei	I2FRW6	ERCC4 domain-containing protein	0.844	415-450	SKAAKAAAAKQAREQKAIEREAAKAHKLRLATEKKK
UP000006174	Ustilago hordei	I2FS16	Uncharacterized protein	0.877	30-37	KKKKKRGR
UP000006174	Ustilago hordei	I2FTI3	Related to SPT23-suppressor of TY retrotransposon	0.92	435-447	RERKRAHRKKDPK
UP000006174	Ustilago hordei	I2FTI3	Related to SPT23-suppressor of TY retrotransposon	0.716	632-648	KQRKERSKPYDGNRRRR
UP000006174	Ustilago hordei	I2FU75	JmjC domain-containing protein	0.918	283-319	RWRRKARLRIKREIDERAAADAGEGSRDKSQRKGKAK
UP000006174	Ustilago hordei	I2FUN2	DNA-directed RNA polymerase subunit	0.783	338-352	KSVRARLKGKEGRLR
UP000006174	Ustilago hordei	I2FV78	Aspartate--tRNA ligase	0.956	41-62	KKKRAAKAEKERIKAEKATKLA
UP000006174	Ustilago hordei	I2FW81	H/ACA ribonucleoprotein complex subunit CBF5	0.998	455-493	ERKKRKKEKKEKKAEAAAAGIETPKSEKKKKDKKDKKDK
UP000006174	Ustilago hordei	I2FX37	Related to NMD2-Nonsense-mediated mRNA decay protein 2	0.723	955-961	KRRRAKG
UP000006174	Ustilago hordei	I2G0D1	Uncharacterized protein	0.833	193-212	RPQKQKHRSAHGLRGRLRRR
UP000006174	Ustilago hordei	I2G0D1	Uncharacterized protein	0.815	310-316	KSRKRKK
UP000006174	Ustilago hordei	I2G0D1	Uncharacterized protein	0.665	764-772	SRLRPKWGR
UP000006174	Ustilago hordei	I2G233	Abhydrolase_3 domain-containing protein	0.996	170-208	AASKKAAQTRRRRRNKRHERARSEIRAMRQKTESAIKRR
UP000006174	Ustilago hordei	I2G2D7	Uncharacterized protein	0.833	838-849	KRRRRHGDSRRR
UP000006174	Ustilago hordei	I2G2S9	Probable BUD23-Protein involved in bud-site selection	0.999	237-298	RNGVKYEKRRLDREGRKGGKKGKKRGGETAKEYILRKKELNRKRGKEDVPLDSKYTGRRRKA
UP000006174	Ustilago hordei	I2G5H4	Probable MADS-box homolog Umc1	0.988	81-111	GKGKGKKGKRSHTEAKGERDLKTGRRKIKIE
UP000006174	Ustilago hordei	I2G5H4	Probable MADS-box homolog Umc1	0.814	264-273	KRGRGRPRKN
UP000006174	Ustilago hordei	I2G5H4	Probable MADS-box homolog Umc1	0.612	125-127	KRK
UP000006174	Ustilago hordei	I2G5N4	Related to ubiquitin carboxyl-terminal hydrolase 36	0.879	682-692	KKEKRKQKKAA
UP000006174	Ustilago hordei	I2G5N4	Related to ubiquitin carboxyl-terminal hydrolase 36	0.869	720-732	KEQKKKSKKDQKA
UP000006174	Ustilago hordei	I2FN04	Zn(2)-C6 fungal-type domain-containing protein	0.968	612-625	KGKAKAKAKAKRRS
UP000006174	Ustilago hordei	I2FPD0	Uncharacterized protein	0.992	459-482	KDRKRAKRKGVQRRVDKTKRKRSK
UP000006174	Ustilago hordei	I2FPD0	Uncharacterized protein	0.936	160-177	KREAKAAKKSQRSAKRKA
UP000006174	Ustilago hordei	I2FPQ5	Uncharacterized protein	0.938	213-263	NKRSQSPQERKRRRLTATERRTIAGKGKGDSPTQSPKGSPSRRRSSSSKST
UP000006174	Ustilago hordei	I2FPQ5	Uncharacterized protein	0.708	1027-1033	GRRGKKK
UP000006174	Ustilago hordei	I2FPQ5	Uncharacterized protein	0.679	758-766	GRPRKVSLR
UP000006174	Ustilago hordei	I2FPQ5	Uncharacterized protein	0.631	267-274	KPGSIRRR
UP000006174	Ustilago hordei	I2FQM1	Probable CDC40-Pre-mRNA splicing factor important for catalytic step II	0.685	69-73	KRKKK
UP000006174	Ustilago hordei	I2FR82	Rho-GAP domain-containing protein	0.949	1085-1103	KEKVEKKKKVAPPKPAKPA
UP000006174	Ustilago hordei	I2FSC0	Actin cytoskeleton-regulatory complex protein SLA1	0.983	652-679	ERERERERRKEKEREQRRREQSKSGPKR
UP000006174	Ustilago hordei	I2FSC0	Actin cytoskeleton-regulatory complex protein SLA1	0.782	208-213	KKKKKK
UP000006174	Ustilago hordei	I2FT22	tRNA (guanine(9)-N1)-methyltransferase	0.99	28-67	PPGISKNAAKKLARKQKLEATKHERRAAERLKKKENKRAR
UP000006174	Ustilago hordei	I2FT22	tRNA (guanine(9)-N1)-methyltransferase	0.881	402-423	KALPRRKLKQRGPVAKPVGEKK
UP000006174	Ustilago hordei	I2FT22	tRNA (guanine(9)-N1)-methyltransferase	0.731	110-115	NKKRKA
UP000006174	Ustilago hordei	I2FTE0	Non-specific serine/threonine protein kinase	0.777	1003-1010	RRRRRKVD
UP000006174	Ustilago hordei	I2FWZ4	Valyl-tRNA synthetase	0.881	96-137	KKAAKLAEKQAKQAAKDALKSDKPAQNAPGTAAAKKEKPKKE
UP000006174	Ustilago hordei	I2FXE1	TAFII28 domain-containing protein	0.993	137-163	AKTKKPTKPKTEGGAETKPKKPKKKPA
UP000006174	Ustilago hordei	I2FXE1	TAFII28 domain-containing protein	0.984	185-209	PPKPKKPAKKKAADKDNAKIASKGP
UP000006174	Ustilago hordei	I2FXE1	TAFII28 domain-containing protein	0.979	225-251	SPSKETKSKSKKAGGPKAGGKAASKAR
UP000006174	Ustilago hordei	I2FXP3	Related to 50S ribosomal protein L34	0.99	107-141	RIRKRRHGFLARIKTKNGKKTITRRRFRGKAKLSH
UP000006174	Ustilago hordei	I2FY29	Beta-galactosidase	0.63	1009-1013	RGRGR
UP000006174	Ustilago hordei	I2FZZ4	26S proteasome regulatory subunit RPN1	0.864	24-47	EKKKEKQREEAARKGLPPFNEKRA
UP000006174	Ustilago hordei	I2G139	Cep57_MT_bd domain-containing protein	0.614	910-914	RKASR
UP000006174	Ustilago hordei	I2G1R0	Uncharacterized protein	0.916	50-62	RKSRKKSKSEKRT
UP000006174	Ustilago hordei	I2G2H0	Vesicle-fusing ATPase	0.76	367-375	APAKRKKQQ
UP000006174	Ustilago hordei	I2G3S0	Related to choline-phosphate cytidylyltransferase	0.646	219-221	RKK
UP000006174	Ustilago hordei	I2G4A2	2OG-FeII_Oxy_2 domain-containing protein	0.76	539-547	KSVGKRKRK
UP000006174	Ustilago hordei	I2G4B5	Homeobox domain-containing protein	0.709	855-868	KKIATAAPAPKRRK
UP000006174	Ustilago hordei	I2G630	Related to SAL1-member of the Ca2+-binding subfamily of the mitochondrial carrier family	0.63	554-559	AKRVEK
UP000006174	Ustilago hordei	I2G630	Related to SAL1-member of the Ca2+-binding subfamily of the mitochondrial carrier family	0.606	371-372	KR
UP000006174	Ustilago hordei	I2G6C9	Related to Diaphanous protein homolog 1	0.867	1577-1591	PKPPSLPLIPKKKRK
UP000006174	Ustilago hordei	I2G6C9	Related to Diaphanous protein homolog 1	0.663	1536-1556	PPPARPSGAAGGAPPPPPPPP
UP000006174	Ustilago hordei	I2FNY5	DNA polymerase	0.984	102-118	GKRKPKKGTKARSKLKG
UP000006174	Ustilago hordei	I2FNY5	DNA polymerase	0.703	795-803	RFRRPKWPK
UP000006174	Ustilago hordei	I2FRM0	Related to NUG1-Nuclear GTPase (Involved in Ribosome biogenesis)	0.967	659-672	ARRKLKKLKKRADK
UP000006174	Ustilago hordei	I2FRM0	Related to NUG1-Nuclear GTPase (Involved in Ribosome biogenesis)	0.656	720-725	KKNKGG
UP000006174	Ustilago hordei	I2FRS2	Pre-mRNA-splicing factor CWC24	0.87	355-367	EKAKKRKAQAKAE
UP000006174	Ustilago hordei	I2FTN5	BHLH domain-containing protein	0.988	110-125	GKPKRKRNRKRPDTKK
UP000006174	Ustilago hordei	I2FTZ9	Uncharacterized protein	0.998	563-604	PKTKAPANKAAAKPKPASKAKALPKPKAPPKLKEPKAKGKKA
UP000006174	Ustilago hordei	I2FTZ9	Uncharacterized protein	0.988	653-669	PKPKKARRAPARPRKKA
UP000006174	Ustilago hordei	I2FTZ9	Uncharacterized protein	0.983	721-744	SKGKSKAAAKPRAPSKAKAKAKAA
UP000006174	Ustilago hordei	I2FTZ9	Uncharacterized protein	0.952	764-780	KPKPAAKRAAAKKAKGP
UP000006174	Ustilago hordei	I2FV90	Related to cell cycle control protein cwf25	0.993	172-277	KGSKEEKRRRKEEKRRRHDDDDGHKRRRYGDDDRDSDRRHRSRHSDSRGDSHSHRHGEDRDGKSRDRDRSPRRDGESSSHRRHHDEHRSSRRHHDSERCRRERARP
UP000006174	Ustilago hordei	I2FVF3	UDG domain-containing protein	0.974	126-141	PKKNGTKKPRKKIRRT
UP000006174	Ustilago hordei	I2FWK5	Related to KOG1-Subunit of TORC1, a rapamycin-sensitive complex involved in growth control	0.631	579-583	KGRRR
UP000006174	Ustilago hordei	I2FX46	Related to nitrogen assimilation transcription factor	0.945	69-90	PKKRGPPKGSTRGGSKTAKRKA
UP000006174	Ustilago hordei	I2FXA0	Uncharacterized protein	0.945	251-273	RRLKAKNRKGWPSERERLRKWRR
UP000006174	Ustilago hordei	I2FXA0	Uncharacterized protein	0.786	171-186	KPRSRPPASAAKAKSK
UP000006174	Ustilago hordei	I2FXA0	Uncharacterized protein	0.764	140-148	PAKKRGRSS
UP000006174	Ustilago hordei	I2FXI0	Endo/exonuclease/phosphatase domain-containing protein	0.981	15-45	PKKGKKDNRPSPEEIEAKRRERAAKKEKAAK
UP000006174	Ustilago hordei	I2FXY9	BAR domain-containing protein	0.72	336-345	REKEKNKKSR
UP000006174	Ustilago hordei	I2FYW9	zf-C2HC5 domain-containing protein	0.875	164-175	KGKKGKHGRAKA
UP000006174	Ustilago hordei	I2G3P9	Uncharacterized protein	0.792	70-87	RARRAEAARRAKVAAARR
UP000006174	Ustilago hordei	I2G3P9	Uncharacterized protein	0.667	354-362	RGRSRSPKR
UP000006174	Ustilago hordei	I2G3Z5	Related to MNR2-Manganese resistance protein	0.998	529-576	KKATGRRQNKKARQAAKRAKKREEELIRQGRLPPKPSRSARAKALRAK
UP000006174	Ustilago hordei	I2G3Z5	Related to MNR2-Manganese resistance protein	0.996	349-379	RTRRRTQRGRRSRASRRSRSRRGSRSSRGSR
UP000006174	Ustilago hordei	I2G3Z5	Related to MNR2-Manganese resistance protein	0.987	223-246	KSKEARRAARREARRAERRARRER
UP000006174	Ustilago hordei	I2G3Z5	Related to MNR2-Manganese resistance protein	0.962	469-493	SRRSSRRLSLSGKRAKSRRSRGTRS
UP000006174	Ustilago hordei	I2G3Z5	Related to MNR2-Manganese resistance protein	0.869	665-692	RHHRHAAKAAAEKASHHRAKRAQARDAK
UP000006174	Ustilago hordei	I2G3Z5	Related to MNR2-Manganese resistance protein	0.812	1430-1440	KRGVAKRRAAR
UP000006174	Ustilago hordei	I2G3Z5	Related to MNR2-Manganese resistance protein	0.806	307-314	GRKPKRKL
UP000006174	Ustilago hordei	I2G4X2	Uncharacterized protein	0.967	474-494	GAKKRRQARRSRTAKIRGGPA
UP000006174	Ustilago hordei	I2G4X2	Uncharacterized protein	0.626	184-187	KAKK
UP000006174	Ustilago hordei	I2G5F5	Uncharacterized protein	0.976	298-308	RPKKKKKKIKQ
UP000006174	Ustilago hordei	I2G5F5	Uncharacterized protein	0.678	233-240	ASKRARAA
UP000006174	Ustilago hordei	I2G5P6	Related to diadenosine hexaphosphate (Ap6A) hydrolase (Fragment)	0.702	14-21	RPKKEGKK
UP000006174	Ustilago hordei	I2G692	Uncharacterized protein	0.997	523-536	RRRRRRKKKRAAKL
UP000006174	Ustilago hordei	I2FM42	Uncharacterized protein	0.863	120-131	RRRKGGNRKAKN
UP000006174	Ustilago hordei	I2FNL5	Uncharacterized protein	0.888	1118-1140	KKAARNKAVAEKRKATKETKAAA
UP000006174	Ustilago hordei	I2FNL5	Uncharacterized protein	0.856	17-26	RKKRRSRGGR
UP000006174	Ustilago hordei	I2FNL5	Uncharacterized protein	0.789	393-402	AKKQRGRPKK
UP000006174	Ustilago hordei	I2FNL5	Uncharacterized protein	0.634	633-638	KKKLGR
UP000006174	Ustilago hordei	I2FNL5	Uncharacterized protein	0.609	549-550	GR
UP000006174	Ustilago hordei	I2FNL5	Uncharacterized protein	0.6	669-669	K
UP000006174	Ustilago hordei	I2FNU6	Zn(2)-C6 fungal-type domain-containing protein	0.671	713-726	PKRGRSTDAAKRNE
UP000006174	Ustilago hordei	I2FNU6	Zn(2)-C6 fungal-type domain-containing protein	0.631	729-734	AKASKR
UP000006174	Ustilago hordei	I2FPB2	Protein-tyrosine-phosphatase	0.653	1015-1021	GRVRRGR
UP000006174	Ustilago hordei	I2FR67	ERF-3	0.829	664-678	KTGKKSRRGPQFAKK
UP000006174	Ustilago hordei	I2FRH7	Uncharacterized protein	0.813	88-97	HKRGRKPGKI
UP000006174	Ustilago hordei	I2FSC8	Uncharacterized protein	0.757	562-569	KTKRRKAK
UP000006174	Ustilago hordei	I2FV23	DUF1713 domain-containing protein	0.999	426-454	RRKRRKKIRKHKYKKLRKTQRAERQKMKK
UP000006174	Ustilago hordei	I2FX69	Zn(2)-C6 fungal-type domain-containing protein	0.639	183-191	GPPKGFRSS
UP000006174	Ustilago hordei	I2FXG3	Related to atp-dependent clp protease, atp-binding subunit	0.999	886-921	KAHAKKQAAKKGKGEKEKKPEGKGKEKGGKKRKGSK
UP000006174	Ustilago hordei	I2FXZ3	Uncharacterized protein	0.957	265-287	FKPRPSKAKKDRGPSAAKPGEGR
UP000006174	Ustilago hordei	I2FZK1	Uncharacterized protein	0.735	1604-1609	KSKKKR
UP000006174	Ustilago hordei	I2G0I3	Serine/threonine-protein phosphatase	0.89	320-331	PPRKQKKKSDGK
UP000006174	Ustilago hordei	I2G0Q9	Condensin complex subunit 1	0.97	563-584	ARSRKSKVKKEIVKPKAKEGRR
UP000006174	Ustilago hordei	I2G0Q9	Condensin complex subunit 1	0.871	1369-1400	KMTKGRGGRGKTSGAAASAGGGAKRGTRGSRR
UP000006174	Ustilago hordei	I2G143	Related to zinc finger protein white collar 2 (Wc-2)	0.718	751-756	RRKKKP
UP000006174	Ustilago hordei	I2G143	Related to zinc finger protein white collar 2 (Wc-2)	0.625	797-800	KIKR
UP000006174	Ustilago hordei	I2G345	Related to Serine/threonine-protein kinase	0.765	404-415	RRREKEREKARK
UP000006174	Ustilago hordei	I2G382	Zn(2)-C6 fungal-type domain-containing protein	0.812	91-100	RKPRGPKGKK
UP000006174	Ustilago hordei	I2G506	Uncharacterized protein	0.879	266-273	IAKKKKKK
UP000006174	Ustilago hordei	I2G6K3	Fork-head domain-containing protein	0.993	1358-1373	KKHNKPKRNKPKRKKT
UP000006174	Ustilago hordei	I2G6K3	Fork-head domain-containing protein	0.983	348-366	RRRLKLKKHKWRLRRERER
UP000006174	Ustilago hordei	I2G6K3	Fork-head domain-containing protein	0.683	1027-1031	KKGKK
UP000006174	Ustilago hordei	I2G6K3	Fork-head domain-containing protein	0.681	1391-1397	RRRSAKK
UP000006174	Ustilago hordei	I2G6X9	Uncharacterized protein	0.961	47-71	KKRRRGEARKFGVIHRGGPRAKMGK
UP000006174	Ustilago hordei	I2G6X9	Uncharacterized protein	0.924	109-123	VSKKGETRRKKKVAA
UP000006174	Ustilago hordei	I2FNX1	Uncharacterized protein	0.887	105-116	SKKNKKKNKTVK
UP000006174	Ustilago hordei	I2FNX1	Uncharacterized protein	0.865	47-68	KNKNKKKTKDAASAPAPAPEKK
UP000006174	Ustilago hordei	I2FPZ9	Flavin_Reduct domain-containing protein	0.773	30-44	RPRRSLRPARQARRR
UP000006174	Ustilago hordei	I2FQC7	Uncharacterized protein	0.667	230-235	LRKKIS
UP000006174	Ustilago hordei	I2FQC7	Uncharacterized protein	0.607	239-239	K
UP000006174	Ustilago hordei	I2FQC9	Protein kinase domain-containing protein	0.682	117-123	KRGRRRR
UP000006174	Ustilago hordei	I2FQC9	Protein kinase domain-containing protein	0.682	742-748	KKSGKKS
UP000006174	Ustilago hordei	I2FR33	NUC153 domain-containing protein	0.891	41-50	GSSNKRKKRK
UP000006174	Ustilago hordei	I2FR33	NUC153 domain-containing protein	0.887	733-759	RGNKKRSFEDRLKSKEGRGPASGRRPR
UP000006174	Ustilago hordei	I2FR33	NUC153 domain-containing protein	0.69	836-843	QKRRHPNR
UP000006174	Ustilago hordei	I2FW02	Transcription factor BYE1	0.984	260-293	KKARRKVSESMRRPRASSKPSSGPKKGSPRKAAG
UP000006174	Ustilago hordei	I2FW02	Transcription factor BYE1	0.966	1064-1089	GGGGRGYGHGRGGGKGRGGRGRSRGW
UP000006174	Ustilago hordei	I2FW70	DNA damage-binding protein CMR1	0.948	36-63	GRSPKRSTPTKPKKAAAPSKKADNTPIR
UP000006174	Ustilago hordei	I2FW70	DNA damage-binding protein CMR1	0.643	152-157	RRRAGK
UP000006174	Ustilago hordei	I2FWE8	Probable ribosomal protein L35	0.911	75-109	KGKKHLPLDLRSKKTRAIRRKLNQHERTRITERQH
UP000006174	Ustilago hordei	I2FXQ7	Zn(2)-C6 fungal-type domain-containing protein	0.772	633-639	RKKPKRP
UP000006174	Ustilago hordei	I2G0S4	Uncharacterized protein	0.805	155-164	RVWRQKKRKR
UP000006174	Ustilago hordei	I2G5A2	Related to nuclear GTPase	0.999	4-48	VKKRASKRLKLAQREKVKKKVKEHRRKTRRDERRSTQWKSKAKKD
UP000006174	Ustilago hordei	I2G5A2	Related to nuclear GTPase	0.913	593-620	RKERRVQKKARVVVPSKSKPAAKRNGTK
UP000006174	Ustilago hordei	I2G5A2	Related to nuclear GTPase	0.715	558-568	KSILKKGGSKK
UP000006174	Ustilago hordei	I2G5A2	Related to nuclear GTPase	0.611	396-397	RR
UP000006174	Ustilago hordei	I2G6Y3	Conserved uncharacterized protein (N-terminal) (Fragment)	0.609	519-520	KP
UP000006174	Ustilago hordei	I2FMV7	Related to RDS2-Regulator of drug sensitivity	0.826	73-82	RKNKPSKRRK
UP000006174	Ustilago hordei	I2FNS7	Protein kinase domain-containing protein	0.909	931-959	KKAELERKRNERRLRLEQLKKEKEAARQR
UP000006174	Ustilago hordei	I2FNS7	Protein kinase domain-containing protein	0.844	775-795	KKKAPTVGKTKMAKAKLGPRR
UP000006174	Ustilago hordei	I2FQF1	Related to Peregrin (Bromodomain and PHD finger-containing protein 1)	0.774	813-823	AQKTARKRKTL
UP000006174	Ustilago hordei	I2FR57	Glyco_hydro_cc domain-containing protein	0.807	40-65	HRRAHNKSCSSKHKPKKVESHLKVPK
UP000006174	Ustilago hordei	I2FRN4	Glutaminyl-tRNA synthetase	0.925	847-873	KKDDNKKDDNKKDDNKKGTAGAKKGGK
UP000006174	Ustilago hordei	I2FRN4	Glutaminyl-tRNA synthetase	0.752	191-201	KKAPPPKEKKP
UP000006174	Ustilago hordei	I2FRN4	Glutaminyl-tRNA synthetase	0.724	367-376	PERGPRKPSR
UP000006174	Ustilago hordei	I2FRR8	C2H2-type domain-containing protein	0.929	183-200	KEREAKREKRRQQRLAKK
UP000006174	Ustilago hordei	I2FS86	Probable transposase	0.699	114-122	KKPKLLKRH
UP000006174	Ustilago hordei	I2FVJ0	Eukaryotic translation initiation factor 2A	0.772	539-547	KEGKKKGGK
UP000006174	Ustilago hordei	I2G0X2	PHD domain-containing protein	0.963	520-546	SRRGRKSKNQPLRVGETPSKRRGRKPK
UP000006174	Ustilago hordei	I2G185	RNA-dependent RNA polymerase	0.714	4-14	KRKHRGQRHER
UP000006174	Ustilago hordei	I2G1W3	Uncharacterized protein	0.82	190-207	SRRAIRERRRSSYTRKKS
UP000006174	Ustilago hordei	I2G1W3	Uncharacterized protein	0.754	627-632	PRKRKR
UP000006174	Ustilago hordei	I2G340	Uncharacterized protein	0.942	673-686	QRLKDKRKKGRAAK
UP000006174	Ustilago hordei	I2G340	Uncharacterized protein	0.623	462-467	QREAKR
UP000006174	Ustilago hordei	I2G4G7	Uncharacterized protein	0.773	560-570	SAARRRSKPPK
UP000006174	Ustilago hordei	I2G6I5	N-acetyltransferase domain-containing protein	0.872	148-167	TPKPKKDKNGKETKPEPVKK
UP000006174	Ustilago hordei	I2FMB0	Ubiquitin	0.831	121-128	LRPKKKLK
UP000006174	Ustilago hordei	I2FMZ7	Probable 40S ribosomal protein S15	0.98	46-70	RARRKFQRGLKRKPMGLIKRLRKAK
UP000006174	Ustilago hordei	I2FPE4	rRNA-processing protein	0.992	32-103	KKLEQRRKQEAIKQREREMKAEKEAEAERKKTVSRERKQMAEEKARLEIMAHKMSAKKLARKKRRLGITKKV
UP000006174	Ustilago hordei	I2FQD5	Actin cytoskeleton-regulatory complex protein PAN1	0.997	1609-1639	LSRPRTAKRPSKPEEPQRRKPPHRPRKRPSR
UP000006174	Ustilago hordei	I2FQD5	Actin cytoskeleton-regulatory complex protein PAN1	0.786	1589-1602	RRPPPPPGQKRHKN
UP000006174	Ustilago hordei	I2FQD5	Actin cytoskeleton-regulatory complex protein PAN1	0.628	818-830	KFGKSAAPPPPPP
UP000006174	Ustilago hordei	I2FRJ7	Related to postreplication repair protein uvsH/nuvA	0.98	49-76	NRTPSPRSPNPRSPSRRSPSRRRSKRIK
UP000006174	Ustilago hordei	I2FWA0	Uncharacterized protein	0.96	1779-1791	PKSKRPRRGRKSK
UP000006174	Ustilago hordei	I2FWA0	Uncharacterized protein	0.931	1695-1705	PPKRKRGRARK
UP000006174	Ustilago hordei	I2FWA0	Uncharacterized protein	0.927	1735-1746	SKPRKGRGRKRA
UP000006174	Ustilago hordei	I2FWA0	Uncharacterized protein	0.89	1897-1930	QPRRSRRSQGGSRASSVSPSKTTPRKNAKRKVLK
UP000006174	Ustilago hordei	I2FWA0	Uncharacterized protein	0.683	1861-1867	RRSRKRK
UP000006174	Ustilago hordei	I2G0S2	Anti_prolifrtn domain-containing protein	0.994	558-581	GGRRRLRSRGRRSRGRGAGRAARR
UP000006174	Ustilago hordei	I2G129	Zn(2)-C6 fungal-type domain-containing protein	0.773	971-980	KKEKSGKKSK
UP000006174	Ustilago hordei	I2G2P6	Probable DBP3-putative RNA helicase required for pre-rRNA processing	0.998	41-61	TPASPAKKEKKGKKEKKDKKR
UP000006174	Ustilago hordei	I2G2P6	Probable DBP3-putative RNA helicase required for pre-rRNA processing	0.992	72-90	KAAKKRRKEEKKAKKASAK
UP000006174	Ustilago hordei	I2G2P6	Probable DBP3-putative RNA helicase required for pre-rRNA processing	0.882	15-29	KSLHKKEKKRSAAAA
UP000006174	Ustilago hordei	I2G4E1	Uncharacterized protein	0.863	98-106	RRRKRKPVR
UP000006174	Ustilago hordei	I2G5A6	CAP-Gly domain-containing protein	0.607	502-502	K
UP000006174	Ustilago hordei	I2G5N9	LisH domain-containing protein	0.859	917-931	EKGKKGNARARKNSK
UP000006174	Ustilago hordei	I2G669	Enhancer of polycomb-like protein	0.832	182-194	SGGKGKAKEKLRK
UP000006174	Ustilago hordei	I2G669	Enhancer of polycomb-like protein	0.677	461-465	KKKRK
UP000006174	Ustilago hordei	I2G669	Enhancer of polycomb-like protein	0.601	580-580	R
UP000006174	Ustilago hordei	I2FN74	Uncharacterized protein	0.952	135-148	ARRGRRRARKDRPE
UP000006174	Ustilago hordei	I2FN74	Uncharacterized protein	0.604	573-574	RR
UP000006174	Ustilago hordei	I2FN74	Uncharacterized protein	0.603	156-156	R
UP000006174	Ustilago hordei	I2FT34	Homeobox domain-containing protein	0.953	228-244	KKKLSAAFRPRGRKKRN
UP000006174	Ustilago hordei	I2FTH3	Uncharacterized protein	0.619	741-743	RRR
UP000006174	Ustilago hordei	I2FTV7	Uncharacterized protein	0.975	636-662	GGKKDGQASPAKKGGRGHRGKGNRHNK
UP000006174	Ustilago hordei	I2FTV7	Uncharacterized protein	0.777	189-195	RKRKSKR
UP000006174	Ustilago hordei	I2FVB7	Uncharacterized protein	0.632	16-20	KRSKR
UP000006174	Ustilago hordei	I2FVS3	Uncharacterized protein	1	168-197	PRKKSKKEKKEKKEKKEKKGKKEKKKVKSE
UP000006174	Ustilago hordei	I2FY82	Fip1 domain-containing protein	0.983	709-758	HKRKSGSSREHHRDSHRSDRDREREKEKEREKEREREARSQARSERRAGR
UP000006174	Ustilago hordei	I2FY82	Fip1 domain-containing protein	0.964	778-819	GGRGSRKRSAPEDRDREGDADGPPPAKTSSRSGKSGGSRKKR
UP000006174	Ustilago hordei	I2FY82	Fip1 domain-containing protein	0.627	647-651	RRGGR
UP000006174	Ustilago hordei	I2FYQ1	rRNA adenine N(6)-methyltransferase	0.863	129-153	EKTGKPGRRKNSQLSEKGAARLAKK
UP000006174	Ustilago hordei	I2FYQ1	rRNA adenine N(6)-methyltransferase	0.84	75-83	PVKPKRKRR
UP000006174	Ustilago hordei	I2G068	Uncharacterized protein	0.923	190-209	KRGKKANAKNKKALAAVKGK
UP000006174	Ustilago hordei	I2G1N0	Uncharacterized protein	0.73	301-315	KHPLRPLKSIRRPSK
UP000006174	Ustilago hordei	I2G2M2	BUD22 domain-containing protein	0.981	457-536	SGSKKERRNRMGQRARKALYEKKYGKNANHIKMREKQKAVKRERSSTRASGVRGGGGDGNGRQRPPAFQAPAKRDGGWGG
UP000006174	Ustilago hordei	I2G2M2	BUD22 domain-containing protein	0.816	396-406	RPRKRKSKTST
UP000006174	Ustilago hordei	I2G2M2	BUD22 domain-containing protein	0.629	8-11	KGRK
UP000006174	Ustilago hordei	I2G2M2	BUD22 domain-containing protein	0.607	543-543	K
UP000006174	Ustilago hordei	I2G3G0	Related to SCJ1 protein	0.631	61-63	RKR
UP000006174	Ustilago hordei	I2G454	Uncharacterized protein	0.864	34-53	KEEEAARKAAVAKMNGGKKK
UP000006174	Ustilago hordei	I2G454	Uncharacterized protein	0.764	7-17	GKAKPLKAPKK
UP000006174	Ustilago hordei	I2G548	BTP domain-containing protein	0.603	754-758	RAPGR
UP000006174	Ustilago hordei	I2G5A7	Expansin-like EG45 domain-containing protein	0.816	78-91	KKDKKKGKCALKKQ
UP000006174	Ustilago hordei	I2G643	Uncharacterized protein	0.857	466-483	RRSRRRRAPSEHGDKPGK
UP000006174	Ustilago hordei	I2G643	Uncharacterized protein	0.831	546-592	NPPRGKNRDKPRFEPFPQAPPHMWKSEKKEKTERGPMDEALKKQRKI
UP000006174	Ustilago hordei	I2G667	Related to SAS10-involved in silencing	0.997	468-488	KKEKKKADKSKKKEGKAKKAG
UP000006174	Ustilago hordei	I2G667	Related to SAS10-involved in silencing	0.995	722-753	NKGLTPHRPKISRNPRVKKRLKYEKAKKKLGS
UP000006174	Ustilago hordei	I2G667	Related to SAS10-involved in silencing	0.914	433-444	VKSKKSAKKAKK
UP000006174	Ustilago hordei	I2FNU9	Ubiquinone biosynthesis protein COQ4, mitochondrial	0.714	336-344	ARNSGKRRG
UP000006174	Ustilago hordei	I2FNY7	Protein OS-9 homolog	0.951	639-652	KQKKEKQKKGKGKG
UP000006174	Ustilago hordei	I2FNY7	Protein OS-9 homolog	0.868	673-696	KEIKGSGKVKQGKGAAGKQPRPLR
UP000006174	Ustilago hordei	I2FNY7	Protein OS-9 homolog	0.628	208-211	KKAG
UP000006174	Ustilago hordei	I2FPM7	HTH APSES-type domain-containing protein	0.917	181-194	PKKRGRPRKTAETP
UP000006174	Ustilago hordei	I2FPM7	HTH APSES-type domain-containing protein	0.692	44-50	RKSKKEK
UP000006174	Ustilago hordei	I2FQ42	RRM domain-containing protein	0.941	430-454	REKERQEELKAKKDKAKAEKDKKDK
UP000006174	Ustilago hordei	I2FQG2	Related to CSR1-phosphatidylinositol transfer protein	0.979	484-529	AKGRKPSDAASVKSGKKSKKGEAAAAAAGAGAGAAGVKRSKSKKKQ
UP000006174	Ustilago hordei	I2FQG2	Related to CSR1-phosphatidylinositol transfer protein	0.758	558-578	RARRSPSANKSLNRKPSRAAK
UP000006174	Ustilago hordei	I2FQS9	Related to EBP2-required for pre-rRNA processing and ribosomal subunit assembly	0.996	560-599	RGARGSKPLKGKPTSGKAGFRPKQKSGAAKRPGKARRAGH
UP000006174	Ustilago hordei	I2FQS9	Related to EBP2-required for pre-rRNA processing and ribosomal subunit assembly	0.88	443-472	AKKQRELKKFGKKVQVEKLQERIRNKKEMN
UP000006174	Ustilago hordei	I2FQS9	Related to EBP2-required for pre-rRNA processing and ribosomal subunit assembly	0.833	508-541	KKQVNGKGGRESTNKAKMPRSARDAKYGFGGKKK
UP000006174	Ustilago hordei	I2FQS9	Related to EBP2-required for pre-rRNA processing and ribosomal subunit assembly	0.721	46-64	KTPSPLKKGGSTPKASSKK
UP000006174	Ustilago hordei	I2FR78	Uncharacterized protein	0.99	309-323	KKPKTKKRKKAAKAK
UP000006174	Ustilago hordei	I2FR78	Uncharacterized protein	0.966	690-713	GKKPGTKKMEKRLKKIEDEKKRER
UP000006174	Ustilago hordei	I2FR78	Uncharacterized protein	0.784	129-140	SKKRAKEHAARR
UP000006174	Ustilago hordei	I2FR78	Uncharacterized protein	0.741	767-779	LKKTQPKAAKSKK
UP000006174	Ustilago hordei	I2FR78	Uncharacterized protein	0.689	80-93	RLAKAQAKRDAARR
UP000006174	Ustilago hordei	I2FRL7	Related to ECM14-involved in cell wall biogenesis and architecture	1	313-332	KKKKNRKGKKGKKGKKGKKH
UP000006174	Ustilago hordei	I2FRL8	Related to UTP13-U3 snoRNP protein	0.875	203-214	KGKKPKSKNKSN
UP000006174	Ustilago hordei	I2FRL8	Related to UTP13-U3 snoRNP protein	0.703	896-903	SRRGGKKG
UP000006174	Ustilago hordei	I2FS34	TFIIB-type domain-containing protein	0.787	622-630	GRGGKKRPK
UP000006174	Ustilago hordei	I2FSI0	Zn(2)-C6 fungal-type domain-containing protein	0.718	866-875	RRRREGKSGK
UP000006174	Ustilago hordei	I2FT11	Related to CKI1-choline kinase	0.637	584-589	WRRLKR
UP000006174	Ustilago hordei	I2FT11	Related to CKI1-choline kinase	0.62	574-578	KSPRG
UP000006174	Ustilago hordei	I2FV33	Zn(2)-C6 fungal-type domain-containing protein	0.997	152-200	AVNKRKRSASPKGKGKKANAGKTANGDKANGGKDAKGGTPGKKQKPTRG
UP000006174	Ustilago hordei	I2FV33	Zn(2)-C6 fungal-type domain-containing protein	0.948	800-823	KKRRRLTLAAKKAAVKDKGKGKGT
UP000006174	Ustilago hordei	I2FV69	Related to meiotic recombination protein SPO11	0.616	58-60	KRR
UP000006174	Ustilago hordei	I2FWU1	Uncharacterized protein	0.967	311-323	ERKDRRKRRRTKA
UP000006174	Ustilago hordei	I2FZT1	Probable Ubiquitin-conjugating enzyme E2	0.808	14-20	AKKKKPK
UP000006174	Ustilago hordei	I2FZU9	Uncharacterized protein	0.862	175-182	KKKKKHRR
UP000006174	Ustilago hordei	I2FZZ0	Uncharacterized protein	0.998	63-152	KKGAPSPKKWAVEKGERKDPSEPVGTPKTKKGGDEKAKDEPSEESGSKRKASTKAEDGGKEKATKAKKPKTQPKPAAKGTREQPKRSANK
UP000006174	Ustilago hordei	I2G0E4	Uncharacterized protein	0.787	243-254	RRHREEKKRERE
UP000006174	Ustilago hordei	I2G0E4	Uncharacterized protein	0.608	59-60	KR
UP000006174	Ustilago hordei	I2G103	Uncharacterized protein	0.749	768-775	KSRKGRKR
UP000006174	Ustilago hordei	I2G3F9	Zn(2)-C6 fungal-type domain-containing protein	0.76	88-97	KGTKRKAKYI
UP000006174	Ustilago hordei	I2G4V0	PHD-type domain-containing protein	0.985	520-534	PKKSKKKKGSSKKSK
UP000006174	Ustilago hordei	I2G4V0	PHD-type domain-containing protein	0.795	143-151	PPPAKKKKT
UP000006174	Ustilago hordei	I2G4V0	PHD-type domain-containing protein	0.605	662-662	K
UP000006174	Ustilago hordei	I2FPA9	Prolyl-tRNA synthetase	0.698	40-46	KPKHRRK
UP000006174	Ustilago hordei	I2FPR9	GATA-type domain-containing protein	0.918	391-406	RRRLAGKGMKRVRKRK
UP000006174	Ustilago hordei	I2FQ71	Uncharacterized protein	0.994	551-611	PAPHNPSHKAKSGSGPKRHGHHKHGHKHSHHHKHGHKHSHHHQHGHKHSHHRIHSKKAPSH
UP000006174	Ustilago hordei	I2FQ71	Uncharacterized protein	0.906	242-249	ARRRKRKR
UP000006174	Ustilago hordei	I2FS45	Related to dipeptidyl aminopeptidase B	0.807	1052-1061	GKREKGKKNR
UP000006174	Ustilago hordei	I2FS55	Ribosome biogenesis protein NOP53	0.916	320-348	KRKTRQQRARAKRTRQQQLEAAARKKARI
UP000006174	Ustilago hordei	I2FS55	Ribosome biogenesis protein NOP53	0.616	24-26	GKK
UP000006174	Ustilago hordei	I2FSD3	Related to MPD1-Disulfide isomerase related protein	0.819	264-280	SGKVKKPSVKVIPKKKA
UP000006174	Ustilago hordei	I2FTD2	Non-specific serine/threonine protein kinase	0.694	208-219	KLGKKASAARLR
UP000006174	Ustilago hordei	I2FTE2	Mediator of RNA polymerase II transcription subunit 1	0.969	1090-1107	KASKKVKPASPSKKKGKK
UP000006174	Ustilago hordei	I2FTF4	40S ribosomal protein S1	0.897	5-18	KNKKLSKGKGNKKR
UP000006174	Ustilago hordei	I2FWA8	Exocyst complex component SEC5	0.628	877-881	PRKEK
UP000006174	Ustilago hordei	I2FWG4	Telomerase reverse transcriptase	0.99	1245-1264	KAGKRKRADGRRWGKRKRAA
UP000006174	Ustilago hordei	I2FXH9	Vacuolar import and degradation protein 21	0.944	1086-1134	KKSDGKDDAASSKREKLNKKLSSKYDGSKRKLRRSNLMEVMRKSAKRRE
UP000006174	Ustilago hordei	I2FZX9	Complex I-B14.7	0.771	163-179	REAREARRRSFFKQKKK
UP000006174	Ustilago hordei	I2G078	DPBB_1 domain-containing protein	0.997	88-120	RARKHRHRKHHRSRKHRSSSSSKSHRRSKHGKH
UP000006174	Ustilago hordei	I2G151	Uncharacterized protein	0.696	183-203	PRRRRVTSIRDRNWERERERE
UP000006174	Ustilago hordei	I2G470	Related to SSK1-two-component signal transducer	0.761	1363-1372	RRGRGPKKAP
UP000006174	Ustilago hordei	I2G4F0	Uncharacterized protein	0.999	52-74	RRKRHEHKAKRKKRNGRQKRSKA
UP000006174	Ustilago hordei	I2G577	Uncharacterized protein	0.996	23-42	GKKNKKHKKDRKDKKDKKSK
UP000006174	Ustilago hordei	I2G577	Uncharacterized protein	0.994	191-225	KRKRGRPKKDPNAPSVKKVKKDPSEGGQRRGRRAK
UP000006174	Ustilago hordei	I2G577	Uncharacterized protein	0.993	65-84	KAARKERKRQKKERKERERL
UP000006174	Ustilago hordei	I2G5R6	DNA-(apurinic or apyrimidinic site) lyase	0.739	567-573	KSRPKRK
UP000006174	Ustilago hordei	I2G5R6	DNA-(apurinic or apyrimidinic site) lyase	0.726	333-340	PAKKRARG
UP000006174	Ustilago hordei	I2G5T7	Probable 60S ribosomal protein L18	0.994	161-192	FGPHKNKKPYIRSKGRKFEKARGRRASRGFKV
UP000006174	Ustilago hordei	I2G6I2	Zn(2)-C6 fungal-type domain-containing protein	0.894	96-106	ERKRRNKEKKL
UP000006174	Ustilago hordei	I2FNL0	Homeobox domain-containing protein	0.898	400-412	RRAKAKAKDKKRQ
UP000006174	Ustilago hordei	I2FPF3	Uncharacterized protein	0.701	115-120	KRRKAK
UP000006174	Ustilago hordei	I2FPS9	Uncharacterized protein	0.893	252-263	AARRPRRIKKGR
UP000006174	Ustilago hordei	I2FPY3	Related to Don3 interacting protein	0.79	357-367	KASPRKRASRR
UP000006174	Ustilago hordei	I2FQ96	Conserved uncharacterized protein (C-terminal) (Fragment)	0.689	139-145	SKSRKKR
UP000006174	Ustilago hordei	I2FQM0	Ribosome biogenesis regulatory protein	0.878	346-353	GKGKRGRK
UP000006174	Ustilago hordei	I2FQM0	Ribosome biogenesis regulatory protein	0.867	104-131	REKSMPKPKPLTKWEKFAKQKGIQSKKK
UP000006174	Ustilago hordei	I2FQM0	Ribosome biogenesis regulatory protein	0.867	177-193	TAKKERLAKKEKNEKQR
UP000006174	Ustilago hordei	I2FQM0	Ribosome biogenesis regulatory protein	0.636	276-280	KGIKR
UP000006174	Ustilago hordei	I2FRH9	Probable TSD2 protein, required for DNA replication	0.918	234-253	GKRKRSRSSKSPSTSKRRNR
UP000006174	Ustilago hordei	I2FT97	Splicing factor YJU2	0.94	279-296	SKKKKNGRNALGLVRKKK
UP000006174	Ustilago hordei	I2FTX3	HECT-type E3 ubiquitin transferase	0.899	3417-3431	RPPKRSKGKEKEKEK
UP000006174	Ustilago hordei	I2FTX3	HECT-type E3 ubiquitin transferase	0.643	2865-2868	RRKL
UP000006174	Ustilago hordei	I2FTX3	HECT-type E3 ubiquitin transferase	0.604	2872-2873	RK
UP000006174	Ustilago hordei	I2FV38	Uncharacterized protein	0.991	595-638	IAKGKAKGKAKGKAGDGNVKEGKKSSKDGKDGESKDEAEKRKSK
UP000006174	Ustilago hordei	I2FV38	Uncharacterized protein	0.854	540-553	RRKRRGTISKKDKG
UP000006174	Ustilago hordei	I2FV38	Uncharacterized protein	0.623	796-799	KKEK
UP000006174	Ustilago hordei	I2FW42	40S ribosomal protein S6	0.866	175-204	TKAPKIQRLVTAQRLQRKRHLRSLKIRKAE
UP000006174	Ustilago hordei	I2FW42	40S ribosomal protein S6	0.823	221-241	VAEKKAEVASNKAARKSARKA
UP000006174	Ustilago hordei	I2FW42	40S ribosomal protein S6	0.65	91-94	ERKR
UP000006174	Ustilago hordei	I2FW42	40S ribosomal protein S6	0.605	172-173	KP
UP000006174	Ustilago hordei	I2FYE0	P-type phospholipid transporter	0.895	176-185	RKMKPKKRRN
UP000006174	Ustilago hordei	I2FYE0	P-type phospholipid transporter	0.814	78-89	RDDRRKAKRANS
UP000006174	Ustilago hordei	I2FYE0	P-type phospholipid transporter	0.658	1526-1530	KKAKR
UP000006174	Ustilago hordei	I2FZC6	Related to amino acid transport protein	0.81	153-164	TRRRSKARDRRL
UP000006174	Ustilago hordei	I2FZC6	Related to amino acid transport protein	0.626	184-186	PKR
UP000006174	Ustilago hordei	I2FZP2	Probable RAD54-DNA-dependent ATPase of the Snf2p family	0.891	113-125	KGAKAGAKKKGKA
UP000006174	Ustilago hordei	I2FZP2	Probable RAD54-DNA-dependent ATPase of the Snf2p family	0.795	73-84	KDNPEGGRKRKK
UP000006174	Ustilago hordei	I2G058	Uncharacterized protein	0.996	459-515	KAAKKSRRKERSARWKKRKMQTQQRIKSLRAELKQAVQKERNAKKKAAGRVQATKAG
UP000006174	Ustilago hordei	I2G198	Uncharacterized protein	0.747	116-125	SAKGKGKARA
UP000006174	Ustilago hordei	I2G4H5	Related to xap-5 protein	0.971	91-110	LKADDRAAKKNKKVKKEKAK
UP000006174	Ustilago hordei	I2G4Y8	Ubiquitin-like domain-containing protein	0.989	114-126	KRRAKRRKKKHTK
UP000006174	Ustilago hordei	I2G4Y8	Ubiquitin-like domain-containing protein	0.749	15-25	PSKSKAKDKPK
UP000006174	Ustilago hordei	I2G5H8	IPPc domain-containing protein	0.969	329-366	QKNRAVKDKDKDKEKEKEKDASKDKDRDKPSRAKEKQR
UP000006174	Ustilago hordei	I2G682	Related to adrenoleukodystrophy protein	0.957	111-125	RGRGGRRGKKSKGPR
UP000006174	Ustilago hordei	I2G682	Related to adrenoleukodystrophy protein	0.955	59-69	GGKKKKAKKPA
UP000006174	Ustilago hordei	I2G6A1	Related to OSH3-Member of oxysterol-binding protein family	0.764	37-42	KKKRKK
UP000006174	Ustilago hordei	I2G731	USP domain-containing protein	0.89	1063-1075	AHRKHGGRKGRKH
UP000006174	Ustilago hordei	I2G731	USP domain-containing protein	0.659	394-399	RKRDRL
UP000006174	Ustilago hordei	I2G731	USP domain-containing protein	0.643	720-723	RRRR
UP000006174	Ustilago hordei	I2FME6	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.841	390-399	KGSRRKRGKR
UP000006174	Ustilago hordei	I2FND5	Uncharacterized protein	0.873	64-75	SKDIKREKRKKD
UP000006174	Ustilago hordei	I2FPE3	Eukaryotic translation initiation factor 5B	0.995	211-236	TKKEKEKLKKEKEKAKKKAQAQAKKA
UP000006174	Ustilago hordei	I2FPE3	Eukaryotic translation initiation factor 5B	0.994	278-305	KKKKKKKGGKGAAAEPAPATPAAPPSGK
UP000006174	Ustilago hordei	I2FPE3	Eukaryotic translation initiation factor 5B	0.988	352-385	RKEAAKRAKKEKEKAKIEQLKKEGKYLTPKQKAE
UP000006174	Ustilago hordei	I2FPE3	Eukaryotic translation initiation factor 5B	0.978	111-124	ANKKGKKDKKKNKK
UP000006174	Ustilago hordei	I2FPE3	Eukaryotic translation initiation factor 5B	0.969	415-436	KPAPKKRTLVDDRKKKKGPQKR
UP000006174	Ustilago hordei	I2FPE3	Eukaryotic translation initiation factor 5B	0.675	174-179	PKKKGG
UP000006174	Ustilago hordei	I2FV41	Endonuclease III homolog	0.988	120-164	SKSKAKGKSALLKPTRKTPAKKEQNNKSTSKKRKSASSSPKKPPT
UP000006174	Ustilago hordei	I2FV53	Uncharacterized protein	0.999	97-314	AAEKREVKPKKEKKAKENNGKSAAHKKGTKNSKPVHPEHPAHPAHPKTTKDSKKTTKGDAVNKHKQGQKQSSAHKSTHAAKPEHPKTHGDGVNKGKQGQKQSTAHKPAHAAHPEHLKKGSEKTKRDEQEDEVKPKKEGTKKKKALGHNKQGKKAPPAHPEHHAHPTKPKTHGDEMNKGKQGDKKKHTHTARPVKPTKKEHKKPAHKHKKPAHKHKSKT
UP000006174	Ustilago hordei	I2FZS8	Vps54 domain-containing protein	1	1672-1686	GSKKNKKKKKKGKKK
UP000006174	Ustilago hordei	I2G077	Probable dihydroxy-acid dehydratase	0.991	558-579	KQKRKEKWVKEKKGKHIKHKRG
UP000006174	Ustilago hordei	I2G0Q5	Uncharacterized protein	1	92-192	AKRKRGRPPKEPEPKEPKKRGRPRKYAPGEKRPRRSRRKLNPDGSFKKRGRPKKVVDPDAVMMKVPKRRGRPPKPVEEGAEDSKRKRSGDGGGAGKRKRKR
UP000006174	Ustilago hordei	I2G0Q5	Uncharacterized protein	0.683	358-368	KPKGRPVGSKN
UP000006174	Ustilago hordei	I2G122	Uncharacterized protein	0.975	164-188	AKRRKTAKARGAAGPGRGWRKGLTK
UP000006174	Ustilago hordei	I2G1I3	Uncharacterized protein	0.762	966-1014	KRHKEELRARKQAKYQEQKKDPAFLERRRQMEHEWHRKKVEAAGKTYRP
UP000006174	Ustilago hordei	I2G232	Related to DNA ligase	0.893	463-475	KGKSRRKSRLKSP
UP000006174	Ustilago hordei	I2G232	Related to DNA ligase	0.655	273-278	RARRGK
UP000006174	Ustilago hordei	I2G366	Uncharacterized protein	0.813	915-922	DRQKKKRK
UP000006174	Ustilago hordei	I2G366	Uncharacterized protein	0.808	753-767	KKAEKPVKAAKAKAS
UP000006174	Ustilago hordei	I2G366	Uncharacterized protein	0.762	808-836	RRAKTKSSKQKSSAKQASALRTKVSQAKK
UP000006174	Ustilago hordei	I2G366	Uncharacterized protein	0.638	788-792	RRRGR
UP000006174	Ustilago hordei	I2G5V5	SMK-1 domain-containing protein	0.652	1109-1117	RSRSPSPKR
UP000006174	Ustilago hordei	I2G5V5	SMK-1 domain-containing protein	0.61	1054-1056	KSG
UP000006174	Ustilago hordei	I2G6F5	Uncharacterized protein	0.929	796-809	RRRRWIRLRRRKPL
UP000006174	Ustilago hordei	I2G6F5	Uncharacterized protein	0.921	413-427	KRRKKLIRREIQRRK
UP000006174	Ustilago hordei	I2G6F5	Uncharacterized protein	0.832	587-593	KRRRRKK
UP000006174	Ustilago hordei	I2G6F5	Uncharacterized protein	0.723	912-924	KSKDPRQRQRARK
UP000006174	Ustilago hordei	I2G733	60S ribosomal protein L41	0.659	41-49	RRYDRKQKG
UP000006174	Ustilago hordei	I2G733	60S ribosomal protein L41	0.649	58-63	FHKKAK
UP000006174	Ustilago hordei	I2G733	60S ribosomal protein L41	0.604	55-56	KP
UP000006174	Ustilago hordei	I2FMT2	Related to Cullin-3	0.613	15-17	LKP
UP000006174	Ustilago hordei	I2FMZ0	Uncharacterized protein	0.773	35-41	KPKKRRR
UP000006174	Ustilago hordei	I2FMZ0	Uncharacterized protein	0.695	246-261	RRPPLPPPSRKLVPPR
UP000006174	Ustilago hordei	I2FPJ8	RF_PROK_I domain-containing protein	0.987	133-165	KKRVRRLQEADARRKKQNKIKRADVKSGRKFRG
UP000006174	Ustilago hordei	I2FPV5	Related to PRP3-essential splicing factor	0.909	395-415	LTKKEQRKLRRQRRAAEQSDK
UP000006174	Ustilago hordei	I2FQU8	Related to RIB1-GTP cyclohydrolase II	0.996	574-605	WKFGKRLKRKSKKTRSGRSKSEAKIGGGSARN
UP000006174	Ustilago hordei	I2FSB5	RING-type domain-containing protein	0.75	452-458	RKGRKRA
UP000006174	Ustilago hordei	I2FSB5	RING-type domain-containing protein	0.744	585-591	KRRSKAK
UP000006174	Ustilago hordei	I2FTU7	Uncharacterized protein	0.853	446-456	TPKKEGKKKIR
UP000006174	Ustilago hordei	I2FTU7	Uncharacterized protein	0.626	381-392	HHRQHEKQDRRA
UP000006174	Ustilago hordei	I2FTU7	Uncharacterized protein	0.623	610-615	PPKAQR
UP000006174	Ustilago hordei	I2FUA0	Uncharacterized protein	0.975	705-716	GRKKRRKRPASK
UP000006174	Ustilago hordei	I2FUA3	Related to lactose regulatory protein	0.615	186-188	KKR
UP000006174	Ustilago hordei	I2FW65	Uncharacterized protein	0.975	472-498	PPRGRSKARGRSSHRRSPSPPRAAARR
UP000006174	Ustilago hordei	I2FW65	Uncharacterized protein	0.802	577-590	GRGRGRSTRRGRGS
UP000006174	Ustilago hordei	I2FWH0	Uncharacterized protein	0.914	10-28	AAKAARARAKLKKHQAQKK
UP000006174	Ustilago hordei	I2FZ07	Uncharacterized protein	0.997	1068-1103	SKKKREAKRARDRKARTPESRTKESASKRRKREEAR
UP000006174	Ustilago hordei	I2FZ07	Uncharacterized protein	0.963	1921-1963	GGFRSGWGGRGRPRGGGGGGGGGGGGRDGEGGRGGRGRGWGMR
UP000006174	Ustilago hordei	I2FZ07	Uncharacterized protein	0.844	975-986	KVKAGAKRKGKA
UP000006174	Ustilago hordei	I2FZ07	Uncharacterized protein	0.821	828-837	NKGRRRAKGK
UP000006174	Ustilago hordei	I2FZ07	Uncharacterized protein	0.703	1182-1188	KKAKKRA
UP000006174	Ustilago hordei	I2FZ07	Uncharacterized protein	0.697	1201-1212	KKDNPTKTKKAR
UP000006174	Ustilago hordei	I2FZ07	Uncharacterized protein	0.696	266-274	GKQRKGQKA
UP000006174	Ustilago hordei	I2FZQ4	Related to CTF18-Chromosome Transmission Fidelity factor	0.822	544-561	GPKAAGLAARGKKQQRKG
UP000006174	Ustilago hordei	I2FZQ4	Related to CTF18-Chromosome Transmission Fidelity factor	0.706	295-301	RRKRVKG
UP000006174	Ustilago hordei	I2G0G0	Uncharacterized protein	0.98	189-213	PKKGKGQAAGRKSKTQLKKQRKKAR
UP000006174	Ustilago hordei	I2G0L8	Uncharacterized protein	0.661	70-74	AKRPK
UP000006174	Ustilago hordei	I2G158	RED_N domain-containing protein	0.992	478-490	KDRKRKKKKSKHH
UP000006174	Ustilago hordei	I2G158	RED_N domain-containing protein	0.954	227-237	GKRMRKKKRKH
UP000006174	Ustilago hordei	I2G381	GPN-loop GTPase	0.77	347-358	ERDAKRERSKKE
UP000006174	Ustilago hordei	I2G583	Histone deacetylase	0.703	484-491	KGKGRPKR
UP000006174	Ustilago hordei	I2FNF1	Uncharacterized protein	0.611	17-19	GRR
UP000006174	Ustilago hordei	I2FNI7	Uncharacterized protein	0.741	14-22	AKGGRRGKR
UP000006174	Ustilago hordei	I2FNQ7	1-phosphatidylinositol 4-kinase	0.791	43-59	RKWKAAVARKFRGKAQR
UP000006174	Ustilago hordei	I2FP25	Uncharacterized protein	0.795	83-105	RRRRRNNSVAHRLGRTLKLKKLK
UP000006174	Ustilago hordei	I2FPG3	Related to Tetratricopeptide repeat protein 1	0.998	1258-1274	KGKKRKRTGGKKKKGKK
UP000006174	Ustilago hordei	I2FPG3	Related to Tetratricopeptide repeat protein 1	0.998	1332-1374	RSGKPSKLSKLAKSKKSKGKKSLSSKSDAGRKKRKSLKRAKAK
UP000006174	Ustilago hordei	I2FPG3	Related to Tetratricopeptide repeat protein 1	0.937	1421-1436	KKKKSSAPKGRTKKAK
UP000006174	Ustilago hordei	I2FPG3	Related to Tetratricopeptide repeat protein 1	0.715	1233-1241	EPRRRAAKR
UP000006174	Ustilago hordei	I2FT55	WW domain-containing protein	0.999	170-201	SKAAPGGANQQGKKKNKKKRKGKQARDAEKAK
UP000006174	Ustilago hordei	I2FT55	WW domain-containing protein	0.658	286-290	KRKRG
UP000006174	Ustilago hordei	I2FT55	WW domain-containing protein	0.605	164-164	K
UP000006174	Ustilago hordei	I2FTS9	Glyco_hydro_cc domain-containing protein	0.776	407-417	HKDKKDKGKGK
UP000006174	Ustilago hordei	I2FU62	Uncharacterized protein	0.917	450-470	KLVVRHRRVKKEAERERVKRR
UP000006174	Ustilago hordei	I2FU62	Uncharacterized protein	0.834	122-149	KREKFQHGAGKVKSRVQKEREAEERKKK
UP000006174	Ustilago hordei	I2FVX5	G-patch domain-containing protein	1	303-331	KKKKKKKKKEKKEKKEKEKEDKKSKKNKK
UP000006174	Ustilago hordei	I2FVX5	G-patch domain-containing protein	0.998	124-151	KKSKKSKKSKKEEKDKKEEKDKSKKRKL
UP000006174	Ustilago hordei	I2FVX5	G-patch domain-containing protein	0.968	161-177	SKKSKKEKESKRWKKEK
UP000006174	Ustilago hordei	I2FXC5	Related to RPA49-49 kD subunit of DNA-directed RNA polymerase I	0.751	509-517	RKGKAGERK
UP000006174	Ustilago hordei	I2FXS3	Uncharacterized protein	0.988	681-704	ERRRRMKRKNGKKQNEATKPHKGR
UP000006174	Ustilago hordei	I2FXS3	Uncharacterized protein	0.868	940-950	GSRKHRKKIGK
UP000006174	Ustilago hordei	I2FXS3	Uncharacterized protein	0.822	1308-1315	KRKKKGLR
UP000006174	Ustilago hordei	I2FXS3	Uncharacterized protein	0.639	1752-1755	GRKK
UP000006174	Ustilago hordei	I2G042	BHLH domain-containing protein	0.979	527-550	EAKKLAEKRRKRRESHNAVERRRR
UP000006174	Ustilago hordei	I2G1B6	Related to putative C2H2 transcriptional regulator	0.665	456-463	DMRKAWRK
UP000006174	Ustilago hordei	I2G1B6	Related to putative C2H2 transcriptional regulator	0.647	406-409	KRPR
UP000006174	Ustilago hordei	I2G289	BZIP domain-containing protein	0.99	82-115	GKKGKGPKGKKSAAANKSKDTKAAQHRKEQNRAA
UP000006174	Ustilago hordei	I2G4T9	Related to SNF2 family helicase/ATPase	0.889	1359-1397	KSKGFSEPSKKKQRKDTAQQPGLLKKSRLRGNASQRKIS
UP000006174	Ustilago hordei	I2G4T9	Related to SNF2 family helicase/ATPase	0.886	514-527	SSNKKRKKASSGPR
UP000006174	Ustilago hordei	I2G4T9	Related to SNF2 family helicase/ATPase	0.801	26-42	AKAPTRKGKQGPSKSAA
UP000006174	Ustilago hordei	I2G655	RRN7-type domain-containing protein	0.918	952-970	ARATRMRKMLKRVERRKKS
UP000006174	Ustilago hordei	I2G655	RRN7-type domain-containing protein	0.908	465-474	KRKRRRRHIP
UP000006174	Ustilago hordei	I2G655	RRN7-type domain-containing protein	0.675	145-150	HKKARR
UP000006174	Ustilago hordei	I2FM06	CCHC-type domain-containing protein	0.98	231-250	EKQGKRGKRGKGKQKSDSAK
UP000006174	Ustilago hordei	I2FNP1	Stress-associated endoplasmic reticulum protein	0.952	48-66	REAKKRKGRQIVKPAKKDR
UP000006174	Ustilago hordei	I2FNX4	Uncharacterized protein	0.607	1202-1203	KK
UP000006174	Ustilago hordei	I2FPY0	Uncharacterized protein	0.999	388-556	KKPASKKKKKAQREREEAEAAAAAEAAKKKAEEEAAAAAAAAKKSKKKLTKKEREEKERKEKEEKEKAEREEKEKEAAAAVPVTKGAKGKSKKKQKEEAAAAASAEKSPAKNGRANGADAPGSPDKDKKGSPKKTAGKKPAGSAAAAATPAAPASAGKKKTLAKAADKK
UP000006174	Ustilago hordei	I2FQQ8	26S proteasome regulatory subunit RPN2	0.828	892-901	KSKPKKERKQ
UP000006174	Ustilago hordei	I2FTY6	Uncharacterized protein	0.954	459-471	HKKKGRPFKRKRE
UP000006174	Ustilago hordei	I2FTY6	Uncharacterized protein	0.879	319-336	RGRGAPRGRGGRPSHPRR
UP000006174	Ustilago hordei	I2FV72	GLTSCR1 domain-containing protein	0.991	641-680	PGPTPHRGRGRPRKHPLPGTPGGPPIPKPRNKKLKPGEPG
UP000006174	Ustilago hordei	I2FV72	GLTSCR1 domain-containing protein	0.797	404-431	EREIERIKRQQERAAAKAAKLEKERENR
UP000006174	Ustilago hordei	I2FV72	GLTSCR1 domain-containing protein	0.78	610-622	KPPSKSKAKAKAA
UP000006174	Ustilago hordei	I2FVE2	Uncharacterized protein	0.973	271-291	RRRIKARQREKAMRKKAEKDR
UP000006174	Ustilago hordei	I2FXZ9	Uncharacterized protein	0.999	350-368	MKKGKKQAKGKKKAKKIKK
UP000006174	Ustilago hordei	I2FXZ9	Uncharacterized protein	0.979	575-608	GKENPGAKGKKDKVKVNGKGVAKAKGVKPKQPRI
UP000006174	Ustilago hordei	I2FXZ9	Uncharacterized protein	0.694	542-548	KPVKKKS
UP000006174	Ustilago hordei	I2FYN5	Uncharacterized protein	0.982	850-884	KKKEKERMKKKMHKERELERERDREWERDQARGRQ
UP000006174	Ustilago hordei	I2G3Q5	Smr domain-containing protein	0.936	334-344	KGKKRRAARKR
UP000006174	Ustilago hordei	I2G409	Transcription elongation factor Spt6	0.997	78-90	RRERRRRRKKKRK
UP000006174	Ustilago hordei	I2G409	Transcription elongation factor Spt6	0.792	114-127	RRKEAGRLKRFRRG
UP000006174	Ustilago hordei	I2G409	Transcription elongation factor Spt6	0.759	226-238	RRQERREQKRRAR
UP000006174	Ustilago hordei	I2G560	Uncharacterized protein	0.963	355-378	EKKQKVKAKEKVKNLLKGKRPGGK
UP000006174	Ustilago hordei	I2G560	Uncharacterized protein	0.651	140-145	RKEKAR
UP000006174	Ustilago hordei	I2G6X8	Related to RAD26-DNA repair and recombination protein	0.853	36-44	PKARKRRRP
UP000006174	Ustilago hordei	I2FN76	Uncharacterized protein	0.979	640-655	MWRKARAKGKKKPSAK
UP000006174	Ustilago hordei	I2FN76	Uncharacterized protein	0.836	807-816	EAQKKKKRLR
UP000006174	Ustilago hordei	I2FNU1	Uncharacterized protein	0.611	9-11	KSK
UP000006174	Ustilago hordei	I2FRC8	Peptidase A1 domain-containing protein	0.76	624-629	RRRRRR
UP000006174	Ustilago hordei	I2FRP4	Zn(2)-C6 fungal-type domain-containing protein	0.669	506-510	RKKGR
UP000006174	Ustilago hordei	I2FRR0	Related to MDR1-Mac1p interacting protein	0.723	1235-1258	GRASSRRPSASAKASRSTSAPAKR
UP000006174	Ustilago hordei	I2FRR0	Related to MDR1-Mac1p interacting protein	0.663	943-949	KSRKVKK
UP000006174	Ustilago hordei	I2FSE8	Related to Formin binding protein 3	0.912	385-400	KRKEMAHKKRRERQNR
UP000006174	Ustilago hordei	I2FSE8	Related to Formin binding protein 3	0.859	520-535	KASEERRKLERKHRHK
UP000006174	Ustilago hordei	I2FXI6	Uncharacterized protein	0.997	295-329	TKPKSPPKQAKPIKKPKKVLGKRKYREIGPMERRS
UP000006174	Ustilago hordei	I2FXX8	Uncharacterized protein	0.711	133-143	RGRRIKPLLHR
UP000006174	Ustilago hordei	I2FXZ4	Cytoplasmic tRNA 2-thiolation protein 2	0.721	150-155	RRKKGR
UP000006174	Ustilago hordei	I2FYR5	Related to component of the spindle assembly checkpoint dma1	0.684	1005-1014	GRSRSRSRSR
UP000006174	Ustilago hordei	I2G012	Probable ribosomal protein L13B	0.95	30-47	GAKKRRRTAREAKAAKLG
UP000006174	Ustilago hordei	I2G012	Probable ribosomal protein L13B	0.914	181-209	RKARGTHRAAGKVKARIQKKEEEAANAKK
UP000006174	Ustilago hordei	I2G0V0	Probable regulator Ustilago maydis 1 protein (Rum1)	0.983	1651-1663	DRKRKAKRGKRAK
UP000006174	Ustilago hordei	I2G521	Related to Nucleolar protein NOP4	0.997	1020-1057	RREAQAARKIEAEKNKPKGYAHGHVIGKKRKERKARRG
UP000006174	Ustilago hordei	I2G521	Related to Nucleolar protein NOP4	0.874	985-1004	KKRANKLKAIKEGAERRKQR
UP000006174	Ustilago hordei	I2FLV8	SET domain-containing protein	0.763	87-92	KKKKKS
UP000006174	Ustilago hordei	I2FR20	Uncharacterized protein	0.928	80-100	RPRPPRPGPSRPGPSRRNRAA
UP000006174	Ustilago hordei	I2FSA9	SEC7 domain-containing protein	0.765	564-577	GRRAKASPGKRVSK
UP000006174	Ustilago hordei	I2FTJ6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.991	1146-1174	GKKGKKDEKAEAGAAELKPKPKRQPKKKA
UP000006174	Ustilago hordei	I2FTJ6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.983	763-781	EKRRIKNEKAKERRRLKKG
UP000006174	Ustilago hordei	I2FTJ6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.772	356-371	SGKARPSEPKPSLKRK
UP000006174	Ustilago hordei	I2FTJ6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.751	1072-1078	KRRRKQS
UP000006174	Ustilago hordei	I2FVU5	Uncharacterized protein	0.936	113-173	ARSTRQRRSRSPPSTRAAGRGGREEERTSRSPTATSSKREGAGRRSRSRSPASLPWGRGAP
UP000006174	Ustilago hordei	I2FWA4	GATA-type domain-containing protein	0.987	841-877	KKTKKSKVDEAAKTNKKQAKIEEREAKKKAKAEAKAK
UP000006174	Ustilago hordei	I2FWA4	GATA-type domain-containing protein	0.928	1066-1086	GNKKKKGSTAAGGKKGNKAVK
UP000006174	Ustilago hordei	I2FWA4	GATA-type domain-containing protein	0.808	1262-1269	PKPPKRKR
UP000006174	Ustilago hordei	I2FWA4	GATA-type domain-containing protein	0.757	188-210	KKVSKAKANKQPGCTGKPKQKRR
UP000006174	Ustilago hordei	I2FWA4	GATA-type domain-containing protein	0.699	323-329	EARRRRR
UP000006174	Ustilago hordei	I2FWL3	Non-specific serine/threonine protein kinase	0.835	164-188	KSKRGGPKRGPTDSPQTVRKAPKPK
UP000006174	Ustilago hordei	I2FWL3	Non-specific serine/threonine protein kinase	0.791	811-830	KPTAGRKSLHPRSRKSVAAP
UP000006174	Ustilago hordei	I2FWL3	Non-specific serine/threonine protein kinase	0.665	360-370	AKALKAKQNKR
UP000006174	Ustilago hordei	I2FWT7	Uncharacterized protein	0.873	199-214	GRRRVSGARKKHLKSY
UP000006174	Ustilago hordei	I2FWT7	Uncharacterized protein	0.657	382-387	RSKRGK
UP000006174	Ustilago hordei	I2FWT7	Uncharacterized protein	0.601	362-362	R
UP000006174	Ustilago hordei	I2FX86	Related to TSC13-Enoyl reductase involved in very long chain fatty acid elongation	0.604	292-293	KK
UP000006174	Ustilago hordei	I2G0Y4	Cysteinyl-tRNA synthetase	0.798	794-800	PKKRRKN
UP000006174	Ustilago hordei	I2G351	Related to actin-interacting protein AIP3	0.87	1245-1263	AKPKKLTLGSKKGRDGKKP
UP000006174	Ustilago hordei	I2G374	DEK_C domain-containing protein	0.983	74-114	QPKASTSRSSSPKKASPTKASPPKSTKSAKLTKKGPAKRKE
UP000006174	Ustilago hordei	I2G374	DEK_C domain-containing protein	0.822	170-181	RARKKSKPNKTK
UP000006174	Ustilago hordei	I2G3N5	Uncharacterized protein	0.934	569-590	LKGLKRARKDRNVGRTKPTRRP
UP000006174	Ustilago hordei	I2G3N5	Uncharacterized protein	0.873	498-508	RRRLRRRTRRR
UP000006174	Ustilago hordei	I2G3N5	Uncharacterized protein	0.756	620-629	ELGRHKRPRP
UP000006174	Ustilago hordei	I2G4G5	Uncharacterized protein	0.906	217-229	PKPRRISRRRHRK
UP000006174	Ustilago hordei	I2G4G5	Uncharacterized protein	0.619	519-521	RKR
UP000006174	Ustilago hordei	I2FMB1	Uncharacterized protein	0.742	463-487	RNRGEAREAKRHINEFRDRNRKEQH
UP000006174	Ustilago hordei	I2FPI3	MINDY_DUB domain-containing protein	0.969	927-943	KQGKKDKKGKKIKGDKK
UP000006174	Ustilago hordei	I2FQQ6	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	0.901	85-93	AKKKGKKKA
UP000006174	Ustilago hordei	I2FR09	GTP--RNA guanylyltransferase	0.684	397-404	KTAKREKR
UP000006174	Ustilago hordei	I2FU87	Related to SIZ1-E3-like factor in the SUMO pathway	0.677	683-689	RPGKRPR
UP000006174	Ustilago hordei	I2FUF2	Uncharacterized protein	0.799	481-499	GGSRSEEGRVKVKGRGRMK
UP000006174	Ustilago hordei	I2FUF2	Uncharacterized protein	0.623	443-446	RGRR
UP000006174	Ustilago hordei	I2FUW9	SNRNP27 domain-containing protein	0.917	108-139	PRPRSPRRHRDEPLRSRDDRSRPSASGRRSRS
UP000006174	Ustilago hordei	I2FUW9	SNRNP27 domain-containing protein	0.893	31-98	DRRRRSPSPSYSRSSRNNAGQRDWRKDERVPPPPRRDEEGRPDRAGRGDYRSRDRDDRYRDRPPRPRP
UP000006174	Ustilago hordei	I2FUY9	Uncharacterized protein	0.948	18-35	KLKGDDGKKDKKTKKKVK
UP000006174	Ustilago hordei	I2FV49	Uncharacterized protein	0.984	163-187	KPNAERRRKKSERHRRRFADMVRKK
UP000006174	Ustilago hordei	I2FVM9	SLD3 domain-containing protein	0.963	251-267	PRKRSRKLEKAKRWRGT
UP000006174	Ustilago hordei	I2FVQ4	Zn(2)-C6 fungal-type domain-containing protein	0.91	51-63	KNGKRGKDGKRKR
UP000006174	Ustilago hordei	I2G001	Uncharacterized protein	0.835	295-305	PSKKTSKKKKE
UP000006174	Ustilago hordei	I2G251	Glyco_hydro_cc domain-containing protein	0.82	33-46	RAKGHKKHHHKHHH
UP000006174	Ustilago hordei	I2G349	Brr6_like_C_C domain-containing protein	0.757	103-115	RRKRSVLSRKGKR
UP000006174	Ustilago hordei	I2G6F7	Uncharacterized protein	0.876	208-225	GRRRPTRRAAVQGRKKAA
UP000006174	Ustilago hordei	I2G6F7	Uncharacterized protein	0.748	262-269	RRRRAGRK
UP000006174	Ustilago hordei	I2G6N0	Related to Ral2 protein, implicated in activation of ras1	0.983	1267-1293	KLEKEERKRMEKAEKERKKAGKAEYKR
UP000006174	Ustilago hordei	I2G6P6	Related to TAF7-TFIID subunit (TBP-associated factor), 67 kD	0.958	231-244	ARKRRFRKRAARRA
UP000006174	Ustilago hordei	I2G6R6	ATP-dependent DNA helicase	0.993	1338-1365	SPKKTKKGSKTGKKSSRAAIEGGKKKRK
UP000006174	Ustilago hordei	I2G6R6	ATP-dependent DNA helicase	0.942	866-881	TRAKKDPKPKKDPKRN
UP000006174	Ustilago hordei	I2FMN1	Related to RAD16-nucleotide excision repair protein	0.976	923-940	RGKTDKNNGKKRKRKAAK
UP000006174	Ustilago hordei	I2FMN1	Related to RAD16-nucleotide excision repair protein	0.84	787-807	GKKKAKEKTDPEIVRRKHLER
UP000006174	Ustilago hordei	I2FMN1	Related to RAD16-nucleotide excision repair protein	0.801	729-739	KGKGKAGAKRR
UP000006174	Ustilago hordei	I2FMS5	Uncharacterized protein	0.993	619-653	REREIELEREREREKEKEREKEKERERRERRREKQ
UP000006174	Ustilago hordei	I2FMS5	Uncharacterized protein	0.977	1043-1051	KKKKKKKKA
UP000006174	Ustilago hordei	I2FMS5	Uncharacterized protein	0.666	289-302	RRSPAPRLAGRPGP
UP000006174	Ustilago hordei	I2FMS5	Uncharacterized protein	0.643	463-467	RKEKK
UP000006174	Ustilago hordei	I2FND9	Uncharacterized protein	0.678	1211-1221	PRAPNDGKKRK
UP000006174	Ustilago hordei	I2FNW8	Probable RML2-mitochondrial ribosomal protein, large subunit	0.963	431-481	GRGKSKSNMHPRSIYGHLAKGARTRKPGTRSGNQMVVRERPRRNGKRLGKP
UP000006174	Ustilago hordei	I2FNW8	Probable RML2-mitochondrial ribosomal protein, large subunit	0.9	79-102	APAKLTRKERRTAIKLQRKTAKRR
UP000006174	Ustilago hordei	I2FNW8	Probable RML2-mitochondrial ribosomal protein, large subunit	0.898	398-417	HKRLGKAGRSRWLGRRPKVR
UP000006174	Ustilago hordei	I2FNW8	Probable RML2-mitochondrial ribosomal protein, large subunit	0.644	180-186	RGGGHRR
UP000006174	Ustilago hordei	I2FPL0	PAPA-1 domain-containing protein	0.988	177-216	PAAAGRGRPSRAAAAGAPTPPGRKPKDATKVKWKPRAKGK
UP000006174	Ustilago hordei	I2FPL0	PAPA-1 domain-containing protein	0.693	321-325	ARKRK
UP000006174	Ustilago hordei	I2FPM9	Related to PUS7-Pseudouridine synthase	0.966	296-322	GGGGGRGGRGRGRGRGGFAGRGGGRLP
UP000006174	Ustilago hordei	I2FQM5	Related to calcium/calmodulin dependent protein kinase C	0.87	168-190	KTRLRKSHRAVDFRKPARAPRRS
UP000006174	Ustilago hordei	I2FQR5	Uncharacterized protein	0.704	24-35	SRLRKPSLKSGK
UP000006174	Ustilago hordei	I2FRM6	Uncharacterized protein	0.696	272-279	SKSKGKGK
UP000006174	Ustilago hordei	I2FRM6	Uncharacterized protein	0.68	505-510	RRGRRA
UP000006174	Ustilago hordei	I2FRM6	Uncharacterized protein	0.634	593-597	RKPVK
UP000006174	Ustilago hordei	I2FTW7	Uncharacterized protein	0.622	577-579	KRR
UP000006174	Ustilago hordei	I2FUR4	Magnesium transporter	0.99	386-421	RLRRVGLGSGAARGAKRRVGEKKRRWWARLRGEAAK
UP000006174	Ustilago hordei	I2FV64	Probable MAPKK kinase Kpp4	0.924	1443-1464	KEGKRPTRSKSTRRLEREKRHK
UP000006174	Ustilago hordei	I2FY10	Ubiquitin carboxyl-terminal hydrolase	0.992	364-392	KKIEKDRDERAKIRKRAKARKIAEEKAAK
UP000006174	Ustilago hordei	I2FYX4	Uncharacterized protein	0.974	477-500	KAMGKVKGGKKEDRKKEKNRTQAK
UP000006174	Ustilago hordei	I2FYX4	Uncharacterized protein	0.794	261-279	RRNRKPVDTKRNKHKDLGK
UP000006174	Ustilago hordei	I2G0T0	RRM domain-containing protein	0.904	162-179	KSGKKKKSSQQGAKKSRV
UP000006174	Ustilago hordei	I2G0T0	RRM domain-containing protein	0.779	405-418	KEKVAKLKAGRRFK
UP000006174	Ustilago hordei	I2G269	Uncharacterized protein	0.941	856-871	KKGEAKKARKNKPWKF
UP000006174	Ustilago hordei	I2G269	Uncharacterized protein	0.813	984-997	KPDGKIKSKAKSKA
UP000006174	Ustilago hordei	I2G2A5	Uncharacterized protein	0.991	428-445	KGKVAEPKRKGKKKAKSK
UP000006174	Ustilago hordei	I2G2M6	Uncharacterized protein	0.859	206-217	KESPKKRRQRSR
UP000006174	Ustilago hordei	I2G2X0	DDB1- and CUL4-associated factor 13	0.983	472-496	SKNKQENRRKHSKAGDKKPKAARKE
UP000006174	Ustilago hordei	I2G4S5	Related to atp-dependent rna helicase	0.817	34-40	KKKKKSK
UP000006174	Ustilago hordei	I2G594	Related to Rpa43-43 kD subunit of DNA-directed RNA polymerase I	0.868	368-377	KPEKKRRKQA
UP000006174	Ustilago hordei	I2G594	Related to Rpa43-43 kD subunit of DNA-directed RNA polymerase I	0.746	5-16	KPKSKDKSSKRR
UP000006174	Ustilago hordei	I2G690	Non-specific serine/threonine protein kinase	0.666	618-622	KRRKI
UP000006174	Ustilago hordei	I2FM13	Uncharacterized protein	0.741	276-286	PKKRPEKNEKA
UP000006174	Ustilago hordei	I2FN53	Shugoshin_C domain-containing protein	0.624	315-319	RSGRK
UP000006174	Ustilago hordei	I2FNG0	Reverse transcriptase Ty1/copia-type domain-containing protein	0.769	337-348	KSRSHKIRRRGS
UP000006174	Ustilago hordei	I2FPJ0	Uncharacterized protein	0.762	541-549	TRKGSKKRG
UP000006174	Ustilago hordei	I2FPJ0	Uncharacterized protein	0.666	398-403	KKKSNR
UP000006174	Ustilago hordei	I2FQK1	Related to Kinesin-like protein KIF23	0.952	1100-1109	PKKKRKLRKK
UP000006174	Ustilago hordei	I2FQZ1	Uncharacterized protein	0.997	18-35	GGRKRARKARKRSKKNKP
UP000006174	Ustilago hordei	I2FRN5	Orotate phosphoribosyltransferase	0.993	5-39	GNRGGGRGGGRGRGRGGGGGGRGRAGGGRGGARGG
UP000006174	Ustilago hordei	I2FT94	Uncharacterized protein	0.721	590-597	RWRRRGRK
UP000006174	Ustilago hordei	I2FV27	Related to MOT1-transcriptional accessory protein	0.895	379-393	ERNALKRKRKLEGKN
UP000006174	Ustilago hordei	I2FVG4	XPGN domain-containing protein	0.905	90-118	LALKDREQVKRRNKRELDKIRSKLEHERR
UP000006174	Ustilago hordei	I2FVS6	Uncharacterized protein	0.982	726-746	SRTVKRNTKAKSTSKKRKKRA
UP000006174	Ustilago hordei	I2FVS6	Uncharacterized protein	0.934	663-707	ESKSPASVNKRKGTHTSKSAKSLTKASASSKAKADSKGNGRKRKG
UP000006174	Ustilago hordei	I2FVS6	Uncharacterized protein	0.76	582-598	ERAAKAKKATSGIPLKR
UP000006174	Ustilago hordei	I2FVS6	Uncharacterized protein	0.61	658-660	KRH
UP000006174	Ustilago hordei	I2FVW3	Mediator of RNA polymerase II transcription subunit 17	0.998	605-633	KKKKEEEKKKKEEEKKKEEEKKKEEEKKK
UP000006174	Ustilago hordei	I2FVW3	Mediator of RNA polymerase II transcription subunit 17	0.691	382-389	KGAGGKKK
UP000006174	Ustilago hordei	I2FYJ4	Related to Ribonucleases P/MRP protein subunit POP1	0.885	156-188	RSDIRKRLPSHGVIRATLRRKKLAERASHPQRR
UP000006174	Ustilago hordei	I2FYJ4	Related to Ribonucleases P/MRP protein subunit POP1	0.612	988-989	RR
UP000006174	Ustilago hordei	I2FYY7	Uncharacterized protein	0.624	83-85	RKK
UP000006174	Ustilago hordei	I2FZY0	Related to Tyrosyl-tRNA synthetase	0.994	208-236	PKKEKKEKKEKAPKEVKAGAGGGGGKKGG
UP000006174	Ustilago hordei	I2FZY0	Related to Tyrosyl-tRNA synthetase	0.65	177-181	KKAKK
UP000006174	Ustilago hordei	I2G056	Uncharacterized protein	0.9	249-258	YAKNKKRKRK
UP000006174	Ustilago hordei	I2G056	Uncharacterized protein	0.721	807-815	ASLSKRKKG
UP000006174	Ustilago hordei	I2G097	Uncharacterized protein	0.988	294-335	GRVARNVRRAEKRKGPQAAKNAKDAPSKTAAKGVKAKTAGKK
UP000006174	Ustilago hordei	I2G097	Uncharacterized protein	0.77	73-85	GRGRKSAGRGRPK
UP000006174	Ustilago hordei	I2G0F5	Uncharacterized protein	0.661	96-100	RRRKR
UP000006174	Ustilago hordei	I2G0J2	G-patch domain-containing protein	0.857	365-416	HRHRSRSPMTSKSKDHDRHCERRRDDRGSERRSHASSRSDRDRDDRRRDHRR
UP000006174	Ustilago hordei	I2G206	Related to DnaJ homolog subfamily A member 2	0.673	116-122	RGRRPRR
UP000006174	Ustilago hordei	I2G4D4	Uncharacterized protein	0.994	365-385	LERKRKREERRRRKVEKQKQK
UP000006174	Ustilago hordei	I2G4X0	Uncharacterized protein	0.991	685-805	RRKKRRGDEKNNRRGRGQKDKAAPHTGWGHSGDSGSKGGGPKRGKFSRKNQKARSKPYERDTDGASSRNSGSGGKRRRGRGNGGGGGHGNGNGDNGSRGGGGGGSKSKQNGGGGGEKVRGG
UP000006174	Ustilago hordei	I2G4X0	Uncharacterized protein	0.693	562-567	KEKKKG
UP000006174	Ustilago hordei	I2G4X0	Uncharacterized protein	0.661	639-643	PSKKR
UP000006174	Ustilago hordei	I2G5B3	Uncharacterized protein	0.815	595-613	RRRRGGGGQPSPRRQGGRR
UP000006174	Ustilago hordei	I2G5B3	Uncharacterized protein	0.735	651-662	PRRRTMRRAPGR
UP000006174	Ustilago hordei	I2G5C7	SWIB domain-containing protein	0.998	129-160	AKAPASNGTKPKAEPKPKVEPKPKKKPTKKRA
UP000006174	Ustilago hordei	I2G6A8	Related to IKI3-Subunit of RNA polymerase II elongator histone acetyltransferase complex	0.988	1338-1357	RKKEAKLKKKAERQKAGGKK
UP000006174	Ustilago hordei	I2G6Q8	NTP_transf_2 domain-containing protein	0.973	790-813	KIARQAAEALRKEKKKNARRARSH
UP000006174	Ustilago hordei	I2G6Q8	NTP_transf_2 domain-containing protein	0.838	530-539	RPKRPRRRGN
UP000006174	Ustilago hordei	I2G6Q8	NTP_transf_2 domain-containing protein	0.657	225-235	NRLRGEEKERR
UP000006174	Ustilago hordei	I2FN13	YL1_C domain-containing protein	0.88	31-48	GQKFKERKRKEAMPQRSR
UP000006174	Ustilago hordei	I2FN13	YL1_C domain-containing protein	0.628	59-68	RREERERLAK
UP000006174	Ustilago hordei	I2FP57	G-patch domain-containing protein	0.995	263-280	GRKAARRKQRKRKRGSPP
UP000006174	Ustilago hordei	I2FR35	Rab-GAP TBC domain-containing protein	0.872	158-166	KSKKNKRRK
UP000006174	Ustilago hordei	I2FR35	Rab-GAP TBC domain-containing protein	0.65	43-47	AKRRR
UP000006174	Ustilago hordei	I2FR81	Uncharacterized protein	0.986	460-496	RMRMLMFRAEQKAKRVSKIKSKAYRKIHRKEKERLKA
UP000006174	Ustilago hordei	I2FR81	Uncharacterized protein	0.801	99-109	KAKGKQPKRRR
UP000006174	Ustilago hordei	I2FR81	Uncharacterized protein	0.709	43-51	GKPAPRRPR
UP000006174	Ustilago hordei	I2FR81	Uncharacterized protein	0.614	530-534	RARER
UP000006174	Ustilago hordei	I2FRJ5	Fungal_trans domain-containing protein	0.657	58-61	KRRK
UP000006174	Ustilago hordei	I2FUW7	ATM homolog	0.603	473-474	RR
UP000006174	Ustilago hordei	I2FVJ8	Related to SNF5-component of SWI/SNF transcription activator complex	0.964	1471-1488	EREREARRKRRQTRGRRG
UP000006174	Ustilago hordei	I2FVJ8	Related to SNF5-component of SWI/SNF transcription activator complex	0.952	421-434	SKPKPPRKKSEKKS
UP000006174	Ustilago hordei	I2FVQ5	Related to NSR1-nuclear localization sequence binding protein	0.988	361-414	GGAPRGGGRGGGRGGGRGGGRGGAFGGGRGGGGGFGGGRGGGGRGGGRGGRGGS
UP000006174	Ustilago hordei	I2FVQ5	Related to NSR1-nuclear localization sequence binding protein	0.987	18-52	KKDKKAAAKTVEETKANGVTKKDKKDKKDKKSKKE
UP000006174	Ustilago hordei	I2FW08	SCA7 domain-containing protein	0.986	212-240	IAAAKAAAAAAPPKEKKKKSVKDGKSKSG
UP000006174	Ustilago hordei	I2FW08	SCA7 domain-containing protein	0.977	123-144	KKQKKEARLAEEKKKGGRKNKG
UP000006174	Ustilago hordei	I2FWN9	Uncharacterized protein	0.986	208-222	RGSKRRRKRSQRRKR
UP000006174	Ustilago hordei	I2FX11	Related to MRPL9-mitochondrial ribosomal protein, large subunit	0.646	163-171	RKAGIKSGK
UP000006174	Ustilago hordei	I2FX20	Uncharacterized protein	0.823	540-550	ARKKRKQVRGK
UP000006174	Ustilago hordei	I2FX20	Uncharacterized protein	0.745	844-856	KRQRLRKLRIAKG
UP000006174	Ustilago hordei	I2FXX9	PHD-type domain-containing protein	0.99	192-240	TPKAPAKAKVPAKKGTKRARLEAAAARRAASSVAKSSSAPKASGAKRGR
UP000006174	Ustilago hordei	I2FXX9	PHD-type domain-containing protein	0.963	500-522	KAIREEEERERREKEREERKRKR
UP000006174	Ustilago hordei	I2FXX9	PHD-type domain-containing protein	0.934	425-470	RKRSSRIAMKESEREERERDREARARMEKKMAAIRKEEEQKRQKEE
UP000006174	Ustilago hordei	I2FXX9	PHD-type domain-containing protein	0.707	476-493	QKSREQRLREREERLRAR
UP000006174	Ustilago hordei	I2FY44	Probable heat shock protein 80	0.933	245-257	KKDKKDKPKKKVK
UP000006174	Ustilago hordei	I2FYN6	Probable serine/threonine protein kinase B-related Ukb1	0.741	404-411	NRSHRRRK
UP000006174	Ustilago hordei	I2FYN6	Probable serine/threonine protein kinase B-related Ukb1	0.674	109-115	KREGRKR
UP000006174	Ustilago hordei	I2FZN5	Uncharacterized protein	0.738	511-525	REQEREKEKEKEKGR
UP000006174	Ustilago hordei	I2G0G3	Related to TRM2-tRNA(M5U54)methyltransferase	0.675	54-62	ARRTRQKRK
UP000006174	Ustilago hordei	I2G0G9	Uncharacterized protein	0.625	1937-1939	KRK
UP000006174	Ustilago hordei	I2G101	DNA-directed RNA polymerase subunit	0.94	1220-1230	ADKKKKSKKHK
UP000006174	Ustilago hordei	I2G1D4	Related to DNA repair protein RAD14	0.854	291-299	EKARKRGKK
UP000006174	Ustilago hordei	I2G1D4	Related to DNA repair protein RAD14	0.663	22-33	RARLRLEARARK
UP000006174	Ustilago hordei	I2G3X8	Related to tandem ph domain-containing protein-2 (Tapp2)	0.846	89-100	KKGEKRKTWKKR
UP000006174	Ustilago hordei	I2FM47	THO complex subunit 2	0.995	1711-1788	RERDRDRDRNERPSDRDKTRTTERERERERDRDRDRRDRDRSARDRDREREKERNREREREREREKEVRDRERARDRE
UP000006174	Ustilago hordei	I2FM47	THO complex subunit 2	0.656	1978-1988	GRDQRRDRSAR
UP000006174	Ustilago hordei	I2FVG0	Flavin mononucleotide kinase 1	0.621	205-207	KKS
UP000006174	Ustilago hordei	I2FVL9	VWFA domain-containing protein	0.739	407-415	KARRRAEKK
UP000006174	Ustilago hordei	I2FWV0	Uncharacterized protein	0.945	284-293	KKKKRSKRSK
UP000006174	Ustilago hordei	I2FXM8	Uncharacterized protein	0.99	36-66	AKKPAAVKKKAVVKKKAAHSGPRSTGGRRKG
UP000006174	Ustilago hordei	I2FXU2	Uncharacterized protein	0.986	342-359	GKGKSASASRKGGKGKRK
UP000006174	Ustilago hordei	I2FXU2	Uncharacterized protein	0.94	248-283	EKELKRQQLAKAPAAIRQGMRKAAGERREKEREKAK
UP000006174	Ustilago hordei	I2FXU2	Uncharacterized protein	0.876	65-75	KKRLSSKKRKR
UP000006174	Ustilago hordei	I2FYR6	Uncharacterized protein	0.996	68-124	KKREDAQRRKEKSTLQPGAKGGGALAGKVKSKAEIKMELKKALRGKAKARKEARRAR
UP000006174	Ustilago hordei	I2FYR6	Uncharacterized protein	0.844	8-26	LKVARKAAAAPPTPPKRKK
UP000006174	Ustilago hordei	I2FYW2	Related to cysteine synthase	0.968	69-80	RRERRRRRRKLR
UP000006174	Ustilago hordei	I2FZT4	DUF2786 domain-containing protein	0.673	305-311	ERLKKEK
UP000006174	Ustilago hordei	I2FZT4	DUF2786 domain-containing protein	0.626	494-497	KKRA
UP000006174	Ustilago hordei	I2FZT4	DUF2786 domain-containing protein	0.612	521-523	KRK
UP000006174	Ustilago hordei	I2G1Q8	Related to UV-endonuclease UVE-1	0.976	96-110	KPAKKKPAKAPKKGK
UP000006174	Ustilago hordei	I2G1Q8	Related to UV-endonuclease UVE-1	0.972	493-521	PAKDIGVKTSGRKSKLGGERLPRKGKARK
UP000006174	Ustilago hordei	I2G1Q8	Related to UV-endonuclease UVE-1	0.955	140-154	RRDKNGRRLAKRKKK
UP000006174	Ustilago hordei	I2G1Q8	Related to UV-endonuclease UVE-1	0.915	656-668	KPKKGRKKAATPK
UP000006174	Ustilago hordei	I2G1Q8	Related to UV-endonuclease UVE-1	0.912	34-51	PPKRARKAVKEPPAKVKR
UP000006174	Ustilago hordei	I2G264	Methionine aminopeptidase	0.863	346-355	VREERKKRRK
UP000006174	Ustilago hordei	I2G2G8	Uncharacterized protein	0.984	424-438	GKKGEGKKKGKNARK
UP000006174	Ustilago hordei	I2G385	Related to 5`-nucleotidase	0.63	1002-1005	KKRR
UP000006174	Ustilago hordei	I2G3B2	Uncharacterized protein	0.978	228-249	PKRAPKKPKATKKLKHLTIKLR
UP000006174	Ustilago hordei	I2G3B2	Uncharacterized protein	0.826	367-385	KKRGKDSIIVKKAIKRPAK
UP000006174	Ustilago hordei	I2G3K6	Uncharacterized protein	0.844	105-125	KKKAKKPAADGINAKPASTKK
UP000006174	Ustilago hordei	I2G3P1	Nucleolar protein 16	0.856	5-32	RQRRKSRSGSSMKPSLNAKRQMKKRLAR
UP000006174	Ustilago hordei	I2G4V9	Phosphatidylinositol 3-kinase VPS34	0.779	587-604	RAKELRSNRDARPKKIEK
UP000006174	Ustilago hordei	I2G4Z6	B-related factor 1	0.978	612-632	GSGKGSRKKGGDGRKSSKRRR
UP000006174	Ustilago hordei	I2G4Z6	B-related factor 1	0.854	556-565	PYKRKKPKAP
UP000006174	Ustilago hordei	I2G4Z6	B-related factor 1	0.794	308-315	TNKRKRKN
UP000006174	Ustilago hordei	I2G6C3	Hydroxymethylbilane synthase	0.931	678-698	HRKMAEEADRRRREEARKRKA
UP000006174	Ustilago hordei	I2FNL4	Uncharacterized protein	0.854	274-284	KKRGRPRLKAR
UP000006174	Ustilago hordei	I2FQ95	Related to spindle assembly checkpoint protein	0.873	656-662	LKKKKKR
UP000006174	Ustilago hordei	I2FQJ1	Related to rna binding motif protein	0.979	196-233	RRKEQRASIRAEREAKRRRREERASTSTRYKDDKRQDK
UP000006174	Ustilago hordei	I2FT25	BZIP domain-containing protein	0.766	82-94	RKAQREFRKRREA
UP000006174	Ustilago hordei	I2FU95	Uncharacterized protein	0.76	17-25	PRPKKRPQN
UP000006174	Ustilago hordei	I2FXW5	CUE domain-containing protein	0.754	127-146	RGRGGASVRGARGGRGGFRG
UP000006174	Ustilago hordei	I2FZK0	Uncharacterized protein	0.879	220-238	KKADAKKADKKADKKDEKG
UP000006174	Ustilago hordei	I2FRK6	Related to multidrug resistance protein 1	0.877	888-907	GKSDAQSKASRKEEKRRLRK
UP000006174	Ustilago hordei	I2FT01	Exosome complex protein	0.97	214-243	TPKNAPATPSKKTSSAASSPSKKQKKKSHK
UP000006174	Ustilago hordei	I2FTN4	Related to SWR1-DEAH-box protein, putative RNA helicase	0.951	444-460	RPARGKRKGKAREERLH
UP000006174	Ustilago hordei	I2FUU8	Uncharacterized protein	0.734	162-178	KMRAAERIERRKLEQKR
UP000006174	Ustilago hordei	I2FUV3	Leucine zipper-EF-hand-containing transmembrane protein 1	0.86	746-767	KIKQQGKEIRSNGPVEKKKPKK
UP000006174	Ustilago hordei	I2FUX1	PX domain-containing protein YPT35	0.932	278-297	PGKKKERRPSAGHRPPSILK
UP000006174	Ustilago hordei	I2FWD4	Uncharacterized protein	0.969	290-315	RPKNAEERRARMLESKRRWARKKRLQ
UP000006174	Ustilago hordei	I2FYH9	Uncharacterized protein	0.797	386-400	KAKRQSEIRRKRGVR
UP000006174	Ustilago hordei	I2FZL4	DNA-directed RNA polymerase III subunit	0.901	135-145	EQKAKKKSRRK
UP000006174	Ustilago hordei	I2G192	Signal recognition particle 54 kDa protein homolog	0.987	455-478	GRAKKKKKPLQKVRMTARARRVAR
UP000006174	Ustilago hordei	I2G2I2	Probable NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial	0.668	284-293	KPKEDPKDKK
UP000006174	Ustilago hordei	I2G2Q0	RWD domain-containing protein	0.711	219-235	KMSAKEREEYKKSKVKP
UP000006174	Ustilago hordei	I2G3U8	Usp domain-containing protein	0.704	284-295	KHLKKRLNDPKR
UP000006174	Ustilago hordei	I2G457	Uncharacterized protein	0.672	438-450	RIRGRTAAEKGRK
UP000006174	Ustilago hordei	I2G4T6	Uncharacterized protein	0.933	120-132	NARKRERRKLRKA
UP000006174	Ustilago hordei	I2G4T6	Uncharacterized protein	0.846	297-318	KAYRQIKEKKIQESESKRAKKA
UP000006174	Ustilago hordei	I2G4T6	Uncharacterized protein	0.602	267-267	K
UP000006174	Ustilago hordei	I2G4T8	C3H1-type domain-containing protein	0.884	8-23	RGSGRGRGRGRGRGSL
UP000006174	Ustilago hordei	I2G4T8	C3H1-type domain-containing protein	0.607	263-263	K
UP000006174	Ustilago hordei	I2G4T8	C3H1-type domain-containing protein	0.602	266-266	R
UP000006174	Ustilago hordei	I2G5T9	Related to Transformer-2 protein	0.996	284-319	RRRPSPPRRPRRSPSPPPKRSGGSRYSRSPSPRRGG
UP000006174	Ustilago hordei	I2G5T9	Related to Transformer-2 protein	0.994	32-122	SRPPRGRSYSRSPSTTPVPGRRDRSPARRADSRSRSRSRSRSPLPHRRSRSPAARRYDRDDRDRRDRNRSRSPPPPRSDRRRSPPPKPRGA
UP000006174	Ustilago hordei	I2G6R2	Related to DBP6-ATP-dependent RNA helicase	0.999	98-133	KARIGPKEKTKAKQRYLKSKKERRKARIRAAPKKSK
UP000006174	Ustilago hordei	I2G6R2	Related to DBP6-ATP-dependent RNA helicase	0.808	164-177	AKRKLSKAKEHKPA
UP000006174	Ustilago hordei	I2G718	Related to BFR1-Nuclear segregation protein	0.895	394-404	KQRKPKGKGRR
UP000006174	Ustilago hordei	I2FNP6	Related to MRPS9-mitochondrial ribosomal protein, small subunit	0.943	333-358	KRDPRMVERKKTGKLKARKAFTWVKR
UP000006174	Ustilago hordei	I2FPK3	Uncharacterized protein	0.951	72-89	KRAGAKAKAPKKEKLKPW
UP000006174	Ustilago hordei	I2FQE9	Histidine--tRNA ligase	0.951	432-442	EKKKPKSKKKG
UP000006174	Ustilago hordei	I2FRZ5	SAP domain-containing protein	0.99	168-241	ADKRKEKKERREAVVVEKKPEETEDERKEREKREEEEKEKARRRAERFGLKTSGEGEKRKGEEANGGVEKRVKA
UP000006174	Ustilago hordei	I2FSG4	Uncharacterized protein	0.967	233-245	KIVKKKKRKGYKK
UP000006174	Ustilago hordei	I2FUJ6	Uncharacterized protein	0.844	568-588	GKRRRNSTNVPPRRPPKSPHR
UP000006174	Ustilago hordei	I2FUL3	Related to SSF1-Nucleolar protein involved in the assembly of the large ribosomal subunit	0.998	538-562	PKRKAAPAKGKPAAKGKGAKKGGRR
UP000006174	Ustilago hordei	I2FUL3	Related to SSF1-Nucleolar protein involved in the assembly of the large ribosomal subunit	0.644	358-368	KKEEKGQLRKA
UP000006174	Ustilago hordei	I2FVA5	Uncharacterized protein	0.816	70-82	KNRTRKTKKRISG
UP000006174	Ustilago hordei	I2FVA5	Uncharacterized protein	0.739	1105-1110	SRKRKH
UP000006174	Ustilago hordei	I2FX65	Uncharacterized protein	0.646	256-260	NRKSK
UP000006174	Ustilago hordei	I2FXE9	Uncharacterized protein	0.83	741-767	KSRWKERVKASNKVWRGIEKERERKER
UP000006174	Ustilago hordei	I2FYR2	Autophagy-related protein 11	0.729	621-628	ARKRMRRR
UP000006174	Ustilago hordei	I2FZU7	Uncharacterized protein	0.785	598-617	KNAAKSAKKPSSGAGGGGKK
UP000006174	Ustilago hordei	I2FM39	OTU domain-containing protein	0.975	536-586	KRGRGRPRKDGLPNKSTVAIKRRVPTAREKRDAAQARKRERQLEKIGRARA
UP000006174	Ustilago hordei	I2FM39	OTU domain-containing protein	0.895	193-209	RQRRRQKREESKRDKKS
UP000006174	Ustilago hordei	I2FP55	Probable ubiquitin/ribosomal protein S27a fusion protein	0.994	73-99	LRGGAKKRKKKVYTTPKRIPHKRKKVK
UP000006174	Ustilago hordei	I2FPH0	Uncharacterized protein	0.861	451-463	KSKSKAKPKFKPK
UP000006174	Ustilago hordei	I2FQZ5	Related to MKK1-MAP kinase kinase	0.744	8-14	KKPRKPG
UP000006174	Ustilago hordei	I2FRH0	Uncharacterized protein	0.986	1537-1553	KRLPHKPIKKRRKSRIK
UP000006174	Ustilago hordei	I2FT74	Related to Signal recognition particle 14 kDa protein	0.999	100-176	LKKRDKAKERKMDKAREQSRKKLVQVVDGKEKVITNKIGSKRGAGRRKRQRALKKGLALRKEKAKEAKRKLQSAKAA
UP000006174	Ustilago hordei	I2FUL0	Non-specific serine/threonine protein kinase	0.997	814-843	AKKKNNNKRRRRGKRGGAAVAAKAAKANGK
UP000006174	Ustilago hordei	I2FWG2	Uncharacterized protein	0.996	534-564	GRKKPPKKAKKVGPDGVRQRGKGRGRGGSAG
UP000006174	Ustilago hordei	I2FYG4	C2 NT-type domain-containing protein	0.898	690-708	ELRKQRLAQGKEKAKGKKS
UP000006174	Ustilago hordei	I2FZR3	SAE2 domain-containing protein	0.947	163-175	KDKRHRKKHKSKA
UP000006174	Ustilago hordei	I2FZR3	SAE2 domain-containing protein	0.881	423-440	KAKRVGGRREEGGSGRRR
UP000006174	Ustilago hordei	I2G3C9	Bromo domain-containing protein	0.765	858-867	KPTEKKRGKK
UP000006174	Ustilago hordei	I2G3C9	Bromo domain-containing protein	0.71	827-841	KPSKSATHRSNKKAR
UP000006174	Ustilago hordei	I2G510	Uncharacterized protein	0.604	177-178	KP
UP000006174	Ustilago hordei	I2G5V6	Related to DIP2-Dom34p-interacting protein	0.996	359-379	KKMERRRKRNKEKAEKKRAKE
UP000006174	Ustilago hordei	I2G5V6	Related to DIP2-Dom34p-interacting protein	0.737	1065-1072	AARKRKLR
UP000006174	Ustilago hordei	I2G677	Uncharacterized protein	0.685	113-120	RRPRNRQR
UP000006174	Ustilago hordei	I2G6M8	Endopolyphosphatase	0.998	470-492	HHHRPTPPKKKKGKKHHKHKLPR
UP000006174	Ustilago hordei	I2G6M8	Endopolyphosphatase	0.912	543-560	KKKHKDNDDEEKKKRRKE
UP000006174	Ustilago hordei	I2G6M8	Endopolyphosphatase	0.859	86-97	KKPKKHKSEGKQ
UP000006174	Ustilago hordei	I2G6M8	Endopolyphosphatase	0.801	626-639	KKGTGRKKLAKPLR
UP000006174	Ustilago hordei	L7N6F5	Probable b mating type locus, bE1 allele	0.868	294-313	PARKTATKTQTKPKKAKQRA
UP000006174	Ustilago hordei	L7N6F5	Probable b mating type locus, bE1 allele	0.621	374-380	KVKALPK
UP000006174	Ustilago hordei	I2FRW3	Uncharacterized protein	0.876	1058-1071	AKKGKKVKGRVSSK
UP000006174	Ustilago hordei	I2FRW3	Uncharacterized protein	0.681	149-159	KLKREEERRKR
UP000006174	Ustilago hordei	I2FRW3	Uncharacterized protein	0.642	136-140	KARRQ
UP000006174	Ustilago hordei	I2FSC4	Related to GTPase-activating protein of the rho/rac family (LRG1 protein)	0.83	1181-1192	KGGKDKKEIKKK
UP000006174	Ustilago hordei	I2FSD7	Uncharacterized protein	0.601	643-643	K
UP000006174	Ustilago hordei	I2FTD3	Uncharacterized protein	0.682	421-435	AAAAERKTAGKPLPA
UP000006174	Ustilago hordei	I2FTD3	Uncharacterized protein	0.639	409-415	RSRSKSL
UP000006174	Ustilago hordei	I2FUI7	Uncharacterized protein	0.784	291-303	KRKEWEKRLKRWR
UP000006174	Ustilago hordei	I2FUI7	Uncharacterized protein	0.603	29-29	R
UP000006174	Ustilago hordei	I2FWN1	Uncharacterized protein	0.982	105-136	KHKRRLKREAEQKQREERDRVRREKRLLKRKA
UP000006174	Ustilago hordei	I2FWN1	Uncharacterized protein	0.873	547-573	LPAARKAAEKEEARRRALAEREAKVRS
UP000006174	Ustilago hordei	I2G272	Zn(2)-C6 fungal-type domain-containing protein	0.665	297-304	KSPHRLKR
UP000006174	Ustilago hordei	I2G465	Smg4_UPF3 domain-containing protein	0.997	381-400	KLGKKEKSKKKSRKGKGGAE
UP000006174	Ustilago hordei	I2G465	Smg4_UPF3 domain-containing protein	0.754	435-445	APKAPKKMAKQ
UP000006174	Ustilago hordei	I2G465	Smg4_UPF3 domain-containing protein	0.712	86-96	KQPKKQVKKEV
UP000006174	Ustilago hordei	I2G465	Smg4_UPF3 domain-containing protein	0.709	330-343	KRESVARLKKANKA
UP000006174	Ustilago hordei	I2G465	Smg4_UPF3 domain-containing protein	0.688	454-462	AKAKAKSPP
UP000006174	Ustilago hordei	I2G465	Smg4_UPF3 domain-containing protein	0.677	469-474	RKKGGS
UP000006174	Ustilago hordei	I2G473	Related to MAK5-ATP-dependent RNA helicase	0.902	558-571	KKRRKLKQLTKKRH
UP000006174	Ustilago hordei	I2G473	Related to MAK5-ATP-dependent RNA helicase	0.862	137-148	TQKRKAKKNNKR
UP000006174	Ustilago hordei	I2G473	Related to MAK5-ATP-dependent RNA helicase	0.845	7-25	PAKAHSAPSAKRSKKSHNK
UP000006174	Ustilago hordei	I2G473	Related to MAK5-ATP-dependent RNA helicase	0.841	923-969	PKRTKQKVPPQKEMPKKNKVDQTPIAKNKVEAKTANKKTANLHKRQK
UP000006174	Ustilago hordei	I2G5U3	Related to POP4-protein involved in processing of tRNAs and rRNAs	0.97	72-90	RAKAEKKLVKRRRRVKSEL
UP000006174	Ustilago hordei	I2FPD6	SLT domain-containing protein	0.773	61-72	RRMGRRSKRHCK
UP000006174	Ustilago hordei	I2FPI8	Uncharacterized protein	0.9	102-114	KSKKKNNNKKKKS
UP000006174	Ustilago hordei	I2FTI7	Zn(2)-C6 fungal-type domain-containing protein	0.665	65-69	KKRKR
UP000006174	Ustilago hordei	I2FU68	MADS-box domain-containing protein	0.678	139-144	RKARRG
UP000006174	Ustilago hordei	I2FUP1	Probable myosin I	0.875	983-1022	KPAPKKKPGLVRPITSGKLLRAGGPSNANNKPKPRAIPRP
UP000006174	Ustilago hordei	I2FUP1	Probable myosin I	0.793	5-27	KKAGAKKAGAASNPPPAKSRAGV
UP000006174	Ustilago hordei	I2FUP1	Probable myosin I	0.761	1235-1255	PKPTAPPAANGKANPPPPPRR
UP000006174	Ustilago hordei	I2FVZ8	Metallophos domain-containing protein	0.78	374-385	KRKRAGNKGKVR
UP000006174	Ustilago hordei	I2FVZ9	Sde2_N_Ubi domain-containing protein	0.914	245-255	KKKKPNKGKAK
UP000006174	Ustilago hordei	I2FYQ5	WW domain-containing protein	0.913	165-193	PKKAAGGTKRKKDPATASAAANAGRKGRK
UP000006174	Ustilago hordei	I2FZY2	BZIP domain-containing protein	0.75	377-391	RERNKASQRESRKRK
UP000006174	Ustilago hordei	I2G2X3	DUF4110 domain-containing protein	0.995	385-399	KRPKKKAGGRRKKKP
UP000006174	Ustilago hordei	I2G2X3	DUF4110 domain-containing protein	0.984	3-32	KKAKPSAGKAAAKVAKKEKAEKKATSKLTK
UP000006174	Ustilago hordei	I2G499	Related to Rpa34-34 kD subunit of DNA-directed RNA polymerase I	0.99	280-302	KKQKKRKAKTEGEKSPKKSKKDE
UP000006174	Ustilago hordei	I2G4M5	tRNA(His) guanylyltransferase	0.957	249-274	KTRLRIELKKGAREAKSQEKKEKKAK
UP000006174	Ustilago hordei	I2G656	Palmitoyltransferase	0.846	316-336	RIRLRSKKNPARPRVEDRLRG
UP000006174	Ustilago hordei	I2G656	Palmitoyltransferase	0.651	356-363	GGRREARG
UP000006174	Ustilago hordei	I2G656	Palmitoyltransferase	0.612	375-377	RKA
UP000006174	Ustilago hordei	I2FM73	Uncharacterized protein	0.932	787-804	KGRTSRAKSKGKGKARER
UP000006174	Ustilago hordei	I2FM73	Uncharacterized protein	0.898	1046-1053	RRRRRRRR
UP000006174	Ustilago hordei	I2FM73	Uncharacterized protein	0.619	1220-1225	KREGKR
UP000006174	Ustilago hordei	I2FPB5	Chitinase	0.691	88-104	SRILSRRPSTRISPRKR
UP000006174	Ustilago hordei	I2FPF5	Probable SIK1-involved in pre-rRNA processing	0.999	464-516	KKSKKDKESKKDKKSKSKSSDKDKKKDVEKAAKKAAKESKKEKKDKKEKKSKK
UP000006174	Ustilago hordei	I2FQB0	Uncharacterized protein	0.897	333-357	ERKRESKALQASSKRNKTAKRKQDQ
UP000006174	Ustilago hordei	I2FRC5	Non-specific serine/threonine protein kinase	0.999	729-772	KLSKQEAKALKKQAKKQTKDANREKRKTKMPKAEKKRRLKKNHK
UP000006174	Ustilago hordei	I2FRX2	Uncharacterized protein	1	39-66	RQGEKKKKKKGEKGEKKKKKKKAATTRR
UP000006174	Ustilago hordei	I2FTX9	FACT complex subunit	0.891	1023-1030	GGSKKKRR
UP000006174	Ustilago hordei	I2FTX9	FACT complex subunit	0.745	1004-1014	AARADEKKRRQ
UP000006174	Ustilago hordei	I2FV61	Probable mrna export factor elf1	0.987	1054-1079	KFKAKKGKKKMTRNDKKAQEERRRLR
UP000006174	Ustilago hordei	I2FWL7	Uncharacterized protein	0.918	1000-1015	RRRHRRRSSGPRSLRP
UP000006174	Ustilago hordei	I2FWL7	Uncharacterized protein	0.782	353-369	RRRIRRWSSIERERRRG
UP000006174	Ustilago hordei	I2FWN2	Uncharacterized protein	0.997	358-409	HERRRERREGREGREGRERRKSESDHRRDKDKRKDKDSNKDKERKKSRKQRE
UP000006174	Ustilago hordei	I2FWN2	Uncharacterized protein	0.996	261-320	HNERRKKEIQEARQKRSREKGKRREEQEHPNPPRSSAHRRDSPRRRCRSPDRKDKGRHGS
UP000006174	Ustilago hordei	I2FWN2	Uncharacterized protein	0.766	11-17	ERRRRRP
UP000006174	Ustilago hordei	I2FX03	Uncharacterized protein	0.879	279-309	KPPQRKRAKLSDTGPAGSGKGKVRSARSGKK
UP000006174	Ustilago hordei	I2FX03	Uncharacterized protein	0.791	354-374	GGKSTRKGKAGVDVAKKAGGR
UP000006174	Ustilago hordei	I2FX03	Uncharacterized protein	0.717	107-119	RRTSARDRKAPAK
UP000006174	Ustilago hordei	I2FX29	Related to Meiotic expression upregulated protein 26	0.996	178-206	SKNVTKAKKASKKQPKASKPKKKATTRRP
UP000006174	Ustilago hordei	I2FX29	Related to Meiotic expression upregulated protein 26	0.604	164-165	KK
UP000006174	Ustilago hordei	I2FX98	Uncharacterized protein	0.774	111-118	RKRRKAKK
UP000006174	Ustilago hordei	I2FX98	Uncharacterized protein	0.763	674-683	KWTRKKPGKS
UP000006174	Ustilago hordei	I2FY68	Diadenosine tetraphosphate synthetase	0.835	165-173	KKSKKKKVK
UP000006174	Ustilago hordei	I2FYR8	Related to Tuftelin-interacting protein 11	0.998	350-394	RNEARRRGQGSPSPPPSGKKQKGKKEKRPVWTQPEREKKPRKPKI
UP000006174	Ustilago hordei	I2G0S7	Probable NOP58-required for pre-18S rRNA processing	0.984	528-581	KEERKALKKAKKEEGNGVETPKKEKKKRSADEAEVNGTPKSEPGSSKKKKSKKD
UP000006174	Ustilago hordei	I2G0S7	Probable NOP58-required for pre-18S rRNA processing	0.885	490-505	KLSKEERKALKKARKS
UP000006174	Ustilago hordei	I2G137	Glycylpeptide N-tetradecanoyltransferase	0.993	67-83	KQRKKKKSKAAAKLRKK
UP000006174	Ustilago hordei	I2G1L8	NTP_transf_9 domain-containing protein	0.769	626-636	RRPFKKRVWKR
UP000006174	Ustilago hordei	I2G2Q7	Related to mitotic spindle assembly checkpoint protein mad2b	0.679	372-376	SKRKR
UP000006174	Ustilago hordei	I2G3C1	Uncharacterized protein	0.67	561-574	NRRASLAPKPLKLK
UP000006174	Ustilago hordei	I2G4U3	UDENN domain-containing protein	0.723	1075-1082	KRKRRISK
UP000006174	Ustilago hordei	I2G5A3	Related to Vacuolar membrane protein	0.807	75-84	RQREKPKRKW
UP000006174	Ustilago hordei	I2G659	Uncharacterized protein	0.96	296-314	KKRLEKQEKKQKKRENKRE
UP000006174	Ustilago hordei	I2G6G1	FHA domain-containing protein	0.625	927-930	RGRK
UP000006174	Ustilago hordei	I2G6X5	Nucleolar GTP-binding protein 2	0.983	688-725	VKNKSRRGKPDAAELKSKERGPKVGANGKGAPQQRRRK
UP000006174	Ustilago hordei	I2G6X5	Nucleolar GTP-binding protein 2	0.714	664-678	RKTKKEARVTTSKRK
UP000006174	Ustilago hordei	I2G740	3'-5' exonuclease domain-containing protein	0.779	443-452	PKAKAKAKPK
UP000006174	Ustilago hordei	L7N6F6	Probable transposase	0.693	114-122	KKPKLLKRH
UP000006174	Ustilago hordei	I2FMF3	DNA-directed RNA polymerase	0.856	1483-1495	PKKKDGRKTKKDK
UP000006174	Ustilago hordei	I2FNE4	Golgi apparatus membrane protein TVP38	0.96	385-400	RRGAIRLRPRRKRRLS
UP000006174	Ustilago hordei	I2FPU5	Adenine DNA glycosylase	0.891	626-637	KRAKSTGKKSKR
UP000006174	Ustilago hordei	I2FPU5	Adenine DNA glycosylase	0.621	562-564	KKR
UP000006174	Ustilago hordei	I2FR17	Uncharacterized protein	0.777	73-80	ARPKRKRQ
UP000006174	Ustilago hordei	I2FTH4	Abhydrolase_3 domain-containing protein	0.956	1325-1339	DRFGRGKGRRKGRGR
UP000006174	Ustilago hordei	I2FVF2	Uncharacterized protein	1	1031-1065	KKQSRSAKRAAKRLAKEKRKRKAARRIRRAKREEA
UP000006174	Ustilago hordei	I2FVF2	Uncharacterized protein	0.874	1541-1558	RALKEAKQAERAKKRAAK
UP000006174	Ustilago hordei	I2FVF2	Uncharacterized protein	0.687	770-777	KGKPSKPK
UP000006174	Ustilago hordei	I2FVF2	Uncharacterized protein	0.624	1273-1276	KKNK
UP000006174	Ustilago hordei	I2FVF2	Uncharacterized protein	0.612	757-759	RKK
UP000006174	Ustilago hordei	I2FVG2	Uncharacterized protein	0.923	35-57	KQRDSEPHKHKPKSGPRLHRHPK
UP000006174	Ustilago hordei	I2FVG2	Uncharacterized protein	0.869	629-638	KDKKKRERKK
UP000006174	Ustilago hordei	I2FVG2	Uncharacterized protein	0.72	231-238	KRMVKRKR
UP000006174	Ustilago hordei	I2FW95	Related to SAD1-protein required for assembly of U4 snRNA into the U4/U6 particle	0.716	371-377	KPAKRKR
UP000006174	Ustilago hordei	I2FWY2	DNA topoisomerase 2	0.974	1252-1271	KMKKGKQIKKPAPKGGAARK
UP000006174	Ustilago hordei	I2FWY2	DNA topoisomerase 2	0.945	20-59	AKKTAAKAKPAAAKLKATTAKAGASKANGAVKPKKQPLSK
UP000006174	Ustilago hordei	I2FWY2	DNA topoisomerase 2	0.863	1308-1323	AKKKAAPARASPARKR
UP000006174	Ustilago hordei	I2FWY2	DNA topoisomerase 2	0.796	1429-1452	KNKKATAAKPAATKKTATGLGRKK
UP000006174	Ustilago hordei	I2G0U3	Sterol regulatory element-binding protein cleavage-activating protein	0.715	18-24	TRRRARR
UP000006174	Ustilago hordei	I2G3S1	MMtag domain-containing protein	0.99	154-265	RNEVRRRRAETGEDNGERRRSRKDEESRHHSSGRRRRDDDEDRERRHGRSHRHRDNELEEKESRRHRHHHSNSRRSRSRSRSRSRSPESSSYHRHRHHRHRYDDRHRSKHSR
UP000006174	Ustilago hordei	I2G4V5	Uncharacterized protein	0.92	1236-1262	RKGDKEKQARLDQILQRRGKEGKHKHR
UP000006174	Ustilago hordei	I2G4V5	Uncharacterized protein	0.737	1126-1135	AKGKTVKRKH
UP000006174	Ustilago hordei	I2G4V5	Uncharacterized protein	0.698	930-947	PKSKPQPSKSSAPPKNPA
UP000006174	Ustilago hordei	I2G5M4	PKS_ER domain-containing protein	0.998	1114-1134	SPSKEKKEKKKKDKSKHKRKA
UP000006174	Ustilago hordei	I2G5M4	PKS_ER domain-containing protein	0.668	1016-1022	PRPKSKK
UP000006174	Ustilago hordei	I2G610	Related to PRY1-strong similarity to the plant PR-1 class of pathogen related proteins	0.993	53-69	RHRKHHHKKGKKSKKAK
UP000006174	Ustilago hordei	I2FML6	F-box domain-containing protein	0.682	1167-1174	QKKKAEQR
UP000006174	Ustilago hordei	I2FNC9	Related to IVY1-phospholipid-binding protein	0.687	170-176	NRAGRKK
UP000006174	Ustilago hordei	I2FP27	Uncharacterized protein	0.919	177-194	RIRRRQRRREQQEKRKER
UP000006174	Ustilago hordei	I2FP92	Related to dna exoribonuclease Dhp1p	0.9	928-946	KRGSPERGRGKGRGGHGGP
UP000006174	Ustilago hordei	I2FP92	Related to dna exoribonuclease Dhp1p	0.877	1204-1226	PAGGRGGGRGGRGGGRGGGQGGR
UP000006174	Ustilago hordei	I2FP92	Related to dna exoribonuclease Dhp1p	0.777	415-430	RKEDEDRRENNKKRRE
UP000006174	Ustilago hordei	I2FPR7	Related to MAK11 protein (Maintenance of killer toxin-encoding satellite M1 dsRNA)	0.95	45-81	SAKPVKKPVPQRTRPKDEPKPKTKHEFIQAKKAAAIK
UP000006174	Ustilago hordei	I2FPR7	Related to MAK11 protein (Maintenance of killer toxin-encoding satellite M1 dsRNA)	0.616	35-36	KK
UP000006174	Ustilago hordei	I2FR47	Glycerophosphocholine acyltransferase 1	0.926	104-122	RSRARRRREQLVKKAKSKR
UP000006174	Ustilago hordei	I2FRM3	Uncharacterized protein	0.91	784-801	ARGSSKGKQKERASGKRG
UP000006174	Ustilago hordei	I2FRM3	Uncharacterized protein	0.696	277-287	RRKGEKVDLKK
UP000006174	Ustilago hordei	I2FS38	Uncharacterized protein	0.901	175-191	RLSRRSRRNKTRKHGSK
UP000006174	Ustilago hordei	I2FS39	Cation-transporting ATPase	0.777	140-153	GRRASKSSRRRISM
UP000006174	Ustilago hordei	I2FSZ9	Probable b mating type locus, bW1 allele	0.818	218-228	RRNRKGRKGPK
UP000006174	Ustilago hordei	I2FUN4	Related to GTPase-activating protein beta-chimerin	0.896	160-176	RSRKHAEQKRAKARREK
UP000006174	Ustilago hordei	I2FWQ6	Related to BDF1-sporulation protein	0.989	549-578	SKKSKSKGTKRKASESGAASKKKSKAKSAG
UP000006174	Ustilago hordei	I2FWQ6	Related to BDF1-sporulation protein	0.926	337-350	RKAARRKAAKKAAG
UP000006174	Ustilago hordei	I2FWQ6	Related to BDF1-sporulation protein	0.899	695-725	RPKKPAPTPNKNSKSAPLDGRKRGTGGIKKK
UP000006174	Ustilago hordei	I2FWQ6	Related to BDF1-sporulation protein	0.744	597-617	KKAKSAGSACKKKPSTSNKKD
UP000006174	Ustilago hordei	I2G124	Uncharacterized protein	0.758	295-307	ERERERRDRERKE
UP000006174	Ustilago hordei	I2G3F3	Conserved uncharacterized protein (Fragment)	0.817	16-26	KRSKRGRKLLK
UP000006174	Ustilago hordei	I2G4Q1	PHD domain-containing protein	0.949	96-115	KKSPSKSKKGGRNSRGKSTS
UP000006174	Ustilago hordei	I2G4Q1	PHD domain-containing protein	0.928	526-535	KKGGKKRKRG
UP000006174	Ustilago hordei	I2G4Q1	PHD domain-containing protein	0.781	472-493	RKGGASSRREESKEIPKSPKRR
UP000006174	Ustilago hordei	I2G4Q1	PHD domain-containing protein	0.662	221-227	RSRRGPG
UP000006174	Ustilago hordei	I2G4Q1	PHD domain-containing protein	0.657	425-432	AKKGTGKG
UP000006174	Ustilago hordei	I2FNN5	MRC1 domain-containing protein	0.978	412-428	KSKQSKPKKNKSKKSKR
UP000006174	Ustilago hordei	I2FNN5	MRC1 domain-containing protein	0.819	453-472	KRTASSKEKAPPKVKPLSKK
UP000006174	Ustilago hordei	I2FNN5	MRC1 domain-containing protein	0.781	1739-1748	RERKKAKNRR
UP000006174	Ustilago hordei	I2FNN5	MRC1 domain-containing protein	0.639	275-280	RGKGGQ
UP000006174	Ustilago hordei	I2FPE7	Probable arginine-specific carbamoyl-phosphate synthetase, ammonia chain	0.688	1085-1097	AKRIRFPVKDKRK
UP000006174	Ustilago hordei	I2FPI4	RNA-dependent RNA polymerase	0.792	1408-1414	KRRKRRK
UP000006174	Ustilago hordei	I2FQV3	Uncharacterized protein	0.947	535-548	KGHGRGSGRRKKKR
UP000006174	Ustilago hordei	I2FQV3	Uncharacterized protein	0.917	431-452	KELKDAEKKRIRERQKADRKSG
UP000006174	Ustilago hordei	I2FQV3	Uncharacterized protein	0.757	577-595	RARKKAAVAGGGESKEKRR
UP000006174	Ustilago hordei	I2FQV3	Uncharacterized protein	0.668	101-107	RKVRRPR
UP000006174	Ustilago hordei	I2FR00	Related to RPC53-47 kD subunit of DNA-directed RNA polymerase III	0.868	134-148	GGRGRGRGRGGARPP
UP000006174	Ustilago hordei	I2FR00	Related to RPC53-47 kD subunit of DNA-directed RNA polymerase III	0.681	255-268	KKDKQKVANARQKK
UP000006174	Ustilago hordei	I2FRK3	Probable SUI3-translation initiation factor eIF2 beta subunit	0.953	80-88	KKKKKSKKK
UP000006174	Ustilago hordei	I2FRK3	Probable SUI3-translation initiation factor eIF2 beta subunit	0.696	27-35	KKKNKTKHS
UP000006174	Ustilago hordei	I2FS07	Probable splicing factor 3b subunit 1	0.875	199-209	DRTPKAKRKRR
UP000006174	Ustilago hordei	I2FS07	Probable splicing factor 3b subunit 1	0.724	162-177	RLIEAKEKEQKEKKAE
UP000006174	Ustilago hordei	I2FWE6	Uncharacterized protein	0.747	137-147	KKPLRPRAGRK
UP000006174	Ustilago hordei	I2FWP3	Uncharacterized protein	0.987	114-145	SRKEREKERERARERDKEREREREKAKSKDDE
UP000006174	Ustilago hordei	I2FWP3	Uncharacterized protein	0.965	523-564	AFKSKRKSSHSRRRSRSRTGAISSGDEEERARKRELIRRARP
UP000006174	Ustilago hordei	I2FWP3	Uncharacterized protein	0.85	1341-1352	RAKAIKKRAKDR
UP000006174	Ustilago hordei	I2FWP3	Uncharacterized protein	0.727	651-658	RRRRERQA
UP000006174	Ustilago hordei	I2FZH5	Related to Na+/H+-exchanging protein	0.815	612-623	ARRRGRRDGRST
UP000006174	Ustilago hordei	I2G380	Uncharacterized protein	0.828	240-247	KRRGKKRA
UP000006174	Ustilago hordei	I2G3B0	SWIM-type domain-containing protein	0.996	96-135	RKYARSPSSSRSPAKSTKAKKPAAEKKESKAKPKKISKAA
UP000006174	Ustilago hordei	I2G626	RNA cytidine acetyltransferase	0.996	1155-1178	AEASPKKGSDKKNGKTKSKKQKRR
UP000006174	Ustilago hordei	I2G626	RNA cytidine acetyltransferase	0.787	68-83	RKKREQKIKNDIKRGI
UP000006174	Ustilago hordei	I2G6N7	Uncharacterized protein	0.927	129-147	KMMRRRKHRRSAAASASRR
UP000006174	Ustilago hordei	I2G6T4	Probable AFG3-protease of the SEC18/CDC48/PAS1 family of ATPases (AAA)	0.683	88-92	KKKKK
UP000006174	Ustilago hordei	I2G6T4	Probable AFG3-protease of the SEC18/CDC48/PAS1 family of ATPases (AAA)	0.681	819-825	KGRLKRK
UP000006174	Ustilago hordei	I2G6T4	Probable AFG3-protease of the SEC18/CDC48/PAS1 family of ATPases (AAA)	0.638	389-395	KYKKLGA
UP000006174	Ustilago hordei	I2FPP3	Related to PRIB protein	0.753	334-342	KRGRKPKSK
UP000006174	Ustilago hordei	I2FPU6	Uncharacterized protein	0.943	4-24	RRKSLTKASRIRARKRSAKIR
UP000006174	Ustilago hordei	I2FPX7	Uncharacterized protein	0.988	6-47	KPAKPKKAASPKKSSSQTKTGPKRGPRVIAPKKKAAVQAAKT
UP000006174	Ustilago hordei	I2FQL2	Uncharacterized protein	0.816	238-255	QRKASPSKSHRRTRPNPR
UP000006174	Ustilago hordei	I2FQM2	MI domain-containing protein	0.996	91-137	QKPKPKPKPKPKPKQHSQEKQKKDAAPCSAPKAESSKRKHEERPSKE
UP000006174	Ustilago hordei	I2FQM2	MI domain-containing protein	0.946	193-219	AEAGPSSKGKAKAKDGLGGPLKKKSRR
UP000006174	Ustilago hordei	I2FQM2	MI domain-containing protein	0.704	38-56	HDRRFDSRQGKARLKVIGR
UP000006174	Ustilago hordei	I2FRC9	Uncharacterized protein	0.683	537-549	RRRERQAAEARRH
UP000006174	Ustilago hordei	I2FRS8	Related to FUN30-protein important for chromosome integrity and segregation	0.965	143-161	RKPKKRRLVRGRPTRSHSR
UP000006174	Ustilago hordei	I2FS08	Histone acetyltransferase	0.903	535-544	KTAKKKRRRI
UP000006174	Ustilago hordei	I2FW45	Related to RAD7-nucleotide excision repair protein	0.807	141-148	KGKKKAKK
UP000006174	Ustilago hordei	I2FW45	Related to RAD7-nucleotide excision repair protein	0.727	243-250	KKKQPRRK
UP000006174	Ustilago hordei	I2FW45	Related to RAD7-nucleotide excision repair protein	0.618	118-121	KGKK
UP000006174	Ustilago hordei	I2FX63	Related to ENT2-clathrin binding protein, required for endocytosis	0.882	170-183	RRRRAERERNRRRP
UP000006174	Ustilago hordei	I2G093	Related to ELAV-like protein 2	0.808	625-636	RSRRKNKRLAAA
UP000006174	Ustilago hordei	I2G0D8	Related to MPP10-component of the U3 small nucleolar ribonucleoprotein	0.837	462-475	AKFNKKFGKRKASA
UP000006174	Ustilago hordei	I2G0D8	Related to MPP10-component of the U3 small nucleolar ribonucleoprotein	0.622	106-108	KRK
UP000006174	Ustilago hordei	I2G161	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.933	214-252	RSRHRSQHGRDQNPHDRRESRRHASSRSRSRSRSRERLP
UP000006174	Ustilago hordei	I2G161	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.927	1127-1152	KSNKKTKAKLEAATKKKGTAAAKKSA
UP000006174	Ustilago hordei	I2G161	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.795	768-775	PAKKRRPK
UP000006174	Ustilago hordei	I2G161	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.794	1064-1078	RHDSRSKSKSAAKRR
UP000006174	Ustilago hordei	I2G161	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.69	1190-1202	KAAKTKPAKVPIK
UP000006174	Ustilago hordei	I2G161	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.654	49-61	HRHAKLDRERHRP
UP000006174	Ustilago hordei	I2G161	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.633	1025-1029	AAAKR
UP000006174	Ustilago hordei	I2G1X0	Uncharacterized protein	0.779	581-590	QKKDKQRRRR
UP000006174	Ustilago hordei	I2G1Y6	Uncharacterized protein	0.715	483-492	KMTKSKKLKK
UP000006174	Ustilago hordei	I2G309	Ribosomal protein L19	0.949	52-110	RKPVVGGSRSRARATAAAKRAGRGTGQGHRKGSSEARMPTKVMWMRRQRVLRRLLRKYR
UP000006174	Ustilago hordei	I2G309	Ribosomal protein L19	0.755	162-176	RRMRNKAMRERRAQR
UP000006174	Ustilago hordei	I2G372	Uncharacterized protein	0.968	174-188	RPKLRRKRKGRSENG
UP000006174	Ustilago hordei	I2G3J6	Related to ARO80-positive transcription regulator of ARO9 and ARO10	0.704	549-558	GGRKQTRRRS
UP000006174	Ustilago hordei	I2G6D7	Uncharacterized protein	0.637	1076-1081	RGGRGR
UP000006174	Ustilago hordei	I2FPA4	PITH domain-containing protein	0.834	911-921	KRRIVKKRKSR
UP000006174	Ustilago hordei	I2FPJ6	Related to cation diffusion facilitator 10	0.929	209-226	NKKNQRPRSSNKGKRRNK
UP000006174	Ustilago hordei	I2FQ17	Uncharacterized protein	0.844	54-76	GNAPKKDKKDGGGDQKKDEKKDG
UP000006174	Ustilago hordei	I2FQ17	Uncharacterized protein	0.738	90-109	EKKQEGGGGGGGGGGGKRGG
UP000006174	Ustilago hordei	I2FQZ8	Uncharacterized protein	0.987	215-287	PRKKSKARTPVKSRRSIAEEAESSAEPERKAAKQSPLKTPLKKKTAKTSPAKEAASEKPTKEKGKGKATGLAK
UP000006174	Ustilago hordei	I2FR71	Uncharacterized protein	0.723	311-316	RRSRRK
UP000006174	Ustilago hordei	I2FS64	YDG domain-containing protein	0.83	478-491	VARRSPRKSKASWK
UP000006174	Ustilago hordei	I2FTC9	Uncharacterized protein	0.915	14-63	RGRKHGRSHREHQESSRSSRSHRDRGKDRDQGDFHRRSRSPSPRPRRSDR
UP000006174	Ustilago hordei	I2FTW8	Uncharacterized protein	0.764	245-256	KKKWRDMVKKRR
UP000006174	Ustilago hordei	I2FUU7	DUF4604 domain-containing protein	0.963	170-229	SREKGKGNGTSKGGLKDVKDLIRKERDARAPTKTDKEQHKDDKSKEKIAAAKKLKAKSGK
UP000006174	Ustilago hordei	I2FVC5	Related to PET8-Protein of the mitochondrial carrier family (MCF)	0.642	109-114	RPKRHS
UP000006174	Ustilago hordei	I2FWE5	Probable LSG1-Large-Subunit GTPase involved in 60S ribosomal subunit biogenesis	0.972	692-709	KAGSKKHNKANKRKKQRS
UP000006174	Ustilago hordei	I2FX87	SET domain-containing protein	0.994	639-673	NAKKKKDLKDAGKRKGGSSNGKPRNSGSDKKKQRR
UP000006174	Ustilago hordei	I2FXN4	Flap endonuclease 1	0.996	356-374	APKRKAEQDKKGAKKKGKK
UP000006174	Ustilago hordei	I2FZ84	Lipase_3 domain-containing protein	0.886	511-533	RRMREREKARKQAEKLAARNRPA
UP000006174	Ustilago hordei	I2FZ84	Lipase_3 domain-containing protein	0.74	214-222	RRRRSQRKR
UP000006174	Ustilago hordei	I2FZ84	Lipase_3 domain-containing protein	0.7	1111-1122	PKKKADSQGHRK
UP000006174	Ustilago hordei	I2G0D4	Uncharacterized protein	0.673	498-503	KHGRRR
UP000006174	Ustilago hordei	I2G0N5	Probable 40S RIBOSOMAL PROTEIN S24	0.999	94-134	RIGLAEKTEKASRKLRKERKNRAKKVRGTKKTKAAEASKKK
UP000006174	Ustilago hordei	I2G0R0	Translocation protein SEC62	0.807	340-362	PPKKKSKSDSSGAAGAGEKKKAS
UP000006174	Ustilago hordei	I2G187	Uncharacterized protein	0.951	16-74	HSSSRREKEREDRHRHHHRDSKHRHDDDRKHSSRSDSNRKERAKGDDGHRHRHHHSSHR
UP000006174	Ustilago hordei	I2G187	Uncharacterized protein	0.932	85-107	DRNDRKKRRREDDERRHDSRSHH
UP000006174	Ustilago hordei	I2G187	Uncharacterized protein	0.616	860-862	KRR
UP000006174	Ustilago hordei	I2G394	Related to SUR1-required for mannosylation of sphingolipids	0.719	413-419	SRRRSKR
UP000006174	Ustilago hordei	I2G524	Probable electron transfer flavoprotein subunit beta	0.756	217-225	KAKKKPFKK
UP000006174	Ustilago hordei	I2G579	Related to SNF4-nuclear regulatory protein	0.882	40-55	SRARREREKSGRPKDK
UP000006174	Ustilago hordei	I2G5M8	Uncharacterized protein	0.938	587-607	EKKRSLKRDKSERIRGRRASQ
UP000006174	Ustilago hordei	I2G5M8	Uncharacterized protein	0.909	807-853	GRNGKSKPEEGVWRRGGMLDAPPKGKASGDRKSSGKTGRVGSKTRAG
UP000006174	Ustilago hordei	I2G5M8	Uncharacterized protein	0.791	984-997	GASTRKRGGFGAKK
UP000006174	Ustilago hordei	I2G5M8	Uncharacterized protein	0.664	50-61	AKPSPKTPARDK
UP000006174	Ustilago hordei	I2G604	PX domain-containing protein	0.928	999-1012	EKARRRRKIPAPKA
UP000006174	Ustilago hordei	L7N6C8	Related to n-terminal acetyltransferase 1	0.98	600-632	KAEKKKLLKKQRQAEAKKAAKAEAEAAEKKKKA
UP000006174	Ustilago hordei	I2FMS9	Related to RAD2-structure-specific nuclease of the nucleotide excision repairosome	0.978	1461-1480	RTAPARGRGRGRGRARARGK
UP000006174	Ustilago hordei	I2FMS9	Related to RAD2-structure-specific nuclease of the nucleotide excision repairosome	0.908	464-475	ARRPRRKRGERP
UP000006174	Ustilago hordei	I2FMS9	Related to RAD2-structure-specific nuclease of the nucleotide excision repairosome	0.857	84-100	KRKTLSGRKARKQGAKE
UP000006174	Ustilago hordei	I2FMS9	Related to RAD2-structure-specific nuclease of the nucleotide excision repairosome	0.699	1418-1425	KRKKIAAR
UP000006174	Ustilago hordei	I2FNB5	Related to NOT3-general negative regulator of transcription, subunit 3	0.654	153-156	KKKK
UP000006174	Ustilago hordei	I2FP43	Related to DEG1-pseudouridine synthase	0.886	58-68	KKGGKKEKKAK
UP000006174	Ustilago hordei	I2FP43	Related to DEG1-pseudouridine synthase	0.635	637-640	KRRA
UP000006174	Ustilago hordei	I2FQL7	Uncharacterized protein	0.983	304-322	PRRPKRRHRRSAAGRSSKR
UP000006174	Ustilago hordei	I2FQL7	Uncharacterized protein	0.722	169-180	RGAPRSASRRRP
UP000006174	Ustilago hordei	I2FQU3	Uncharacterized protein	0.865	945-955	RKMRKRQRKLR
UP000006174	Ustilago hordei	I2FQU3	Uncharacterized protein	0.845	205-220	MRHHRLHKEERRQKRR
UP000006174	Ustilago hordei	I2FQU3	Uncharacterized protein	0.799	156-163	EKRRRRGL
UP000006174	Ustilago hordei	I2FTK8	Related to CCH1-Calcium channel (Alpha subunit)	0.733	1636-1641	KRPKRR
UP000006174	Ustilago hordei	I2FUS2	Related to MRPS28-mitochondrial ribosomal protein, small subunit	0.846	50-60	RKKRTARLKRK
UP000006174	Ustilago hordei	I2FVB3	AdoMet-dependent rRNA methyltransferase SPB1	0.999	855-928	KGGQKKKEVQLVVAKGVNRGLKGRPKGTKGRYKMVDPRMKKELRAFKRKAKRDGKKLGSSNHKPRAAKGYGPRN
UP000006174	Ustilago hordei	I2FVB3	AdoMet-dependent rRNA methyltransferase SPB1	0.982	799-827	DARPIKKVAEAKARKKMRTLRRLEKAQKK
UP000006174	Ustilago hordei	I2FVB3	AdoMet-dependent rRNA methyltransferase SPB1	0.979	387-404	ARKARKERRRKNEMRQKK
UP000006174	Ustilago hordei	I2FW12	DUF4187 domain-containing protein	0.957	71-90	KRRKLEAHSSRKKRPKSLKQ
UP000006174	Ustilago hordei	I2FWD5	Uncharacterized protein	0.953	435-445	KSKKKQKKPKK
UP000006174	Ustilago hordei	I2FZP9	Uncharacterized protein	0.79	241-257	SHRSGKGSKDGKKSQKP
UP000006174	Ustilago hordei	I2G0L2	Uncharacterized protein	0.669	444-448	GKKKG
UP000006174	Ustilago hordei	I2G0Q8	Uncharacterized protein	0.999	522-580	DVRDRGGNRMKREGERERDRARAGESREDRRRRKEAKRQQRERREDGTDRERRKKKRRD
UP000006174	Ustilago hordei	I2G2U7	Uncharacterized protein	0.916	394-422	PRRSSRRSLPSPKKQIANDKATKKGKGKQ
UP000006174	Ustilago hordei	I2G2U7	Uncharacterized protein	0.891	271-291	KSKAAAKEGAANKTKGKRRSR
UP000006174	Ustilago hordei	I2G2U7	Uncharacterized protein	0.79	186-199	KKKTKKQGESPRRR
UP000006174	Ustilago hordei	I2G434	Related to Ca2+-transporting ATPase	0.79	1103-1126	GRWPWLARISGGHRGLERRQAKKR
UP000006174	Ustilago hordei	I2G5W1	Uncharacterized protein	0.996	488-594	EKREKRAMSGVEARLKGKIASGSAAQKRGKRSKGKQQKLDEAIVAKKAASRKKSSGSRAKNSGSNARSHARKPARSGTRKLRTRQGLARENRARAIAAQKSKRRGAR
UP000006174	Ustilago hordei	I2G5W1	Uncharacterized protein	0.993	68-89	HKKEAKKSKTAKAARGKKPKKA
UP000006174	Ustilago hordei	I2G5W1	Uncharacterized protein	0.935	356-384	RKNNKKAAAEQKDGKRVRLSHAQRKAKKR
UP000006174	Ustilago hordei	I2G5W1	Uncharacterized protein	0.635	801-815	AKAKSAAVPAAKPVK
UP000006174	Ustilago hordei	I2G668	Fcf2 domain-containing protein	0.96	459-470	GRRKPPSKKKRT
UP000006174	Ustilago hordei	I2G6Q4	Uncharacterized protein	0.96	13-27	FKGDKPKKRKRSGEK
UP000006174	Ustilago hordei	I2G6Q4	Uncharacterized protein	0.832	324-336	RRALRKAQKKGRL
UP000006174	Ustilago hordei	I2FM66	Uncharacterized protein	0.961	142-156	RKKPLYRKKPKNKKF
UP000006174	Ustilago hordei	I2FMC1	Uncharacterized protein	0.911	158-173	ATKKKWRDMVKKRRGR
UP000006174	Ustilago hordei	I2FP46	BHLH domain-containing protein	0.767	364-377	KKPRRSIQSRRSRK
UP000006174	Ustilago hordei	I2FP46	BHLH domain-containing protein	0.679	52-56	KRRKR
UP000006174	Ustilago hordei	I2FPS8	Probable RPL11B-ribosomal protein L11	0.748	140-157	VARRKQRVSRVGAPHRVK
UP000006174	Ustilago hordei	I2FS02	ATP pyrophosphate-lyase	0.859	403-418	KKERRRIKGVRHHLGK
UP000006174	Ustilago hordei	I2FT60	Uncharacterized protein	0.775	93-107	WRRRKSNSNPNRKAR
UP000006174	Ustilago hordei	I2FT60	Uncharacterized protein	0.736	658-668	RRKIGTKKAKI
UP000006174	Ustilago hordei	I2FY14	Multiple RNA-binding domain-containing protein 1	0.972	107-135	EGRGEGKKRKFDKADGKDGEGQKKRGKKG
UP000006174	Ustilago hordei	I2FY14	Multiple RNA-binding domain-containing protein 1	0.968	178-193	EKKAEKKAEKKAKKAA
UP000006174	Ustilago hordei	I2FYA6	Uncharacterized protein	0.851	181-204	GGAKKQDQKQDKKEDKKEEKKEEK
UP000006174	Ustilago hordei	I2FZH2	Uncharacterized protein	0.823	48-56	ARRRRARRR
UP000006174	Ustilago hordei	I2FZS2	F-box domain-containing protein	0.875	287-300	AKGGKFKGKREKGG
UP000006174	Ustilago hordei	I2G1L2	PWI domain-containing protein	0.99	259-321	PSRRSPSPPPRHRRRSPSPVPPPRPSPPPRSPSRSRSVTPDYRAAIRENKRSAQPSRSKHPKP
UP000006174	Ustilago hordei	I2G1L2	PWI domain-containing protein	0.917	126-173	EKKEELRKKREEGERVVREARERAARAAESAGASGEAVAREGKRRSRW
UP000006174	Ustilago hordei	I2G1L2	PWI domain-containing protein	0.819	424-442	RELRNKLLRAKSSRSSKKA
UP000006174	Ustilago hordei	I2G291	Uncharacterized protein	0.863	72-89	RRGGSSAAARRRARARSR
UP000006174	Ustilago hordei	I2G291	Uncharacterized protein	0.796	274-284	KARRKAERKTA
UP000006174	Ustilago hordei	I2G291	Uncharacterized protein	0.676	593-600	KRVKKSYR
UP000006174	Ustilago hordei	I2G291	Uncharacterized protein	0.606	433-433	K
UP000006174	Ustilago hordei	I2G291	Uncharacterized protein	0.602	435-435	K
UP000006174	Ustilago hordei	I2G4I1	Uncharacterized protein	0.823	168-187	PAKDSHKAQERPSNRRRLKR
UP000006174	Ustilago hordei	I2G4J6	MIT domain-containing protein	0.961	700-718	PRRRRRDHRRPGSRGSRGS
UP000006174	Ustilago hordei	I2G4J6	MIT domain-containing protein	0.804	544-559	RNGKRSRPSREEERRR
UP000006174	Ustilago hordei	I2G4K6	Uncharacterized protein	0.963	75-90	KGAGSKSKKTAKRKRR
UP000006174	Ustilago hordei	I2G4K6	Uncharacterized protein	0.732	144-148	KKKKK
UP000006174	Ustilago hordei	I2G5Y8	Probable protein kinase CK2 alpha subunit	0.902	74-84	KPVKKKKIKRE
UP000006174	Ustilago hordei	I2G620	Related to mitochondrial import receptor subunit TOM20	0.965	29-57	RRTDPAFRKGLKKESKKLSKVEKEKAAKR
UP000006174	Ustilago hordei	I2G734	Probable ZUO1-zuotin	0.995	299-381	KQFKADDKAAREAKKNKGRPGVNGAAGAVDPRKAAEEKKKAEEEAKRKAEEEAKAAEQEKAAKADAKKAKEAAKKAIKKEKKA
UP000006174	Ustilago hordei	I2G734	Probable ZUO1-zuotin	0.909	266-280	EKKNRNERARRKKED
UP000006174	Ustilago hordei	I2G734	Probable ZUO1-zuotin	0.638	129-134	RKKVLK
UP000006174	Ustilago hordei	I2FPA8	Related to RNA-binding protein rnp24	0.993	312-333	KRNPPKASKKERKQKSKKPTKK
UP000006174	Ustilago hordei	I2FPA8	Related to RNA-binding protein rnp24	0.955	520-550	PKKHKETKEERMARRAAGGARGREKVTRARP
UP000006174	Ustilago hordei	I2FPA8	Related to RNA-binding protein rnp24	0.764	84-90	RRRKKAA
UP000006174	Ustilago hordei	I2FPA8	Related to RNA-binding protein rnp24	0.761	36-50	EKRRAKETASPTKRK
UP000006174	Ustilago hordei	I2FPK6	Uncharacterized protein	0.716	1202-1211	SLGRSRGKKS
UP000006174	Ustilago hordei	I2FPV9	Related to syntaxin binding protein 1	0.788	834-847	KEKKRLKNPFSFKK
UP000006174	Ustilago hordei	I2FQ39	Origin recognition complex subunit 1	0.906	360-388	PKRRPGRPRKEDSLSAGIEAPKRKYNRKR
UP000006174	Ustilago hordei	I2FRP7	Probable 40S ribosomal protein S2	0.994	8-33	PRGRGGFGRDRGGRGRRGPRRGGRRD
UP000006174	Ustilago hordei	I2FRW2	Uncharacterized protein	0.622	137-139	RRR
UP000006174	Ustilago hordei	I2FRW5	ATP-dependent RNA helicase DBP10	0.998	1099-1182	KGRPGQAKRQAAKDEVKSARQIQKEREIKQNRMEKNARPSKKDGKGGRGGGGRGRGGGRGGGRGGGRGGGRGGGGRGGGRGGRR
UP000006174	Ustilago hordei	I2FRW5	ATP-dependent RNA helicase DBP10	0.933	438-459	GNRKSNFKGKPSKFNGKRKRTG
UP000006174	Ustilago hordei	I2FRW5	ATP-dependent RNA helicase DBP10	0.632	849-852	KKGK
UP000006174	Ustilago hordei	I2FRY2	Related to ADA2-general transcriptional adaptor or co-activator	0.66	568-572	KSKKG
UP000006174	Ustilago hordei	I2FSB8	Replication termination factor 2	0.992	244-259	KAEKRRRKAQKKAKKK
UP000006174	Ustilago hordei	I2FSB8	Replication termination factor 2	0.942	213-229	KRRAEEKANKKKAKART
UP000006174	Ustilago hordei	I2FTB3	Nkap_C domain-containing protein	0.996	253-333	REPEKRKRSSRHKDKHRSDKHRHSSSSKSHRHHSSSSRHHHSSRHKDGKESSSSHRHSRSSRSRRDEEERRRRRSKRSRSK
UP000006174	Ustilago hordei	I2FTB3	Nkap_C domain-containing protein	0.924	352-377	RRHRHRSSRHHSRNGSDKRHRSGRHR
UP000006174	Ustilago hordei	I2FTB3	Nkap_C domain-containing protein	0.892	61-85	IGRSRSKSASPRSERSRSPRQRRGP
UP000006174	Ustilago hordei	I2FTB3	Nkap_C domain-containing protein	0.754	392-404	RRRSRSRSKHSAS
UP000006174	Ustilago hordei	I2FTS5	RF_PROK_I domain-containing protein	0.999	375-411	KLLRGERGGSRIDRQIEKERRKKINKKKKQKKRQKEK
UP000006174	Ustilago hordei	I2FW85	Related to LTV1-low-temperature viability protein	0.999	677-728	KRDKNESKEDRKARKEALKANKKERKERKMKTKQAFASEKKKQTKAERGRKE
UP000006174	Ustilago hordei	I2FW85	Related to LTV1-low-temperature viability protein	0.631	329-332	KGKP
UP000006174	Ustilago hordei	I2FWF2	Zn(2)-C6 fungal-type domain-containing protein	0.952	184-199	RKERRRGIKRGPYKRR
UP000006174	Ustilago hordei	I2FXB5	Uncharacterized protein	0.806	503-511	RRPNRRRRR
UP000006174	Ustilago hordei	I2FXB5	Uncharacterized protein	0.803	447-455	KRSKKSRRK
UP000006174	Ustilago hordei	I2G0G6	Zn(2)-C6 fungal-type domain-containing protein	0.699	161-168	GTRPHRRR
UP000006174	Ustilago hordei	I2G0G6	Zn(2)-C6 fungal-type domain-containing protein	0.659	141-149	RGPLSKKER
UP000006174	Ustilago hordei	I2G1A8	Related to pheromone response factor Prf1	0.968	253-287	EPSKAIKRAREATRPRQKHSTAIPARKRAKTAKGK
UP000006174	Ustilago hordei	I2G1A8	Related to pheromone response factor Prf1	0.897	116-142	IKRLPPSKRPGVSHAKKNPPNHIKRPR
UP000006174	Ustilago hordei	I2G2A6	Structure-specific endonuclease subunit SLX1	0.914	584-594	KKAKAKAKRKS
UP000006174	Ustilago hordei	I2G2A6	Structure-specific endonuclease subunit SLX1	0.664	558-564	KARGKAK
UP000006174	Ustilago hordei	I2G2D0	Uncharacterized protein	0.618	259-261	KKK
UP000006174	Ustilago hordei	I2G421	Uncharacterized protein	0.972	30-40	GKLKRKKKKPK
UP000006174	Ustilago hordei	I2G421	Uncharacterized protein	0.824	264-278	KKREKGPQKPKYKGP
UP000006174	Ustilago hordei	I2G421	Uncharacterized protein	0.699	131-142	AARLAREERRKR
UP000006174	Ustilago hordei	I2G5R8	F-box domain-containing protein	0.701	67-74	RRQKKLRR
UP000006174	Ustilago hordei	I2FM76	Uncharacterized protein	0.935	63-82	QKVKSEPEEKGKDRLKKKPK
UP000006174	Ustilago hordei	I2FNS8	Mediator of RNA polymerase II transcription subunit 14	0.679	394-399	KKPKKA
UP000006174	Ustilago hordei	I2FNT9	Related to siderophore iron transporter mirc	0.795	1100-1107	QKKRRSRR
UP000006174	Ustilago hordei	I2FPN2	Uncharacterized protein	0.999	179-225	EKKLAKRALRKQLAEAGQPKQKKSKKAREDKKEKKGKKDKKDKKANK
UP000006174	Ustilago hordei	I2FPN2	Uncharacterized protein	0.996	265-297	KDKKDKSGKKDEGDKRDKRQKKAKKPNTDKKQR
UP000006174	Ustilago hordei	I2FPN2	Uncharacterized protein	0.931	243-251	PSKKRKRKR
UP000006174	Ustilago hordei	I2FQ98	Uncharacterized protein	0.732	75-81	RRKRARE
UP000006174	Ustilago hordei	I2FQM3	Probable ROK1-ATP-dependent RNA helicase	0.977	540-587	KGPGKKGRKTLKQRAPERKDIRTSAASSVGRREANKRREMVAASKRRK
UP000006174	Ustilago hordei	I2FQQ5	18S rRNA factor 2	1	136-165	AKKEKKEKKGKKEKKEKKEKKEKKEKKAKP
UP000006174	Ustilago hordei	I2FQQ5	18S rRNA factor 2	0.936	371-390	VERARVQKDKLERRKRKAEK
UP000006174	Ustilago hordei	I2FQZ9	eIF-2B GDP-GTP exchange factor subunit epsilon	0.78	161-166	KRRRKK
UP000006174	Ustilago hordei	I2FTC3	B-block_TFIIIC domain-containing protein	0.995	627-674	PAPKRGRPRKHPVEPDAPPPKRGRPRKHPVEPSPDEPVTPRKRGRPRK
UP000006174	Ustilago hordei	I2FTC3	B-block_TFIIIC domain-containing protein	0.803	1480-1489	AQGRRKRRTR
UP000006174	Ustilago hordei	I2FTC3	B-block_TFIIIC domain-containing protein	0.67	605-614	RKGAPRLGRS
UP000006174	Ustilago hordei	I2FTG4	Uncharacterized protein	0.84	59-74	SPRKLEKRRHLQKNKT
UP000006174	Ustilago hordei	I2FTP8	DPBB_1 domain-containing protein	0.621	160-163	KPKK
UP000006174	Ustilago hordei	I2FVU7	Uncharacterized protein	0.974	100-126	KKGPDRRKKRAASNPTAELRRSRRRTG
UP000006174	Ustilago hordei	I2FVU7	Uncharacterized protein	0.803	143-176	ARGSPSKRSTGGRGGRGEQEGRGGQGGQGGRGGR
UP000006174	Ustilago hordei	I2FYD6	Uncharacterized protein	0.969	312-324	GRKRPGKRGKRLK
UP000006174	Ustilago hordei	I2FYD6	Uncharacterized protein	0.769	653-663	RRIGPGRPKKH
UP000006174	Ustilago hordei	I2G080	Uncharacterized protein	0.998	197-291	KKQEELEKKKLAAAPPSKRALTKKQKAAEFRQKKKEKALKRKALKEANSDSKADESSNKAKKVASPEKKAEVASPEKKVRSPTKKARSPTKKAKT
UP000006174	Ustilago hordei	I2G080	Uncharacterized protein	0.785	86-93	TKRKRSKK
UP000006174	Ustilago hordei	I2G0V4	Related to cleft lip and palate transmembrane protein 1 (CLPTM1)	0.855	268-276	PLKRKRKEK
UP000006174	Ustilago hordei	I2G384	Probable MTR4-involved in nucleocytoplasmic transport of mRNA	0.806	29-37	KKQKKRSKA
UP000006174	Ustilago hordei	I2G3Y7	Uncharacterized protein	0.975	183-197	GPKRQERRHPRRRKK
UP000006174	Ustilago hordei	I2G3Z0	Related to RNA-binding region containing protein 2	0.95	68-125	RGRGRSMAASSRSSHASSPSRSRSRSRDSARSRKSHQSRKSSSRADEEMEEKRKRRRG
UP000006174	Ustilago hordei	I2G3Z0	Related to RNA-binding region containing protein 2	0.865	156-167	ARERRRRRSDRS
UP000006174	Ustilago hordei	I2G3Z0	Related to RNA-binding region containing protein 2	0.796	240-250	ARRAPRRRGGR
UP000006174	Ustilago hordei	I2G404	Ribosomal RNA-processing protein 36	0.996	401-470	GKRVSGQEKKQLKKALERRRRKNAQKEKRDMPAGIGFAREGQGAAVPKRKRMVEGGPSGQSRNKRAMFRR
UP000006174	Ustilago hordei	I2G404	Ribosomal RNA-processing protein 36	0.917	328-366	KVEAALRRAEGLAGERERRQRESVVKGKIKRENKERVEK
UP000006174	Ustilago hordei	I2G404	Ribosomal RNA-processing protein 36	0.901	212-242	AREARRQEKERKELAKRSNKNAPTEMSSKRP
UP000006174	Ustilago hordei	I2G405	WD_REPEATS_REGION domain-containing protein	0.994	563-618	GPKKEKKEKNRMRGKNKALSRYLRKKRENVIDPNRIAVKQRMEKMRKEEEQKRKRK
UP000006174	Ustilago hordei	I2G4Q6	HTH CENPB-type domain-containing protein	0.627	608-615	KAKGTPGK
UP000006174	Ustilago hordei	I2G6L6	Uncharacterized protein	0.899	197-213	KRRRKQAKELAEAKKDK
UP000006174	Ustilago hordei	I2G707	Related to Smad nuclear interacting protein 1	0.929	50-126	ERRSHSHRDDRDRDRHRDGRSNRHRERGTNGTSGSRRHKEDADDRRRSNSYLKRHRDGEDRDARKSSRHRDDKKRAS
UP000006174	Ustilago hordei	I2G707	Related to Smad nuclear interacting protein 1	0.863	142-167	KHRHREERTPRGGSSRDHRRSRSRSP
UP000006174	Ustilago hordei	I2FNA2	Mitogen-activated protein kinase	0.944	294-343	PRSPSRSPSRSPSRSPSRSPSRSPSRSPSRSPSRSPSRSPSRSPSRSPSR
UP000006174	Ustilago hordei	I2FNB8	cwf21 domain-containing protein	0.995	163-222	RKKQERLEERRKADEQRKLDWERKKREREDEKRARERRDGGWGGRGSQRSPSPRPKKRGK
UP000006174	Ustilago hordei	I2FNB8	cwf21 domain-containing protein	0.995	238-334	RRERKGKDVGRRRKRTRSPSFSDSRSISSRSRSRSRSPVRRRSRRSPLRSIYKTRSRSRSRSSESGSYSSRSRSRSRTPPRRRVRSRSISSRSRSRS
UP000006174	Ustilago hordei	I2FNB8	cwf21 domain-containing protein	0.978	389-495	RSRSRSPVRRRRRPSVSSGSGSRSRSIDSRSRSRSVDSRSATPPPRGGPKRARVRDAFSPSPSPSPSPSRSRSRSLSRSSSRSRSRSRSISAVRRKPPGPPPARPPG
UP000006174	Ustilago hordei	I2FNB8	cwf21 domain-containing protein	0.872	356-372	PSRSRSPPRKTRGRSRS
UP000006174	Ustilago hordei	I2FP99	DUF4211 domain-containing protein	0.982	322-357	RLKRKKDKQETRKRKQAELEQQAKKRKKDAKTPKSK
UP000006174	Ustilago hordei	I2FP99	DUF4211 domain-containing protein	0.86	403-421	AKFAQARRKARLERGGGKR
UP000006174	Ustilago hordei	I2FP99	DUF4211 domain-containing protein	0.855	775-796	PGKEKEKGKGDGKELERLRRRL
UP000006174	Ustilago hordei	I2FP99	DUF4211 domain-containing protein	0.689	739-747	RKGKDGRGK
UP000006174	Ustilago hordei	I2FP99	DUF4211 domain-containing protein	0.643	112-117	LRKERK
UP000006174	Ustilago hordei	I2FQB8	Probable Leptomycin B resistance protein pmd1	0.896	154-167	KRSEPKRSRSKKKH
UP000006174	Ustilago hordei	I2FSS6	Related to UTR1 (Associated with ferric reductase activity)	0.953	555-565	TSKKKGKKGKK
UP000006174	Ustilago hordei	I2FT23	Uncharacterized protein	0.715	44-50	PAAKKRK
UP000006174	Ustilago hordei	I2FUQ3	Related to proliferation associated SNF2-like protein	0.892	604-615	KPKRGRGRPPKN
UP000006174	Ustilago hordei	I2FUQ3	Related to proliferation associated SNF2-like protein	0.729	120-137	KERKARAEAAAKQQARRN
UP000006174	Ustilago hordei	I2FVP5	Related to CEF1-required during G2/M transition	0.985	178-218	GKKAKRKARERALEEARRLAMLQKRRELKAAGITIKQKPKK
UP000006174	Ustilago hordei	I2FY00	CBF domain-containing protein	0.958	329-339	AGRKKKKSKKA
UP000006174	Ustilago hordei	I2FY00	CBF domain-containing protein	0.723	406-412	SNKRKRR
UP000006174	Ustilago hordei	I2FY00	CBF domain-containing protein	0.666	825-829	RAKKR
UP000006174	Ustilago hordei	I2FY00	CBF domain-containing protein	0.652	787-792	REERKR
UP000006174	Ustilago hordei	I2FY05	Uncharacterized protein	0.996	163-194	PPPKPGPSRRKPPPLIVRIKAKARRAKRKQQK
UP000006174	Ustilago hordei	I2FY52	RING-type domain-containing protein	0.883	93-107	RQAAKEKKHKLRQKK
UP000006174	Ustilago hordei	I2FYM4	Related to gamma-tubulin complex component 5	0.999	1028-1050	EKDRQARRKRRERRKKRRDKAKR
UP000006174	Ustilago hordei	I2G095	Uncharacterized protein	0.999	725-776	KRRTAERRIERHERHRARKEKKRERAARAEARRIKKSQAEEKQKRKAAEQAE
UP000006174	Ustilago hordei	I2G095	Uncharacterized protein	0.93	1034-1064	RARRATSSASRGGGRKGVARSRSPSRARMRV
UP000006174	Ustilago hordei	I2G0R3	Probable b-induced zinc finger protein	0.82	117-126	RKKRRRYGPK
UP000006174	Ustilago hordei	I2G1F0	BHLH domain-containing protein	0.75	498-530	IRKNRSTTAEARANKVRPSPLMKPVSGPLKKKK
UP000006174	Ustilago hordei	I2G1I0	Related to SEN1 protein	0.709	2130-2135	DPKKRK
UP000006174	Ustilago hordei	I2G2J3	Related to CHA1-L-serine/L-threonine deaminase	0.703	342-350	KGLKGKKER
UP000006174	Ustilago hordei	I2G2V0	Related to BRE4-protein involved in endocytosis	0.74	913-925	RKQRFKHGKSAKT
UP000006174	Ustilago hordei	I2G301	Iwr1 domain-containing protein	0.607	298-300	RSK
UP000006174	Ustilago hordei	I2G451	Uncharacterized protein	0.99	417-485	PKEKRKAKEPAELSSEKQKEKEEKEAARTERLKAKEAKRLEREAKELERQKAKEAKEVEIKKAEEQKKR
UP000006174	Ustilago hordei	I2G451	Uncharacterized protein	0.9	773-784	PKKKKKVKLLGR
UP000006174	Ustilago hordei	I2G451	Uncharacterized protein	0.627	593-596	RRRK
UP000006174	Ustilago hordei	I2G4K1	Related to U4/U6 snRNP-associated 61 kDa protein	0.997	433-457	PVPKEGSGGKKRRGGRKARKAKERN
UP000006174	Ustilago hordei	I2G4P5	Probable SKI2-antiviral protein and putative helicase	0.874	535-589	KRKQEKEREANAAATGGGGAARGGRGGGAAGSNSRGRGGMVPARGAAPRGRGGAN
UP000006174	Ustilago hordei	I2G6G5	DNA polymerase epsilon catalytic subunit	0.943	1279-1296	KKKWRKQRLQRAKDRKAR
UP000006174	Ustilago hordei	I2G6P4	Uncharacterized protein	0.856	395-413	PRKRGRKPVLEPGEAQRRR
UP000006174	Ustilago hordei	I2FM18	Uncharacterized protein	0.81	163-172	KARPRKKLWK
UP000006174	Ustilago hordei	I2FM18	Uncharacterized protein	0.609	188-189	RR
UP000006174	Ustilago hordei	I2FM75	Uncharacterized protein	0.787	1282-1312	RRAGGTQRRAKNKSVLNQRSLGTIKKRKQEK
UP000006174	Ustilago hordei	I2FNG4	Conserved uncharacterized protein	0.983	117-134	RASKKRASRSGKKPRPRR
UP000006174	Ustilago hordei	I2FQ83	Related to RRP6-Exonuclease component of the nuclear exosome	0.995	963-999	KKEERKEKVGKAKPKGKGEKKTEEAIFRQPRDRARRK
UP000006174	Ustilago hordei	I2FQ83	Related to RRP6-Exonuclease component of the nuclear exosome	0.959	907-924	TSSKKELKKKRKAEAAAA
UP000006174	Ustilago hordei	I2FQ83	Related to RRP6-Exonuclease component of the nuclear exosome	0.772	935-942	PAAKKRKG
UP000006174	Ustilago hordei	I2FQ83	Related to RRP6-Exonuclease component of the nuclear exosome	0.685	889-897	KSKAKASKP
UP000006174	Ustilago hordei	I2FRB3	DDHD domain-containing protein	0.996	1003-1044	ARIAAKAKEEEKRKEEREREADEEKKKGISAKRKARAKARLR
UP000006174	Ustilago hordei	I2FRB3	DDHD domain-containing protein	0.802	337-348	KAKSGSPRKPKR
UP000006174	Ustilago hordei	I2FRB3	DDHD domain-containing protein	0.72	927-938	KRKAVAAKRSKG
UP000006174	Ustilago hordei	I2FVB8	Ipi1_N domain-containing protein	0.954	3-26	KATKRKKEKKADFQKTKLKLGKGK
UP000006174	Ustilago hordei	I2FWB0	Probable YOR1-ABC transporter	0.953	186-245	PGWRRRTSWALRSTLKPKAGNTKQREARWRAPPKPTPSNAAPAGPGKPAKTVKDPSGHKK
UP000006174	Ustilago hordei	I2FWB0	Probable YOR1-ABC transporter	0.708	601-613	KPKGGAKGAAGAK
UP000006174	Ustilago hordei	I2FXF6	Uncharacterized protein	0.885	333-356	EKKRKQAERLARAKAWLKTRSKQA
UP000006174	Ustilago hordei	I2FXV7	Related to Na+/H+ antiporter AnNHA1	0.713	937-948	RRGDLRKKVLRG
UP000006174	Ustilago hordei	I2FYF2	KRR1 small subunit processome component	0.999	347-377	AERKKKEKKEKRKRDEEEGEKKREKKSKKAK
UP000006174	Ustilago hordei	I2FYF2	KRR1 small subunit processome component	0.979	306-335	KPREKKRAEEERKLKKQAEHKEKREAERQK
UP000006174	Ustilago hordei	I2FYR9	Related to SKN7-transcription factor	0.826	376-386	KRKIPAKKKPN
UP000006174	Ustilago hordei	I2FZZ1	Related to BAG7-Rho GTPase activating protein	0.927	410-441	RSRTAPSHKPVEGASLIRKGRRPRASAGDKRA
UP000006174	Ustilago hordei	I2FZZ1	Related to BAG7-Rho GTPase activating protein	0.878	347-365	RSKTTKPKTKRHALGRPRR
UP000006174	Ustilago hordei	I2G043	Related to TOF1-topoisomerase I interacting factor 1	0.989	1081-1102	SGGKKRSKPTSKKGGSRKQKRR
UP000006174	Ustilago hordei	I2G043	Related to TOF1-topoisomerase I interacting factor 1	0.905	417-434	KGKRRAQRRKDAQERGAP
UP000006174	Ustilago hordei	I2G061	Uncharacterized protein	0.614	269-270	KK
UP000006174	Ustilago hordei	I2G0U1	Related to c-module-binding factor	0.753	1144-1154	KKPRKDAKDKA
UP000006174	Ustilago hordei	I2G290	VHS domain-containing protein	0.933	193-209	KEEEKKSKLRRQKGGKR
UP000006174	Ustilago hordei	I2G362	Uncharacterized protein	0.993	64-96	SSGKHKKRRHKRSHRQRECESDRHHRPKRQRSR
UP000006174	Ustilago hordei	I2G362	Uncharacterized protein	0.772	397-402	KKKKRR
UP000006174	Ustilago hordei	I2G4E2	Related to APN1-AP endonuclease	0.974	513-529	AAKKGSKPTGPGKKKKK
UP000006174	Ustilago hordei	I2G4L3	Uncharacterized protein	0.912	909-925	EVRRRRSARRPSHHRSR
UP000006174	Ustilago hordei	I2G6T7	Uncharacterized protein	0.93	757-765	TRRKKKKGK
UP000006174	Ustilago hordei	I2G6T7	Uncharacterized protein	0.905	785-806	RGGGGGSLPGVHRKNSKKRKEE
UP000006174	Ustilago hordei	I2FMM2	Uncharacterized protein	0.743	84-91	KKHKTRKR
UP000006174	Ustilago hordei	I2FN32	Related to YTA7-26S proteasome subunit	0.969	669-707	SSGRLRRGGGGSNTNRLAEMAAKKRAANGRSKSGRRKPR
UP000006174	Ustilago hordei	I2FN32	Related to YTA7-26S proteasome subunit	0.821	386-411	KTKKRTQFRRSSTKEEKRPRSNNETK
UP000006174	Ustilago hordei	I2FN32	Related to YTA7-26S proteasome subunit	0.794	2003-2019	KRAVERERNAKAKAKAK
UP000006174	Ustilago hordei	I2FN32	Related to YTA7-26S proteasome subunit	0.747	464-492	AKDKAPSKQAEHGPAARSNTAQPPKKGKA
UP000006174	Ustilago hordei	I2FN32	Related to YTA7-26S proteasome subunit	0.675	1444-1452	PKAPPRPPR
UP000006174	Ustilago hordei	I2FN32	Related to YTA7-26S proteasome subunit	0.623	1436-1438	RKR
UP000006174	Ustilago hordei	I2FPE8	Uncharacterized protein	0.889	24-36	SPKKRKMGAKKED
UP000006174	Ustilago hordei	I2FT62	Pre-mRNA-splicing factor SLU7	0.842	127-137	RPRKKGAKKLG
UP000006174	Ustilago hordei	I2FUL2	Zn(2)-C6 fungal-type domain-containing protein	0.871	236-246	IGRPKKRKAEK
UP000006174	Ustilago hordei	I2FWI9	Uncharacterized protein	0.723	973-982	KMRRSSRKKS
UP000006174	Ustilago hordei	I2FZ36	Conserved uncharacterized protein (N-terminal) (Fragment)	0.973	33-58	RKAYRKPRQPPKLPRPATPKVKRRIK
UP000006174	Ustilago hordei	I2FZ36	Conserved uncharacterized protein (N-terminal) (Fragment)	0.932	772-788	QRRRRREAFRKALRSKR
UP000006174	Ustilago hordei	I2FZK8	Related to Nuclear cohesin complex subunit	0.975	81-131	RKKKAAPRRSAATPSKAKSTNTTPRARKTKNGATKAPRSTTKRSGPSRPRA
UP000006174	Ustilago hordei	I2FZK8	Related to Nuclear cohesin complex subunit	0.869	1046-1057	HIRGGKSKKAKK
UP000006174	Ustilago hordei	I2FZK8	Related to Nuclear cohesin complex subunit	0.814	330-342	EKKKARADKSRLK
UP000006174	Ustilago hordei	I2FZV4	PDCD2_C domain-containing protein	0.98	118-154	NRRWAAKLEKQKAKRLAREQAKKERQAAAAKAKQKQE
UP000006174	Ustilago hordei	I2G1A1	Related to SIN3-transcription regulatory protein	0.98	398-430	TPSGSRKKRSGANESGKPGSGKTKKSKHGHKAE
UP000006174	Ustilago hordei	I2G1A1	Related to SIN3-transcription regulatory protein	0.668	919-925	RGKKQAG
UP000006174	Ustilago hordei	I2G1A1	Related to SIN3-transcription regulatory protein	0.612	928-929	RK
UP000006174	Ustilago hordei	I2G1B9	Related to DJP1-DnaJ-like protein	0.969	449-462	AGKNKKKGKKDKKV
UP000006174	Ustilago hordei	I2G1C7	Uncharacterized protein	0.974	385-417	KKEQKKQDKKDEKKDWKTSATRRSNRRKSTKKE
UP000006174	Ustilago hordei	I2G1C7	Uncharacterized protein	0.78	41-48	KAAKKKRK
UP000006174	Ustilago hordei	I2G419	Related to ESF1-18S rRNA factor, nucleolar protein involved in pre-rRNA processing	0.996	243-267	SRKKDKGKEKARKTKPKSSKNKIPR
UP000006174	Ustilago hordei	I2G419	Related to ESF1-18S rRNA factor, nucleolar protein involved in pre-rRNA processing	0.973	891-905	KQPRKRSKRKSKASA
UP000006174	Ustilago hordei	I2G419	Related to ESF1-18S rRNA factor, nucleolar protein involved in pre-rRNA processing	0.958	631-644	RKQKEKKERKKAAR
UP000006174	Ustilago hordei	I2G419	Related to ESF1-18S rRNA factor, nucleolar protein involved in pre-rRNA processing	0.929	764-781	KDAKRAKLLKRLSKKKQR
UP000006174	Ustilago hordei	I2G419	Related to ESF1-18S rRNA factor, nucleolar protein involved in pre-rRNA processing	0.699	63-77	RNKTDKYGRKVGKGK
UP000006174	Ustilago hordei	I2G4C4	Related to DNA topoisomerase II binding protein	0.93	992-1006	GRKKNRLPPRARKPR
UP000006174	Ustilago hordei	I2G5S4	Related to Vacuolar assembly protein VPS41	0.847	153-162	PRKRAHKRRP
UP000006174	Ustilago hordei	I2G628	DIS3-like exonuclease 2	0.915	606-621	KKEKEDKKKRKEEQSG
UP000006174	Ustilago hordei	I2G6C7	Uncharacterized protein	0.874	567-588	SKEGRKFKLPKWLKPGGSKNRS
UP000006174	Ustilago hordei	I2FLV4	Probable DNA/RNA helicase (DEAD/H box family II)	0.923	300-314	EGKAAKKRRGKETNK
UP000006174	Ustilago hordei	I2FMY7	C2H2-type domain-containing protein	0.8	6-24	HGKKTHHARRDVKRGMRTR
UP000006174	Ustilago hordei	I2FMY7	C2H2-type domain-containing protein	0.604	88-89	RR
UP000006174	Ustilago hordei	I2FP67	PCI domain-containing protein	0.826	439-446	GKKKKKDR
UP000006174	Ustilago hordei	I2FRU3	HSF_DOMAIN domain-containing protein	0.762	443-455	KRKSSRQKRGGSP
UP000006174	Ustilago hordei	I2FRY1	Related to YPT31-GTP-binding protein of the rab family	0.969	175-189	GRKRLERRRSKGKRR
UP000006174	Ustilago hordei	I2FV25	Uncharacterized protein	0.993	255-290	KEKETKESGRGTAKEKVRAKTKKEGRGEGKRKTALK
UP000006174	Ustilago hordei	I2FV25	Uncharacterized protein	0.608	72-74	KGK
UP000006174	Ustilago hordei	I2FVI2	Related to KRI1-KRRI-Interacting protein 1	0.996	566-589	LRARLADKKLSKKDRKKLKKKLKA
UP000006174	Ustilago hordei	I2FVI2	Related to KRI1-KRRI-Interacting protein 1	0.985	725-759	SKNKEGEEKPQKKRLGKKERMRLKADEGGAEGEKK
UP000006174	Ustilago hordei	I2FVI2	Related to KRI1-KRRI-Interacting protein 1	0.983	405-438	RREDNTRKRKREERAARKEEEKRLKMQELSRLKN
UP000006174	Ustilago hordei	I2FVX6	WD_REPEATS_REGION domain-containing protein	0.984	761-797	HGGLHKRSQRRREQERAAKREERRKLAKAMDTRTARK
UP000006174	Ustilago hordei	I2FVX6	WD_REPEATS_REGION domain-containing protein	0.694	733-746	SKQRPANPRRSSGR
UP000006174	Ustilago hordei	I2FW27	Rho-GAP domain-containing protein	0.627	257-261	KSSRR
UP000006174	Ustilago hordei	I2FW91	Uncharacterized protein	0.989	835-867	RLLAIRNKEPERGKRAEARRASRRRPHGATGPK
UP000006174	Ustilago hordei	I2FW91	Uncharacterized protein	0.912	761-829	QARAEKAERSAERRRAKEEASAAAAAAALAAKEAKRSEKVKKQEVRQAQLERKREEESQARDRAIREKE
UP000006174	Ustilago hordei	I2FW91	Uncharacterized protein	0.621	169-176	NRGAAPRS
UP000006174	Ustilago hordei	I2FW91	Uncharacterized protein	0.611	1675-1676	KP
UP000006174	Ustilago hordei	I2FW91	Uncharacterized protein	0.607	1670-1671	KR
UP000006174	Ustilago hordei	I2FWK3	Related to RAD5-DNA helicase	0.634	1016-1020	GKGKV
UP000006174	Ustilago hordei	I2G102	Uncharacterized protein	0.647	35-38	HKKR
UP000006174	Ustilago hordei	I2G102	Uncharacterized protein	0.616	236-238	RRR
UP000006174	Ustilago hordei	I2G2U5	Related to integral peroxisomal membrane protein	0.797	603-618	KKSRMGRYTRRRKWVR
UP000006174	Ustilago hordei	I2G313	Uncharacterized protein	0.983	20-55	WKKPRKWSEPTRPKRGKSSTTSHRKSRRGWRDQLRR
UP000006174	Ustilago hordei	I2G3K3	J domain-containing protein	0.961	270-279	QKGGKKKKKK
UP000006174	Ustilago hordei	I2G3K3	J domain-containing protein	0.607	246-246	K
UP000006174	Ustilago hordei	I2G3V0	N-acetyltransferase domain-containing protein	0.999	542-575	EKEAKDRLKKEEKERQREEKVRKKKEKRDRKRGG
UP000006174	Ustilago hordei	I2G5Z1	Probable SNF2-component of SWI/SNF global transcription activator complex	0.995	1491-1511	PAPRGIKIKLGKRKPKKGGKK
UP000006174	Ustilago hordei	I2G5Z1	Probable SNF2-component of SWI/SNF global transcription activator complex	0.955	1253-1284	GRRKKGGRGRGLGGASETPDPSPGPSARKRKR
UP000006174	Ustilago hordei	I2G5Z1	Probable SNF2-component of SWI/SNF global transcription activator complex	0.686	1225-1233	KRERIEKRR
UP000006174	Ustilago hordei	I2G634	5'-3' exoribonuclease 1	0.967	1450-1478	RCRGGRGGGAPRGRGAPAPRGGRGGRGGA
UP000006174	Ustilago hordei	I2G634	5'-3' exoribonuclease 1	0.777	98-117	RSRRFRTAKEAKEIKEKAER
UP000006174	Ustilago hordei	I2FM74	Related to OXA1-cytochrome oxidase biogenesis protein, mitochondrial	0.925	537-550	RERVLKARKRRARQ
UP000006174	Ustilago hordei	I2FP09	EF-hand domain-containing protein	0.776	947-956	ARKAKREAKK
UP000006174	Ustilago hordei	I2FQR8	Mago-bind domain-containing protein	0.668	39-45	RKERKVR
UP000006174	Ustilago hordei	I2FQR8	Mago-bind domain-containing protein	0.605	61-63	RAR
UP000006174	Ustilago hordei	I2FQY3	Chromo domain-containing protein	0.992	103-122	VPKKGVKRMGNKRGKKGKRQ
UP000006174	Ustilago hordei	I2FQY3	Chromo domain-containing protein	0.805	141-149	ARRKRTRRE
UP000006174	Ustilago hordei	I2FS78	CCHC-type domain-containing protein	0.611	247-250	KLKE
UP000006174	Ustilago hordei	I2FS78	CCHC-type domain-containing protein	0.607	252-252	K
UP000006174	Ustilago hordei	I2FSA4	EF-hand domain-containing protein	0.976	182-199	RKSKGRSKKVTRAKRGRK
UP000006174	Ustilago hordei	I2FSH0	Protein MAK16	0.996	297-323	KRAKKRKAPAPTKKAPAPTKNKGGKKG
UP000006174	Ustilago hordei	I2FTH1	Uncharacterized protein	0.998	580-629	ARGSGKAQGRAKPATKTTAAALASRASGKGKGKGKGKGKGAGRGKMPTKG
UP000006174	Ustilago hordei	I2FTH1	Uncharacterized protein	0.98	902-918	KAKPAKPKTTKPKKKKS
UP000006174	Ustilago hordei	I2FTH1	Uncharacterized protein	0.967	1735-1748	GKKGGSGKKKKKAS
UP000006174	Ustilago hordei	I2FTH1	Uncharacterized protein	0.959	674-696	GKRPGKAVKGAKGGKNTKASKGK
UP000006174	Ustilago hordei	I2FTH1	Uncharacterized protein	0.953	525-554	ATAKGKSDPASRQDKPKRRLVLKPKSKVGK
UP000006174	Ustilago hordei	I2FTH1	Uncharacterized protein	0.696	729-733	RKRKR
UP000006174	Ustilago hordei	I2FVM8	Uncharacterized protein	0.888	714-726	RRRSKNGKGHRKR
UP000006174	Ustilago hordei	I2FW62	RNA polymerase II transcription factor B 38 kDa subunit	0.757	204-215	AAKKARAERLRK
UP000006174	Ustilago hordei	I2FW62	RNA polymerase II transcription factor B 38 kDa subunit	0.652	249-252	RKRR
UP000006174	Ustilago hordei	I2FWW4	Uncharacterized protein	0.912	55-76	PKRPKKAKTEQRRNEVMRKGRG
UP000006174	Ustilago hordei	I2FXM0	Uncharacterized protein	0.999	50-78	KESKKKDKKEKKEKKEKKDKKDKKDRKNK
UP000006174	Ustilago hordei	I2FXM0	Uncharacterized protein	0.993	130-152	LKRAKLLKLKAKKAKKEESKKRF
UP000006174	Ustilago hordei	I2G0E2	Related to tRNA pseudouridine synthase B	0.985	92-114	KRPKDNSRKRGKFGKGKGKWAGG
UP000006174	Ustilago hordei	I2G1H0	Uncharacterized protein	0.839	77-92	RSSGRSKELGRRKQRR
UP000006174	Ustilago hordei	I2G2E1	Translation factor GUF1, mitochondrial	0.878	691-707	KLKHLNKQKEGKKRLKA
UP000006174	Ustilago hordei	I2G3H2	Related to 4-coumarate-CoA ligase 1	0.728	702-717	AASKGHKIKIVKQSRK
UP000006174	Ustilago hordei	I2G3S2	Related to DNA polymerase eta	0.868	713-720	PRKKKKRN
UP000006174	Ustilago hordei	I2G3S2	Related to DNA polymerase eta	0.657	862-865	KKKR
UP000006174	Ustilago hordei	I2G461	Uncharacterized protein	0.919	274-287	KKKPRLLRKKAARP
UP000006174	Ustilago hordei	I2G461	Uncharacterized protein	0.714	353-360	RAKRKVKR
UP000006174	Ustilago hordei	I2G491	RING-CH-type domain-containing protein	0.84	385-397	KRRRQGKAKSVRR
UP000006174	Ustilago hordei	I2G4J2	Related to Sentrin-specific protease 1	0.935	690-713	PKAKLVERERLERERRAKERRLRG
UP000006174	Ustilago hordei	I2G4J2	Related to Sentrin-specific protease 1	0.901	808-818	AGSKKKGKKTK
UP000006174	Ustilago hordei	I2G612	Mitochondrial distribution and morphology protein 34	0.882	258-299	RTHNKGRKSQQGRSAGNVAGSAAPSSRSPPKARGSLRRPRHV
UP000006174	Ustilago hordei	I2G612	Mitochondrial distribution and morphology protein 34	0.645	527-531	ARRKK
UP000006174	Ustilago hordei	I2G612	Mitochondrial distribution and morphology protein 34	0.626	498-501	GKRS
UP000006174	Ustilago hordei	I2G612	Mitochondrial distribution and morphology protein 34	0.604	506-506	R
UP000006174	Ustilago hordei	I2FNQ5	Related to GCD2-translation initiation factor eIF2B, 71 kDa (Delta) subunit	0.924	47-80	TKEGGNDKKSAKELKAARRAAKVAERAPGDDGRP
UP000006174	Ustilago hordei	I2FPX5	Related to tRNA nucleotidyltransferase	0.961	681-716	PPPPPSKGDKGKKTKDPTAAAKPAEDRDRRKRQKSE
UP000006174	Ustilago hordei	I2FPY2	Uncharacterized protein	0.999	999-1026	PAGGKKPRGTKRKKRPPPPGARLWKKGR
UP000006174	Ustilago hordei	I2FPY2	Uncharacterized protein	0.696	242-249	RAKRQRRE
UP000006174	Ustilago hordei	I2FPY2	Uncharacterized protein	0.671	335-343	RAPTRAKRS
UP000006174	Ustilago hordei	I2FPY2	Uncharacterized protein	0.623	186-188	HKK
UP000006174	Ustilago hordei	I2FQV4	Mitochondrial genome maintenance protein MGM101	0.749	294-302	KKKKLWRRK
UP000006174	Ustilago hordei	I2FSJ8	Ribosome biogenesis protein RLP24	0.879	40-58	FKLKRNPRKVRWTKAFRKA
UP000006174	Ustilago hordei	I2FSJ8	Ribosome biogenesis protein RLP24	0.6	118-118	K
UP000006174	Ustilago hordei	I2FUQ8	Uncharacterized protein	0.85	451-463	PAKAKRSRSKSKK
UP000006174	Ustilago hordei	I2FUQ8	Uncharacterized protein	0.729	256-276	KKGGKRAVSATTRKASTKIRK
UP000006174	Ustilago hordei	I2FW01	E3 ubiquitin-protein ligase listerin	0.998	56-86	QRGQKKDKSKKDGKGGKRGKAEKKKQYIPPP
UP000006174	Ustilago hordei	I2FW01	E3 ubiquitin-protein ligase listerin	0.631	17-20	RKKQ
UP000006174	Ustilago hordei	I2FW90	Pescadillo homolog	0.867	666-681	QQKKKALNKKATKGRQ
UP000006174	Ustilago hordei	I2FXK2	Uncharacterized protein	0.682	1568-1577	PKRKSLNLKR
UP000006174	Ustilago hordei	I2FYG2	TFIIIC_sub6 domain-containing protein	0.737	281-290	RVGKGKYKRK
UP000006174	Ustilago hordei	I2FYG2	TFIIIC_sub6 domain-containing protein	0.706	302-310	AERKIRKAA
UP000006174	Ustilago hordei	I2FYL5	Phospholipid-transporting ATPase	0.846	1468-1483	PDLFKKSLRKKEQRKR
UP000006174	Ustilago hordei	I2FYL5	Phospholipid-transporting ATPase	0.637	1458-1465	KKKTVKDR
UP000006174	Ustilago hordei	I2G022	Nucleolar protein 9	0.991	850-879	ERKWKPIIVETKRAKKENGKDGGKKKKKDK
UP000006174	Ustilago hordei	I2G022	Nucleolar protein 9	0.969	609-629	RGSKRGRDGKTKTKGKKSSKK
UP000006174	Ustilago hordei	I2G022	Nucleolar protein 9	0.816	5-17	VRQRGKKPSKQRK
UP000006174	Ustilago hordei	I2G0S8	Probable RPT2-26S proteasome regulatory subunit	0.976	10-41	PGRGGKDNKKDQQKKWEPPLPTRVGKKKKRGP
UP000006174	Ustilago hordei	I2G4N3	Uncharacterized protein	0.663	607-611	ARRRR
UP000006174	Ustilago hordei	I2G599	Uncharacterized protein	0.984	182-203	RRKGRARMSQEKRKRLARRRER
UP000006174	Ustilago hordei	I2FN11	Uncharacterized protein	0.971	335-371	PAPARKRKTPATPTTPAGEGGEKPDKKKRTHVRKPKA
UP000006174	Ustilago hordei	I2FN11	Uncharacterized protein	0.745	242-255	RGGRGGKPRTARVG
UP000006174	Ustilago hordei	I2FN11	Uncharacterized protein	0.644	405-410	KRTKAK
UP000006174	Ustilago hordei	I2FNU0	Uncharacterized protein	0.872	7-17	QHKRRRSKEKR
UP000006174	Ustilago hordei	I2FNX6	Probable HCA4-can suppress the U14 snoRNA rRNA processing function	0.991	784-802	ELAKEKRREKRRRQKEREK
UP000006174	Ustilago hordei	I2FNX6	Probable HCA4-can suppress the U14 snoRNA rRNA processing function	0.971	12-34	KRKKGGPAPHLKSRSKNARKLKR
UP000006174	Ustilago hordei	I2FNX6	Probable HCA4-can suppress the U14 snoRNA rRNA processing function	0.701	876-888	KRRRTDKPTKQAP
UP000006174	Ustilago hordei	I2FUE0	Probable U5 snRNP 100 kD protein	0.947	167-180	KDDKKKPKRKPMDK
UP000006174	Ustilago hordei	I2FUE0	Probable U5 snRNP 100 kD protein	0.804	675-687	PVKDAGGKRKRER
UP000006174	Ustilago hordei	I2FVW6	Related to transcription regulator SPT7	0.988	182-199	RKVGKDGKEQRKRKKRRE
UP000006174	Ustilago hordei	I2FVW6	Related to transcription regulator SPT7	0.98	357-378	RGRGKKRRKKAYHLIPATHRKG
UP000006174	Ustilago hordei	I2FXN3	Uncharacterized protein	0.885	1136-1149	RRKKAEVKRRGGSK
UP000006174	Ustilago hordei	I2FY81	RRM domain-containing protein	0.821	239-272	RAQGSTSRRRDIGDRPRERSVSRSKSPPSQGRRR
UP000006174	Ustilago hordei	I2FYJ2	Related to SRP40-serine-rich protein with a role in pre-ribosome assembly or transport	0.874	373-385	KGFTKEKNKKKRG
UP000006174	Ustilago hordei	I2G2W4	Related to cactin	0.957	41-137	KDRDTSSNRRKRHREDDDRDRRRSSKHSQNSRSHRDDDRRDKSDREHRRKDRDRDHGSSSHLRHDSDRHQNHRDRSLKRRETSEERRIRKAAKRSEK
UP000006174	Ustilago hordei	I2G2W4	Related to cactin	0.784	183-203	KWGKKEEKERKQGLSREEAEK
UP000006174	Ustilago hordei	I2G2Y8	Vacuolar membrane-associated protein IML1	0.665	1553-1556	KKKK
UP000006174	Ustilago hordei	I2G4Z1	Homeobox domain-containing protein	0.738	641-648	PPRRRGKL
UP000006174	Ustilago hordei	I2G6V9	Spindle pole body component	0.794	46-60	RKKREETKEERRARK
UP000006174	Ustilago hordei	I2FLV0	AB hydrolase-1 domain-containing protein	0.601	662-662	R
UP000006174	Ustilago hordei	I2FMV5	Uncharacterized protein	0.908	56-75	RRWKKIRRNDRQVKGRGRRT
UP000006174	Ustilago hordei	I2FN61	ATP-dependent DNA helicase	0.62	735-737	AKK
UP000006174	Ustilago hordei	I2FP59	PAN2-PAN3 deadenylation complex catalytic subunit PAN2	0.995	426-490	GKRNVVSGKGPGGIRASALHRPEDRKKIGIPLFRSEKEKEQSKKAAAAGITPADKKKKKAEKKRA
UP000006174	Ustilago hordei	I2FP65	Dual-specificity kinase	0.757	2125-2131	KGKRRRP
UP000006174	Ustilago hordei	I2FP65	Dual-specificity kinase	0.719	919-943	SRDGKSDPKSPRTSRVPSRPGSASR
UP000006174	Ustilago hordei	I2FR06	Midasin	0.659	901-905	RKKRK
UP000006174	Ustilago hordei	I2FTS2	Uncharacterized protein	0.922	726-746	RQLRADERAARRERKGRQRGR
UP000006174	Ustilago hordei	I2FTS2	Uncharacterized protein	0.715	285-292	AKRRHARA
UP000006174	Ustilago hordei	I2FUJ0	Uncharacterized protein	0.999	672-687	GKKKKNKSKKKKKKQK
UP000006174	Ustilago hordei	I2FUJ0	Uncharacterized protein	0.893	559-571	KKSKKNGSKKQKK
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.979	1955-1970	GKKKKGKKVVKEVKRK
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.942	2507-2521	VGGKRKRQAGKKSKR
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.883	2549-2563	RSGRGRMVRKAKAKK
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.778	113-120	RRRRHRRK
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.762	1913-1925	KVFKARPKAKTAA
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.739	799-809	KRKAAKAAKAA
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.694	291-303	PRKKGSTAAGAKG
UP000006174	Ustilago hordei	I2FUQ5	Helicase ATP-binding domain-containing protein	0.681	2128-2135	KRRAKERA
UP000006174	Ustilago hordei	I2FXA8	Related to Rab proteins geranylgeranyltransferase component A 2	0.743	566-572	RKRRKGR
UP000006174	Ustilago hordei	I2G1C6	Probable YDJ1-mitochondrial and ER import protein	0.772	103-112	GRPRGPRKGK
UP000006174	Ustilago hordei	I2G1C6	Probable YDJ1-mitochondrial and ER import protein	0.65	27-31	RKKAL
UP000006174	Ustilago hordei	I2G3W1	Chromatin elongation factor SPT5	0.876	84-94	GRRRAKKQRRN
UP000006174	Ustilago hordei	I2G3W1	Chromatin elongation factor SPT5	0.625	348-350	KRK
UP000006174	Ustilago hordei	I2G439	Related to SRC1-involved in sister chromatid segregation	0.927	163-173	AKRRRGRPRKS
UP000006174	Ustilago hordei	I2G439	Related to SRC1-involved in sister chromatid segregation	0.714	378-392	RRQKDKQQRREQRGR
UP000006174	Ustilago hordei	I2G4H1	Protein kinase domain-containing protein	0.982	1368-1386	KRRKRGARKGRTLAKHLKR
UP000006174	Ustilago hordei	I2G549	Related to poly(A) binding protein II	0.994	178-202	MAFRGRGRGRGRGRPFRGRGRGRGR
UP000006174	Ustilago hordei	I2FMT0	MFS domain-containing protein	0.85	635-645	AEKKGRKNAKR
UP000006174	Ustilago hordei	I2FMZ9	Ribosomal protein L15	0.912	63-78	RIRVRRGNRKKPVPKG
UP000006174	Ustilago hordei	I2FMZ9	Ribosomal protein L15	0.834	162-189	RGLTATGKKSRGQGKGHRYNKTQGGGKN
UP000006174	Ustilago hordei	I2FMZ9	Ribosomal protein L15	0.657	156-160	HKRRE
UP000006174	Ustilago hordei	I2FN08	Foie-gras_1 domain-containing protein	0.778	281-288	RRVKRKRT
UP000006174	Ustilago hordei	I2FPZ7	Mitochondrial DNA polymerase catalytic subunit	0.992	1879-1908	LAKRARRAKKRAHLARKYRVAMEKWRSSKA
UP000006174	Ustilago hordei	I2FPZ7	Mitochondrial DNA polymerase catalytic subunit	0.835	386-398	KHNKAKAEKRAKK
UP000006174	Ustilago hordei	I2FPZ7	Mitochondrial DNA polymerase catalytic subunit	0.663	1574-1578	ARRRR
UP000006174	Ustilago hordei	I2FRU5	PWWP domain-containing protein	0.992	156-192	SKKRKREPESGKIRESADKRKKSKAAEAAKTKVEKPN
UP000006174	Ustilago hordei	I2FTR7	Related to microfibril-associated protein	0.963	429-495	GDKRERKTRERSRSPKRDSRGYEDEREPRASSSRSRHHDDKDSRSHRSREDRDREHDRESRRHRDKK
UP000006174	Ustilago hordei	I2FTR7	Related to microfibril-associated protein	0.862	527-554	KHRSRHHKDDQDREKERYKRRDREREGD
UP000006174	Ustilago hordei	I2FX71	Related to LAG1-longevity-assurance protein	0.976	525-535	KGQKKKKSKRR
UP000006174	Ustilago hordei	I2G0I4	Related to ARK1-Actin Regulating Kinase	0.763	906-919	KGKWRSKPERPRIT
UP000006174	Ustilago hordei	I2G0N9	Dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase	0.735	308-313	GRRRRR
UP000006174	Ustilago hordei	I2G0Z3	Transcription initiation factor TFIID subunit 2	0.94	1205-1217	AERKKIKPKKIKP
UP000006174	Ustilago hordei	I2G0Z3	Transcription initiation factor TFIID subunit 2	0.691	1835-1845	GGGGSSKKAKS
UP000006174	Ustilago hordei	I2G357	Probable NOP2-nucleolar protein	0.917	671-681	SLKKAKGKSRR
UP000006174	Ustilago hordei	I2G357	Probable NOP2-nucleolar protein	0.726	79-91	KASANGKAKAKAR
UP000006174	Ustilago hordei	I2G357	Probable NOP2-nucleolar protein	0.607	25-25	K
UP000006174	Ustilago hordei	I2G415	Related to tRNA isopentenylpyrophosphate transferase	0.899	457-479	HRKGRHHRNNVKRKISGEEKEKR
UP000006174	Ustilago hordei	I2G4A5	Uncharacterized protein	0.624	186-188	KKK
UP000006174	Ustilago hordei	I2G4G6	Related to transcription factor TFIIIC subunit	0.906	87-111	SKKLPPKTARLKRTREPKASASGSR
UP000006174	Ustilago hordei	I2G4G6	Related to transcription factor TFIIIC subunit	0.751	219-227	KQKRRVRRR
UP000006174	Ustilago hordei	I2G4G6	Related to transcription factor TFIIIC subunit	0.745	813-820	KKKRPGGH
UP000006174	Ustilago hordei	I2G6N4	Related to component of the anaphase promoting complex	0.967	449-485	RRRRRPRRSLQTSTPAPSSGKSSKRAAKRRVPHNRRG
UP000006174	Ustilago hordei	I2G6P9	Uncharacterized protein	0.934	1086-1101	RRQRLKAKVKRRLAKR
UP000006174	Ustilago hordei	I2G6S3	Related to glucose regulated stress protein, HSP70-like	0.999	864-911	RRRKVAETINKIKKRRIAKTRPQKKPKNEKKEEKKEEKKEEKKEEKKE
UP000006174	Ustilago hordei	I2G742	Related to TRL1-tRNA ligase	0.955	445-461	KSALKKAKKAKAKLAAK
UP000006174	Ustilago hordei	I2G742	Related to TRL1-tRNA ligase	0.933	794-813	WRVSKKANADKKKAKEEKKA
UP000006174	Ustilago hordei	I2FNB4	Related to 50S ribosomal protein L19	0.892	241-254	KKAQEMAKRRGGRR
UP000006174	Ustilago hordei	I2FNB4	Related to 50S ribosomal protein L19	0.855	200-215	KNDKSGKLRRTRRAKL
UP000006174	Ustilago hordei	I2FP53	RING-CH-type domain-containing protein	0.693	1192-1202	RKMWLRRIRRA
UP000006174	Ustilago hordei	I2FP87	Related to NHP6B-nonhistone chromosomal protein	0.969	152-177	KAVKKLSKLQKRKEKRLRDPDAPKRP
UP000006174	Ustilago hordei	I2FPC3	Uncharacterized protein	0.669	774-797	RKSKTAPSPSPKLGHTNHPAKRQR
UP000006174	Ustilago hordei	I2FPV7	Uncharacterized protein	0.682	405-414	KRRNAIRRAK
UP000006174	Ustilago hordei	I2FPV7	Uncharacterized protein	0.629	554-557	RRKP
UP000006174	Ustilago hordei	I2FS17	Ribosome biogenesis protein NSA2 homolog	0.945	12-64	RRHGRRLDHEERQRKRAAREVHKASAVAQKVTGLKAKMLNKKRRNEKIQMKKT
UP000006174	Ustilago hordei	I2FS17	Ribosome biogenesis protein NSA2 homolog	0.821	137-148	KTGKRKQKGWKR
UP000006174	Ustilago hordei	I2FSK6	Related to excision repair protein RAD4	0.988	21-53	KRRREHQKKRKVIERSAAQKKQKQLRNTGKKSK
UP000006174	Ustilago hordei	I2FUG0	Related to Shuttle craft protein	0.896	98-114	PRRKNRRGGGSGDKPKK
UP000006174	Ustilago hordei	I2FUG0	Related to Shuttle craft protein	0.655	41-50	RNRGNGRGRV
UP000006174	Ustilago hordei	I2FUR5	Related to Cytokinesis protein sepA	0.887	1662-1675	GGPHKQRRKARERR
UP000006174	Ustilago hordei	I2FUR5	Related to Cytokinesis protein sepA	0.759	951-965	RRRKAQAPTPKGNGK
UP000006174	Ustilago hordei	I2FUR5	Related to Cytokinesis protein sepA	0.626	1040-1048	PPPPPPPPP
UP000006174	Ustilago hordei	I2FV79	Uncharacterized protein	0.863	224-232	RHRRKRRRM
UP000006174	Ustilago hordei	I2FV79	Uncharacterized protein	0.681	174-181	KSRPKGKG
UP000006174	Ustilago hordei	I2FW99	C2H2-type domain-containing protein	0.78	519-526	RRIRRRRK
UP000006174	Ustilago hordei	I2FY61	Uncharacterized protein	0.767	181-191	KAKGRKRNLEK
UP000006174	Ustilago hordei	I2FY78	Related to endothelial zinc finger protein induced by tumor necrosis factor alpha	0.984	832-876	KGAAAKGAAAKGVIAAASGAATRGRGRGRPRGSGTRGGRKAGGDR
UP000006174	Ustilago hordei	I2FY78	Related to endothelial zinc finger protein induced by tumor necrosis factor alpha	0.974	552-566	KPKSRGKGRGKGKKS
UP000006174	Ustilago hordei	I2FY78	Related to endothelial zinc finger protein induced by tumor necrosis factor alpha	0.881	637-657	KGAKRAGPNGGRGRKNSSAKK
UP000006174	Ustilago hordei	I2FY78	Related to endothelial zinc finger protein induced by tumor necrosis factor alpha	0.804	260-270	KAPGRGRKKSN
UP000006174	Ustilago hordei	I2G2I7	Uncharacterized protein	0.857	45-79	RKRQSKRDEAIRKKIEGELQRKSGKPSTPISSRRT
UP000006174	Ustilago hordei	I2G2I7	Uncharacterized protein	0.851	701-711	KSTPARKRKPK
UP000006174	Ustilago hordei	I2G3J5	Uncharacterized protein	0.921	310-334	RGIRRIERERRAKMDHKTLRTRKRR
UP000006174	Ustilago hordei	I2G430	DUF4203 domain-containing protein	0.61	819-821	KQK
UP000006174	Ustilago hordei	I2FPS6	DNA helicase	0.899	82-94	KKKGKGALGKKAK
UP000006174	Ustilago hordei	I2FPS6	DNA helicase	0.747	919-933	RHKLFQKRADKAKRK
UP000006174	Ustilago hordei	I2FPW0	Related to nuclear envelope protein NEM1	0.964	489-509	NKPAAKPSRKRKSSSTKRAIR
UP000006174	Ustilago hordei	I2FPW0	Related to nuclear envelope protein NEM1	0.895	458-471	SKPRRRRSGRSSAK
UP000006174	Ustilago hordei	I2FQ22	SAM_MT_RSMB_NOP domain-containing protein	0.99	591-615	AKKGGGSNTAANRKKKLQKKRKKQR
UP000006174	Ustilago hordei	I2FRQ5	Probable 60S ribosomal protein L39	0.645	40-45	KRRHWR
UP000006174	Ustilago hordei	I2FSB6	Uncharacterized protein	0.896	7-23	THKRKRSSARSDKARKL
UP000006174	Ustilago hordei	I2FSB6	Uncharacterized protein	0.878	529-539	KRRMKKRLKRN
UP000006174	Ustilago hordei	I2FTK4	Probable Splicing factor 3b, subunit 2	0.797	21-30	KNAKRRQKKK
UP000006174	Ustilago hordei	I2FTK4	Probable Splicing factor 3b, subunit 2	0.738	158-166	RLSKRKQKK
UP000006174	Ustilago hordei	I2FTN0	RING-type E3 ubiquitin transferase	0.886	712-720	ARKKKGKGK
UP000006174	Ustilago hordei	I2FTU8	Uncharacterized protein	0.924	320-331	RPKKPKKPSRSK
UP000006174	Ustilago hordei	I2FTU8	Uncharacterized protein	0.746	116-125	SAKGKGKARA
UP000006174	Ustilago hordei	I2FU53	Uncharacterized protein	0.928	16-42	RGRPPGSKTRRTQEPTWAPKPGKKRKQ
UP000006174	Ustilago hordei	I2FU99	Related to gata transcription factor	0.878	323-349	PPKLKQIKRKKTDPQPAKVASELARKK
UP000006174	Ustilago hordei	I2FU99	Related to gata transcription factor	0.604	563-564	GR
UP000006174	Ustilago hordei	I2FUL5	Probable RPL3-60s ribosomal protein l3	0.954	18-39	PRKRAARHRGKVKAFPKDDPKK
UP000006174	Ustilago hordei	I2FUL5	Probable RPL3-60s ribosomal protein l3	0.66	238-245	KLPRKTHR
UP000006174	Ustilago hordei	I2FUT7	Probable YEF3-translation elongation factor eEF3	0.958	1030-1052	EKKAKKESASDKRRMRKERMQRA
UP000006174	Ustilago hordei	I2FY06	Uncharacterized protein	0.967	37-63	KQKRRKRALPPGLTRKQAKLLQKIKKR
UP000006174	Ustilago hordei	I2FY93	Dihydrofolate reductase	0.932	251-262	KREKREKREKRH
UP000006174	Ustilago hordei	I2FZW5	Uncharacterized protein	0.992	302-334	PGRSKKRPLQPKTQRQKKPSPAKPLKRARSSKP
UP000006174	Ustilago hordei	I2G033	Uncharacterized protein	0.9	563-615	RRVPKKPRSKLRHVSSGSDLRSVAGKEGLKMPKIGRAKSRSSPNTSPGKDGKR
UP000006174	Ustilago hordei	I2G033	Uncharacterized protein	0.659	360-364	RKWKK
UP000006174	Ustilago hordei	I2G0L7	Uncharacterized protein	0.753	429-444	KKAARKLLKSSSKRAR
UP000006174	Ustilago hordei	I2G0L7	Uncharacterized protein	0.615	191-192	RR
UP000006174	Ustilago hordei	I2G2T6	Related to transcriptional activator Mut3p	0.736	98-103	KGKKRR
UP000006174	Ustilago hordei	I2G2T6	Related to transcriptional activator Mut3p	0.616	69-70	KR
UP000006174	Ustilago hordei	I2G508	FHA domain-containing protein	0.884	443-465	SKKRRTTVRHDKERRRPAESISR
UP000006174	Ustilago hordei	I2G5B9	Uncharacterized protein	0.982	236-332	KGSGKTAKAPKAPKAPKVDKKAAAAATSAAVPVKTAPEPKAKGSKKGASADAPKAKSKAHPYAQPEPASEAKPAKKSKKSEDPPKPLTLKSRLKPPK
UP000006174	Ustilago hordei	I2G5B9	Uncharacterized protein	0.827	420-437	RKAGKSRKGNLKDPNAPK
UP000006174	Ustilago hordei	I2G681	Transcription initiation factor IIE subunit beta	0.975	221-235	AKNKKKKKGAGARRF
UP000006174	Ustilago hordei	I2G6V5	SWR1-complex protein 4	0.946	98-109	KPKFKKRKEKAK
UP000006174	Ustilago hordei	I2FM49	Uncharacterized protein	0.974	110-133	KQKSRRSRQKSKAKESSRAPRRAR
UP000006174	Ustilago hordei	I2FM49	Uncharacterized protein	0.972	163-182	KPSKSAKRRQKKKAAAAAAK
UP000006174	Ustilago hordei	I2FM49	Uncharacterized protein	0.668	201-209	APRVKRQPK
UP000006174	Ustilago hordei	I2FMU1	Uncharacterized protein	0.926	706-728	KWRSRRSMRENPQGKKPGRPKGS
UP000006174	Ustilago hordei	I2FMU1	Uncharacterized protein	0.826	589-606	YRERKALAEAAKRRREEG
UP000006174	Ustilago hordei	I2FMU1	Uncharacterized protein	0.605	949-949	R
UP000006174	Ustilago hordei	I2FQM9	Related to Peptidyl-prolyl cis-trans isomerase	0.678	512-519	KGEERRKK
UP000006174	Ustilago hordei	I2FRN0	Lysine--tRNA ligase	0.89	35-51	KRRMKQREKQAKKATKA
UP000006174	Ustilago hordei	I2FT52	Uncharacterized protein	0.96	1603-1615	GDKGKGKGKGKRK
UP000006174	Ustilago hordei	I2FU89	Uncharacterized protein	0.636	338-342	RNRKL
UP000006174	Ustilago hordei	I2FVF7	Uncharacterized protein	0.902	104-134	KRSRENAEAAARKLKQATNRRQEPAKAKRKL
UP000006174	Ustilago hordei	I2FVF7	Uncharacterized protein	0.848	305-318	RARDAAKKAKGKAK
UP000006174	Ustilago hordei	I2FVF7	Uncharacterized protein	0.834	473-486	PKAKPRSKGRTSKA
UP000006174	Ustilago hordei	I2FVI8	Related to endo-1,3(4)-beta-glucanase	0.727	192-208	TKRKTTSTKRRSTSTRK
UP000006174	Ustilago hordei	I2FWG7	Uncharacterized protein	0.739	327-340	KANRNTKPSQKKRK
UP000006174	Ustilago hordei	I2FY37	zf-primase domain-containing protein	0.831	769-789	KKQKQKEEEGERKKHSGSKEG
UP000006174	Ustilago hordei	I2FY37	zf-primase domain-containing protein	0.821	922-937	KEPNLKIKRAHRPKIR
UP000006174	Ustilago hordei	I2FZZ8	Vps8 domain-containing protein	0.695	1110-1115	RRRKQR
UP000006174	Ustilago hordei	I2G259	rRNA-processing protein FYV7	0.988	137-190	RPRREGKGKSKKPLPHPLPKPVQKESGEEKVRDTRSKEEKEQERLKKNKMWNKP
UP000006174	Ustilago hordei	I2G259	rRNA-processing protein FYV7	0.775	45-61	KHKRIKAELIHKAKVKK
UP000006174	Ustilago hordei	I2G399	60S ribosomal protein L29	0.793	15-28	KAHRNGIKKPKTNK
UP000006174	Ustilago hordei	I2G5Q0	Uncharacterized protein	0.636	147-150	GRRK
UP000006174	Ustilago hordei	I2G5S2	Related to NOP14-nuclear and nucleolar protein with possible role in ribosome biogenesis	0.922	975-987	RAKANIKRRAGKK
UP000006174	Ustilago hordei	I2G5S2	Related to NOP14-nuclear and nucleolar protein with possible role in ribosome biogenesis	0.917	368-378	GRRKRKKGTGP
UP000006174	Ustilago hordei	I2G5S2	Related to NOP14-nuclear and nucleolar protein with possible role in ribosome biogenesis	0.667	75-84	RKIKGAVGRP
UP000006174	Ustilago hordei	I2G5S2	Related to NOP14-nuclear and nucleolar protein with possible role in ribosome biogenesis	0.647	920-925	KKERKG
UP000006174	Ustilago hordei	I2G5S2	Related to NOP14-nuclear and nucleolar protein with possible role in ribosome biogenesis	0.629	30-34	KSRSR
UP000006174	Ustilago hordei	I2G6M9	Kinase	0.879	1047-1060	AKRNARKNRRRLAK
UP000006174	Ustilago hordei	I2G6M9	Kinase	0.682	775-788	PRERSQSRGGRVRR
UP000006174	Ustilago hordei	I2G6M9	Kinase	0.656	1529-1532	RRRR
UP000006174	Ustilago hordei	I2G6T3	ARID domain-containing protein	0.969	694-707	SKPEAKPSKKKRKK
UP000006174	Ustilago hordei	L7N6D6	Uncharacterized protein	0.96	349-398	KGKGKAKAVVPPEDEPPAKASRTSSRNRPTASAPATAKEATPKKPKKPKR
UP000006174	Ustilago hordei	I2FNQ2	GPI-anchored wall transfer protein 1	0.814	610-618	KLRKRRSKS
UP000006174	Ustilago hordei	I2FNQ2	GPI-anchored wall transfer protein 1	0.765	174-190	KKAEKEQSKRDKRHWSK
UP000006174	Ustilago hordei	I2FRG4	Related to HST4-member of the Sir2p family of NAD(+)-dependent histone deacetylases	0.964	563-573	SKKRKPRKKPE
UP000006174	Ustilago hordei	I2FRG4	Related to HST4-member of the Sir2p family of NAD(+)-dependent histone deacetylases	0.715	497-505	KKKPTRSPR
UP000006174	Ustilago hordei	I2FRG4	Related to HST4-member of the Sir2p family of NAD(+)-dependent histone deacetylases	0.663	428-433	ERKEKK
UP000006174	Ustilago hordei	I2FRG4	Related to HST4-member of the Sir2p family of NAD(+)-dependent histone deacetylases	0.644	773-780	RTKGGLKR
UP000006174	Ustilago hordei	I2FRG4	Related to HST4-member of the Sir2p family of NAD(+)-dependent histone deacetylases	0.617	675-678	KEKR
UP000006174	Ustilago hordei	I2FUJ5	Uncharacterized protein	0.986	214-266	TRRRKRRAPNPLSMRKPKSPRLTMEEKLKREQELKKQKQRAAARARMEAGKLG
UP000006174	Ustilago hordei	I2FUJ5	Uncharacterized protein	0.968	274-294	GKAGAAGGAEGARRKRKRSNK
UP000006174	Ustilago hordei	I2FUJ5	Uncharacterized protein	0.89	340-350	APPKKRRSRGK
UP000006174	Ustilago hordei	I2FWU4	Related to KEX1 protein	0.917	564-578	RARKRKRLERGRIGR
UP000006174	Ustilago hordei	I2FXS5	Related to MAK21-protein required for 60S ribosomal subunit biogenesis	0.999	607-633	RRKKDKKRWKHQPRRGKGKKAKAKGKR
UP000006174	Ustilago hordei	I2FXS5	Related to MAK21-protein required for 60S ribosomal subunit biogenesis	0.965	1180-1193	KRRKKQGDKKKRNK
UP000006174	Ustilago hordei	I2FXS5	Related to MAK21-protein required for 60S ribosomal subunit biogenesis	0.66	176-185	HKSKANGKFK
UP000006174	Ustilago hordei	I2FXS5	Related to MAK21-protein required for 60S ribosomal subunit biogenesis	0.63	53-64	KKAATPSKASKK
UP000006174	Ustilago hordei	I2FY65	AP-3 complex subunit delta	0.673	840-843	RKKK
UP000006174	Ustilago hordei	I2FYI0	Related to SPB4-ATP-dependent RNA helicase of DEAH box family	0.996	667-740	EKKKRKKKFGDGITEGAWSAQREKKELREAKREKRAAKRKFLKNQAHEVKKQEQAEAEAKKADTNSKKSKKGRK
UP000006174	Ustilago hordei	I2FYI0	Related to SPB4-ATP-dependent RNA helicase of DEAH box family	0.741	757-767	KLKRQKKQQRR
UP000006174	Ustilago hordei	I2FYM3	Histone acetyltransferase	0.878	327-351	GGGARGSNKRGQPRKSAGLPRSNKK
UP000006174	Ustilago hordei	I2FYM3	Histone acetyltransferase	0.678	828-834	RKRGRPP
UP000006174	Ustilago hordei	I2FZQ8	Zn(2)-C6 fungal-type domain-containing protein	0.822	211-219	RPKSKKRRR
UP000006174	Ustilago hordei	I2FZQ8	Zn(2)-C6 fungal-type domain-containing protein	0.811	102-109	KRERKRKR
UP000006174	Ustilago hordei	I2G125	Uncharacterized protein	0.919	886-899	GKGKKGKTKRTGKS
UP000006174	Ustilago hordei	I2G125	Uncharacterized protein	0.9	482-494	KSKKQKKQDKKRR
UP000006174	Ustilago hordei	I2G125	Uncharacterized protein	0.735	934-939	KKERRK
UP000006174	Ustilago hordei	I2G125	Uncharacterized protein	0.666	249-260	KRLMEKENKRAR
UP000006174	Ustilago hordei	I2G1C8	FAD-binding FR-type domain-containing protein	0.987	1009-1036	KRIRSEGKLRRAKTRRNTVKRKGGRGGK
UP000006174	Ustilago hordei	I2G2X5	Uncharacterized protein	0.99	192-222	SPPVILRRRTQKIGMSGVKRRKRRRAMPGFK
UP000006174	Ustilago hordei	I2G2X5	Uncharacterized protein	0.958	167-189	KGKVGRAPSRRKGRSRAAASAGI
UP000006174	Ustilago hordei	I2G443	Uncharacterized protein	0.894	121-130	RGGRRRRRRS
UP000006174	Ustilago hordei	I2G5N5	Vac14_Fig4_bd domain-containing protein	0.873	304-317	RRAERQEHKKRKGK
UP000006174	Ustilago hordei	I2G6E7	Uncharacterized protein	0.903	82-91	RKERARKRRR
UP000006174	Ustilago hordei	I2G6I8	NudC domain-containing protein 1	0.995	860-886	PRKRSGKAPRRTEKSKRRKDPRTSKAG
UP000006174	Ustilago hordei	I2G6R8	Protein SQS1	0.961	1035-1061	KAGSAGKTKSTKKQSKLARKAGKREMR
UP000006174	Ustilago hordei	I2G6R8	Protein SQS1	0.931	1207-1219	DKSRGKKGKRGGG
UP000006174	Ustilago hordei	I2G6R8	Protein SQS1	0.901	659-675	KKRGRGQRAKRSTANRA
UP000006174	Ustilago hordei	I2G6R8	Protein SQS1	0.862	562-578	SSRKKQSATRGKPRRIP
UP000006174	Ustilago hordei	I2G6R8	Protein SQS1	0.752	14-27	KGRVPIRGGRGRGG
UP000006174	Ustilago hordei	I2G6R8	Protein SQS1	0.644	983-986	KRKG
UP000006174	Ustilago hordei	I2FLV7	Stress response protein NST1	0.998	914-1016	EIRLQREAERKAKEDEKAKKEEERRRRQAEEREREMERERKRREKEERARLEREAQEKAKRDREEAQRKAREEQQRAQREKAEKEQKAKEEQELKIDAAKKEK
UP000006174	Ustilago hordei	I2FLV7	Stress response protein NST1	0.997	386-400	ASKNKKKKKKKKSGA
UP000006174	Ustilago hordei	I2FLV7	Stress response protein NST1	0.994	855-890	KAREARRMKESQKKKDKKKQQREAKEAEKMRKDQER
UP000006174	Ustilago hordei	I2FLV7	Stress response protein NST1	0.983	101-113	AKKKKKKSKSKAK
UP000006174	Ustilago hordei	I2FMA2	Uncharacterized protein	0.994	73-97	GHHKQKQSRGKGKGKTRKAKPKLPR
UP000006174	Ustilago hordei	I2FMC5	Uncharacterized protein	0.64	249-253	KRQRR
UP000006174	Ustilago hordei	I2FMS6	Probable ATP dependent RNA helicase of the DEAD-box family	0.977	640-679	DGKDSKKNRLMGAKSKSSTAKGNGVKGRKKADPLRKFSNK
UP000006174	Ustilago hordei	I2FMS6	Probable ATP dependent RNA helicase of the DEAD-box family	0.968	414-437	GKKRKSDTASSKKSRKKQKQSKSK
UP000006174	Ustilago hordei	I2FQE7	Related to HMG-box transcription factor	0.772	297-304	RPKKKGKT
UP000006174	Ustilago hordei	I2FR37	Uncharacterized protein	0.87	173-198	KGKQKVSQRQRRRTGSIKRHLLGKIK
UP000006174	Ustilago hordei	I2FR37	Uncharacterized protein	0.68	220-232	PKLSRRQRQHARS
UP000006174	Ustilago hordei	I2FW14	ORC_WH_C domain-containing protein	0.665	900-906	KRKSPRK
UP000006174	Ustilago hordei	I2FW74	Related to RRP5-processing of pre-ribosomal RNA	0.967	92-114	AKRNKNKQKFNREKRNDAKKKRA
UP000006174	Ustilago hordei	I2FW74	Related to RRP5-processing of pre-ribosomal RNA	0.693	1258-1269	ALKKSEAKSKSK
UP000006174	Ustilago hordei	I2FWC4	Uncharacterized protein	0.859	322-335	PKKRVYKFSKERKR
UP000006174	Ustilago hordei	I2FWC4	Uncharacterized protein	0.776	38-52	LRAKDHHKKRDMLKR
UP000006174	Ustilago hordei	I2FWC4	Uncharacterized protein	0.661	278-286	RSKVVKAKK
UP000006174	Ustilago hordei	I2FWC4	Uncharacterized protein	0.617	23-26	GRAK
UP000006174	Ustilago hordei	I2FWC4	Uncharacterized protein	0.602	32-34	KHK
UP000006174	Ustilago hordei	I2FWE2	Related to TAF1-TFIID subunit (TBP-associated factor), 145 kD	0.863	552-564	KKKKEGAGARKAK
UP000006174	Ustilago hordei	I2FWE2	Related to TAF1-TFIID subunit (TBP-associated factor), 145 kD	0.728	262-267	PKKRKL
UP000006174	Ustilago hordei	I2FWE2	Related to TAF1-TFIID subunit (TBP-associated factor), 145 kD	0.657	1058-1068	KKNQERRIQRK
UP000006174	Ustilago hordei	I2FWE2	Related to TAF1-TFIID subunit (TBP-associated factor), 145 kD	0.646	1208-1212	KLKKK
UP000006174	Ustilago hordei	I2FYT2	Uncharacterized protein	0.883	12-27	RKAAIKREAKRNRERK
UP000006174	Ustilago hordei	I2FYT4	VASt domain-containing protein	0.926	679-694	KQSKRARLKRKLKGTK
UP000006174	Ustilago hordei	I2G0Z5	Uncharacterized protein	0.793	1719-1751	AGKQQRPKANNGAEGGNKASPKAAEKSAGGKGK
UP000006174	Ustilago hordei	I2G0Z5	Uncharacterized protein	0.769	1631-1654	NKGSKGGATGAAGGGKGKSQQKKA
UP000006174	Ustilago hordei	I2G0Z5	Uncharacterized protein	0.722	1688-1701	GGNKKGGAAAKGSG
UP000006174	Ustilago hordei	I2G202	Uncharacterized protein	0.986	546-620	SSKRDAPKSKHSNKPQQKDDLKHSDRATAKDKKGKPDSNPQAGSKRTQQSARPSEEDGSKPKHKRGTRAGKKVKK
UP000006174	Ustilago hordei	I2G202	Uncharacterized protein	0.985	750-774	RKGQQKGKKRKAGEGDAERGKKKPR
UP000006174	Ustilago hordei	I2G202	Uncharacterized protein	0.859	450-463	KTAKMESKKGKRKQ
UP000006174	Ustilago hordei	I2G3B6	Probable dual specificity protein kinase Fuz7	0.606	348-348	R
UP000006174	Ustilago hordei	I2G3D6	Uncharacterized protein	0.859	155-170	KKWKNLKRREIEARRK
UP000006174	Ustilago hordei	I2G4R5	Related to metalloprotease	0.812	117-131	KKPNSPKKKVPPIAK
UP000006174	Ustilago hordei	I2G5U5	Velvet domain-containing protein	0.737	435-442	NDKKKQRR
UP000006174	Ustilago hordei	I2G6S8	Ubiquitinyl hydrolase 1	0.784	156-167	AKQGKQVKKRRK
UP000006174	Ustilago hordei	I2FMQ6	C2H2-type domain-containing protein	0.707	174-182	KGKGKQRAM
UP000006174	Ustilago hordei	I2FMU9	Uncharacterized protein	0.916	448-466	QPGNKRKRVGEEKGKKGME
UP000006174	Ustilago hordei	I2FPS0	Uncharacterized protein	0.99	175-199	KPSKSRSRKRRRTAASPSRKRGFRG
UP000006174	Ustilago hordei	I2FPW3	Uncharacterized protein	0.918	198-219	RLDAKAKARAVGKARGKQFKRR
UP000006174	Ustilago hordei	I2FT02	Related to IES1-Subunit 1 of the INO80 chromatin remodeling complex	0.975	127-142	RWKKRLARKKKLERKA
UP000006174	Ustilago hordei	I2FTB7	Related to RDS2-Regulator of drug sensitivity	0.712	347-355	RKESRKKVK
UP000006174	Ustilago hordei	I2FX26	Related to aromatic amino acid aminotransferase I	0.691	105-113	KRPRVKEGK
UP000006174	Ustilago hordei	I2FX58	Uncharacterized protein	0.994	606-615	KKKKKKKKRP
UP000006174	Ustilago hordei	I2FX58	Uncharacterized protein	0.919	1281-1309	KPKKKAGDAGSVRSKVSTKSKKGAAAGKR
UP000006174	Ustilago hordei	I2FX58	Uncharacterized protein	0.642	1466-1471	RFKRNK
UP000006174	Ustilago hordei	I2FX58	Uncharacterized protein	0.613	123-125	KKK
UP000006174	Ustilago hordei	I2FY41	Uncharacterized protein	0.912	1321-1330	GGGKKKRGGR
UP000006174	Ustilago hordei	I2FYR7	RING-type domain-containing protein	0.839	677-689	KRQKKQRRPAAKS
UP000006174	Ustilago hordei	I2FZ96	Rhomboid domain-containing protein	0.866	91-104	GPPSKRRPSRRHPS
UP000006174	Ustilago hordei	I2G172	Aminotran_1_2 domain-containing protein	0.611	386-388	KRK
UP000006174	Ustilago hordei	I2G2R0	Uncharacterized protein	0.988	262-370	RARKRDDRDRAHAESMERKLQTEARRKADRDARRLAREKAEQEEAERRKRHHEEAQRRRIAAEREAEEARILKEKEAAERRARRKQQQEERRKREEEVAIRKAEEDAKR
UP000006174	Ustilago hordei	I2G2R0	Uncharacterized protein	0.657	430-436	RRAGRRE
UP000006174	Ustilago hordei	I2G3B9	Dihydrolipoyllysine-residue succinyltransferase	0.995	157-197	EKKEEKKEEKPKQGKKPKQEEKPKQEEKPKADENQQPAKKS
UP000006174	Ustilago hordei	I2G3S8	Probable high-affinity iron permease	0.718	140-146	KRKWKRK
UP000006174	Ustilago hordei	I2G3Z7	Related to RPF1-involved in the assembly of the large ribosomal subunit	0.946	28-69	KMKRTELYRKYKADKHKAKFSRRSAQAKEERGEDGAAKKAAR
UP000006174	Ustilago hordei	I2G3Z7	Related to RPF1-involved in the assembly of the large ribosomal subunit	0.929	396-428	AGKKAKKETKEKKEQEEQVKEKLVSGNKKKRQR
UP000006174	Ustilago hordei	I2G4R2	Uncharacterized protein	0.748	861-868	ERKARKAR
UP000006174	Ustilago hordei	I2G6I0	Uncharacterized protein	0.918	167-186	APRPKRSPKKASRISVVGRR
UP000006174	Ustilago hordei	I2G6I0	Uncharacterized protein	0.839	429-443	RRREAERERERPKKK
UP000006174	Ustilago hordei	I2FMS0	Chloride channel protein	0.635	75-79	RGRKR
UP000006174	Ustilago hordei	I2FN96	Transcription initiation factor TFIID subunit 8	0.819	303-322	AKRKHDLARAQAKRERRMAK
UP000006174	Ustilago hordei	I2FN96	Transcription initiation factor TFIID subunit 8	0.664	236-240	RAKRK
UP000006174	Ustilago hordei	I2FN96	Transcription initiation factor TFIID subunit 8	0.616	223-226	GKAR
UP000006174	Ustilago hordei	I2FNA4	Branchpoint-bridging protein	0.645	132-135	RKRK
UP000006174	Ustilago hordei	I2FPG6	Related to phosphatidylinositol 3-phosphate 5-kinase	0.829	1814-1822	ALKRKKRGR
UP000006174	Ustilago hordei	I2FPG6	Related to phosphatidylinositol 3-phosphate 5-kinase	0.771	1518-1532	RRRERKQKQAQADKR
UP000006174	Ustilago hordei	I2FQ47	Uncharacterized protein	0.987	1214-1231	GARPAKPDKPAKKKKRAS
UP000006174	Ustilago hordei	I2FSH4	RRM domain-containing protein	0.967	687-769	LKKEDQDRINRRMEKKNKKFPASAKGAFKADKSLLAEGDKVKSKEKVRLRQPNGAGAKGVGGGNKFNKAPPQVGARRGPPKAK
UP000006174	Ustilago hordei	I2FSH4	RRM domain-containing protein	0.948	260-272	GKKKNKKNKNKGK
UP000006174	Ustilago hordei	I2FSH4	RRM domain-containing protein	0.846	567-580	GKELKRRLKLKGRP
UP000006174	Ustilago hordei	I2FTK5	Eukaryotic translation initiation factor 3 subunit A	0.842	783-812	EERRRKAAEQIELEKEKRRQQMREQRRRER
UP000006174	Ustilago hordei	I2FX30	Uncharacterized protein	0.998	61-82	ARKEDKKRKRKEKDKARKQKRA
UP000006174	Ustilago hordei	I2FX30	Uncharacterized protein	0.862	220-245	SKRRKLGNGKAQGKDDKGAAAAGKKG
UP000006174	Ustilago hordei	I2FXI9	Probable mitochondrial protein import receptor tom70	0.992	113-125	NKKKKKKGTKKKA
UP000006174	Ustilago hordei	I2FYG5	PH domain-containing protein	0.96	2012-2022	TLPRRRRRRRR
UP000006174	Ustilago hordei	I2FZL1	Uncharacterized protein	0.773	235-248	KQARLEKQKAAKKA
UP000006174	Ustilago hordei	I2FZQ6	Uncharacterized protein	0.773	622-647	RRRAPGNRHVIEHRKTVKLAIRRAKK
UP000006174	Ustilago hordei	I2FZU5	Uncharacterized protein	0.989	90-129	DSRRETYRKSKGLKPFKNKGGNSLFDAHKSKNGGKPKRRR
UP000006174	Ustilago hordei	I2G0X3	Telomere_reg-2 domain-containing protein	0.912	593-614	REVKKREKAKVTRLPRRVNPPP
UP000006174	Ustilago hordei	I2G335	Uncharacterized protein	0.942	90-116	RAKAQEKAEKAKRQAAEQKRLKKQKEK
UP000006174	Ustilago hordei	I2G335	Uncharacterized protein	0.931	186-214	ERADEVAKLQRERKQRRKEQRAGGVVKGR
UP000006174	Ustilago hordei	I2G335	Uncharacterized protein	0.914	279-309	KARAFLKRALEKKKGGFKSATSAKGASAAKK
UP000006174	Ustilago hordei	I2G335	Uncharacterized protein	0.624	181-184	KRSA
UP000006174	Ustilago hordei	I2G627	PARP-type domain-containing protein	0.99	436-464	SGKKRGRPPKEKTEGEEAAKRPRGRPKKA
UP000006174	Ustilago hordei	I2G627	PARP-type domain-containing protein	0.91	382-392	PPAKKRGRPKK
UP000006174	Ustilago hordei	I2G627	PARP-type domain-containing protein	0.886	333-342	PKKRGRPKKE
UP000006174	Ustilago hordei	I2G627	PARP-type domain-containing protein	0.777	284-292	PAKKRGRPS
UP000006174	Ustilago hordei	I2G627	PARP-type domain-containing protein	0.765	169-177	KRKPGRPPK
UP000006174	Ustilago hordei	I2G627	PARP-type domain-containing protein	0.684	499-507	KKPTGRPKK
UP000006174	Ustilago hordei	I2G627	PARP-type domain-containing protein	0.678	251-257	KRGRPPK
UP000006174	Ustilago hordei	I2G6T5	Drf_GBD domain-containing protein	0.721	95-106	KKGLRSRSRSRS
UP000006174	Ustilago hordei	I2FN40	Related to ECM16-putative DEAH-box RNA helicase	0.879	896-922	LEKRFGRKAIAQKNKDRERVQGKHKNR
UP000006174	Ustilago hordei	I2FN40	Related to ECM16-putative DEAH-box RNA helicase	0.834	267-277	RKRTKKPKTTR
UP000006174	Ustilago hordei	I2FN40	Related to ECM16-putative DEAH-box RNA helicase	0.676	145-149	AKRRR
UP000006174	Ustilago hordei	I2FN40	Related to ECM16-putative DEAH-box RNA helicase	0.605	14-14	R
UP000006174	Ustilago hordei	I2FPC5	Uncharacterized protein	0.732	270-279	RKRAARAGKK
UP000006174	Ustilago hordei	I2FPX8	Condensin complex subunit 2	0.611	327-328	RK
UP000006174	Ustilago hordei	I2FQN9	Tudor domain-containing protein	0.857	221-237	QRKKYRNEKKLARREEK
UP000006174	Ustilago hordei	I2FU44	Uncharacterized protein	0.995	879-906	KKQMKKQMKKEAKKEAKKEAKREHRKVE
UP000006174	Ustilago hordei	I2FU44	Uncharacterized protein	0.8	94-101	RRARRKRR
UP000006174	Ustilago hordei	I2FWB3	Related to NOP6-protein with possible role in rRNA processing	0.988	289-367	RQEKIKAKNAGLEKERQKLHGKYVAPKNEARKQARGAKGAKGGQEGEGEGRERKRQRRDGNAEEGGSRWGRNSGKERKV
UP000006174	Ustilago hordei	I2FWB3	Related to NOP6-protein with possible role in rRNA processing	0.839	92-102	KEEKRSHKRKR
UP000006174	Ustilago hordei	I2FWB3	Related to NOP6-protein with possible role in rRNA processing	0.64	134-137	KPKK
UP000006174	Ustilago hordei	I2FWN8	Related to NOC3 protein, required for maturation and intranuclear transport of pre-ribosomes	0.996	679-727	KAAKEHAERRAAMKARQKKGKGGGKEANAKLVRKGLATHLSKKQVKKQK
UP000006174	Ustilago hordei	I2FWN8	Related to NOC3 protein, required for maturation and intranuclear transport of pre-ribosomes	0.92	4-35	KRKAAPSSGAGSSAKQPATKSKRAPSRRPAPK
UP000006174	Ustilago hordei	I2FWN8	Related to NOC3 protein, required for maturation and intranuclear transport of pre-ribosomes	0.691	132-144	KAKDLKRSDRRQF
UP000006174	Ustilago hordei	I2FWN8	Related to NOC3 protein, required for maturation and intranuclear transport of pre-ribosomes	0.686	146-156	ETRKRIAAQKK
UP000006174	Ustilago hordei	I2G191	Related to MOT2-transcriptional repressor	0.616	163-167	KQKER
UP000006174	Ustilago hordei	I2G2S2	Uncharacterized protein	0.724	101-108	QRKRGRHS
UP000006174	Ustilago hordei	I2G2S2	Uncharacterized protein	0.711	448-453	RRKGKR
UP000006174	Ustilago hordei	I2G2S2	Uncharacterized protein	0.653	280-293	RAKSGSRSMSARRK
UP000006174	Ustilago hordei	I2G4T1	60S ribosomal protein L36	0.967	73-96	RNSKDKRARKFIKRRVGTLRRAKN
UP000006174	Ustilago hordei	I2G4T1	60S ribosomal protein L36	0.654	39-44	NRKGRE
UP000006174	Ustilago hordei	I2G6D4	Uncharacterized protein	0.992	1401-1419	VRNRERKRKTRVKPKKAKG
UP000006174	Ustilago hordei	I2G6D4	Uncharacterized protein	0.975	1504-1536	KAEKRKSGPKSKRAKSDSASATDKARKPRASFK
UP000006174	Ustilago hordei	I2G6D4	Uncharacterized protein	0.892	1635-1647	RKTGKKRRSKTAA
UP000006174	Ustilago hordei	I2G6K1	G-patch domain-containing protein	0.959	713-740	RKGVHNEIDKAASKSATKRKKEKASKGK
UP000006174	Ustilago hordei	I2G6X4	Protein acetyllysine N-acetyltransferase	0.983	338-357	EGSSSKKPIKKKRKLGNGKS
UP000006174	Ustilago hordei	I2FNX9	JmjC domain-containing histone demethylation protein 1	0.942	245-264	KKQAKSKSKSKGKQSRLKPR
UP000006174	Ustilago hordei	I2FNX9	JmjC domain-containing histone demethylation protein 1	0.917	642-664	QRMKAEKVGNGGVKKGRAHRRGS
UP000006174	Ustilago hordei	I2FQS5	Uncharacterized protein	0.719	10-21	RSRVSHRIRRRR
UP000006174	Ustilago hordei	I2FSC5	Uncharacterized protein	0.613	296-297	RK
UP000006174	Ustilago hordei	I2FSK2	Zn(2)-C6 fungal-type domain-containing protein	0.78	13-30	KEERPPSKPTARRRAYAK
UP000006174	Ustilago hordei	I2FTX5	Uncharacterized protein	0.659	476-481	LKARRP
UP000006174	Ustilago hordei	I2FUT1	Related to RRP12-Protein required for normal pre-rRNA Processing	0.988	1156-1170	IRKRKERAKRKKAGA
UP000006174	Ustilago hordei	I2FUT1	Related to RRP12-Protein required for normal pre-rRNA Processing	0.941	1238-1269	ALARNRNRNRNRKDGGRDGDEKEGRRDRRRAK
UP000006174	Ustilago hordei	I2FUT1	Related to RRP12-Protein required for normal pre-rRNA Processing	0.928	1428-1453	RRAQGADKKRRVKETIGKEFRAKRGG
UP000006174	Ustilago hordei	I2FUT1	Related to RRP12-Protein required for normal pre-rRNA Processing	0.869	1487-1496	GKGDKSRKRR
UP000006174	Ustilago hordei	I2FUT1	Related to RRP12-Protein required for normal pre-rRNA Processing	0.677	260-266	GKGKNKK
UP000006174	Ustilago hordei	I2FV08	Related to N2,N2-dimethylguanosine tRNA methyltransferase	0.933	70-94	KKARIVRAAQRKTATAGKGKSKRKG
UP000006174	Ustilago hordei	I2FV08	Related to N2,N2-dimethylguanosine tRNA methyltransferase	0.911	713-723	AKGHKGKKKRN
UP000006174	Ustilago hordei	I2FVL2	RRM domain-containing protein	0.98	353-370	AAAEKKKRKKELVRAKKA
UP000006174	Ustilago hordei	I2FW00	Uncharacterized protein	0.757	1250-1255	RKRKRK
UP000006174	Ustilago hordei	I2FWT1	Related to ATP-binding cassette, sub-family A	0.767	1283-1292	RRRKSYKKRR
UP000006174	Ustilago hordei	I2FXP7	Related to RMD8-Cytosolic protein required for sporulation	0.986	747-761	PKERRTRKLRRRKRR
UP000006174	Ustilago hordei	I2G1I9	Uncharacterized protein	0.741	1284-1292	RRSRRRSSR
UP000006174	Ustilago hordei	I2G1I9	Uncharacterized protein	0.736	1215-1230	AMRKGKGEHVVHRRRG
UP000006174	Ustilago hordei	I2G1I9	Uncharacterized protein	0.634	50-55	KFWRKH
UP000006174	Ustilago hordei	I2G2B4	SET domain-containing protein	0.689	112-119	AAPKKLKP
UP000006174	Ustilago hordei	I2G4C8	Ribosome production factor 2 homolog	0.751	6-19	KPKNARSKRALEKR
UP000006174	Ustilago hordei	I2FML8	Uncharacterized protein	0.946	381-399	EKRRVKLNDKPKKKATKPT
UP000006174	Ustilago hordei	I2FML8	Uncharacterized protein	0.872	412-421	RRKRGRPRIR
UP000006174	Ustilago hordei	I2FML8	Uncharacterized protein	0.722	309-317	KMTKKRHKT
UP000006174	Ustilago hordei	I2FNA3	BZIP domain-containing protein	0.634	438-445	KRQLRNKI
UP000006174	Ustilago hordei	I2FQF8	Uncharacterized protein	0.705	114-122	KRLRKLQRR
UP000006174	Ustilago hordei	I2FR83	Uncharacterized protein	0.769	165-174	KKKTKSHKEK
UP000006174	Ustilago hordei	I2FSE7	Related to pre-mRNA splicing factor U2AF large chain	0.677	96-100	RRRRR
UP000006174	Ustilago hordei	I2FUV1	Probable vacuolar ATP synthase subunit D	0.941	213-235	KKVQAKKKEKAAASDKQRKKLQG
UP000006174	Ustilago hordei	I2FUV1	Probable vacuolar ATP synthase subunit D	0.897	264-281	GSKNKSKNKNKNKNKNKD
UP000006174	Ustilago hordei	I2FVH6	DRIM domain-containing protein	0.974	3029-3093	RRQQAKREQRKTERLMRGIQNPELQAKRNEKRNQKNHMARKRRNQVNLEKREAGGSGKTKRARRT
UP000006174	Ustilago hordei	I2FVH6	DRIM domain-containing protein	0.967	11-34	KAGKKPTREQQRKKADKKASKVRR
UP000006174	Ustilago hordei	I2FWC8	Probable CHD1-transcriptional regulator	0.994	340-391	SKRKRSSAAKFTSGSKRQRVTKGARHRQSRANPRRRIAVRRTRSTRARPPRM
UP000006174	Ustilago hordei	I2FWC8	Probable CHD1-transcriptional regulator	0.981	512-537	KRAQKREAKKRRDKSPERLDSRGRQR
UP000006174	Ustilago hordei	I2FWC8	Probable CHD1-transcriptional regulator	0.974	136-188	RNAKSRPGKQSSAPKGKGKTNGASRSKARATSSRPHPSAASIPGGRQLPPPRK
UP000006174	Ustilago hordei	I2FWC8	Probable CHD1-transcriptional regulator	0.971	280-299	RARKKSAIRSRKNKKDRSRR
UP000006174	Ustilago hordei	I2FWC8	Probable CHD1-transcriptional regulator	0.858	1653-1666	PARRGPGRPKKVPK
UP000006174	Ustilago hordei	I2FWC8	Probable CHD1-transcriptional regulator	0.73	1618-1634	EAREKEAQEKRASRRDR
UP000006174	Ustilago hordei	I2FWC8	Probable CHD1-transcriptional regulator	0.692	1292-1296	KKKKK
UP000006174	Ustilago hordei	I2FWF3	Chromatin-remodeling ATPase INO80	0.943	781-816	KRNEKEERELRKKAEREAVEKAKKEEEMREAKRQAR
UP000006174	Ustilago hordei	I2FWF3	Chromatin-remodeling ATPase INO80	0.936	1862-1876	KAAPGKRKSKSHRKK
UP000006174	Ustilago hordei	I2FWF3	Chromatin-remodeling ATPase INO80	0.908	619-640	IIKLKRSKGKLGSVDPRSKKRR
UP000006174	Ustilago hordei	I2FXJ3	Uncharacterized protein	0.808	201-214	GKRMKQLRMRRRRD
UP000006174	Ustilago hordei	I2FXJ3	Uncharacterized protein	0.643	440-445	RKSKSR
UP000006174	Ustilago hordei	I2FXK6	Bromo domain-containing protein	0.858	810-822	KRPKKQKDKERER
UP000006174	Ustilago hordei	I2FXK6	Bromo domain-containing protein	0.743	186-197	NPSRRPIKRLRS
UP000006174	Ustilago hordei	I2FXK6	Bromo domain-containing protein	0.702	548-558	KHAKGKQRLGA
UP000006174	Ustilago hordei	I2FXK6	Bromo domain-containing protein	0.629	688-693	KDKEKA
UP000006174	Ustilago hordei	I2G0D0	Vacuolar fusion protein MON1	0.961	298-310	RRKRRRDQRRRRE
UP000006174	Ustilago hordei	I2G0I0	Uncharacterized protein	0.821	115-127	SKARMLRVRKKRR
UP000006174	Ustilago hordei	I2G0P7	Probable UDP-glucose:sterol glucosyltransferase Ugt53A1	0.981	1151-1166	WSGRGGSKPKKKKKQP
UP000006174	Ustilago hordei	I2G0P7	Probable UDP-glucose:sterol glucosyltransferase Ugt53A1	0.791	419-428	RPGKMRPKRR
UP000006174	Ustilago hordei	I2G0P7	Probable UDP-glucose:sterol glucosyltransferase Ugt53A1	0.718	1516-1529	KAEDIRRRKLLQER
UP000006174	Ustilago hordei	I2G244	Related to NCA2-control of mitochondrial synthesis of Atp6p and Atp8p	0.661	277-282	KSKKQR
UP000006174	Ustilago hordei	I2G2C7	Uncharacterized protein	0.988	389-427	EAKRKAEKEKFDKLSPAEQAKRKEVERKRAMKKAGTKVR
UP000006174	Ustilago hordei	I2G4S1	Type II protein arginine methyltransferase	0.615	276-280	RQQRK
UP000006174	Ustilago hordei	I2G4T2	Uncharacterized protein	0.67	586-593	GGKGKPHQ
UP000006174	Ustilago hordei	I2G4T2	Uncharacterized protein	0.606	570-573	GGHR
UP000006174	Ustilago hordei	I2G4W0	Chromo domain-containing protein	1	52-99	RPPPRAPPSRSLAKKAERREIDRKRRKEKKRRKEKKRRLKRQRRQAEA
UP000006174	Ustilago hordei	I2G4W0	Chromo domain-containing protein	0.993	405-427	RRPRQRAHEAKKRKRRDIRRDKV
UP000006174	Ustilago hordei	I2G4W0	Chromo domain-containing protein	0.753	438-451	KDRAKAKAKEEARY
UP000006174	Ustilago hordei	I2G523	Related to TRP4-anthranilate phosphoribosyltransferase	0.754	460-471	NKAKSRKQKESL
UP000006174	Ustilago hordei	I2G6K9	Uncharacterized protein	0.961	447-468	EKKPPPKRAMKAGKRAQAIRGG
UP000006174	Ustilago hordei	I2G6K9	Uncharacterized protein	0.938	824-846	NRKKLVEKKSKAKSKAQAALSKK
UP000006174	Ustilago hordei	I2G6K9	Uncharacterized protein	0.679	299-303	KKKRK
UP000006174	Ustilago hordei	I2G6P7	Probable 60S ribosomal protein L32	0.882	10-53	KKRTKAFKRHHSDRYHRVGESWRKPKGIDSAVRRRFRGTVRMPK
UP000006174	Ustilago hordei	I2FMX7	Related to Cyclophilin-16	0.973	180-211	DQKREMERKERQEARKRKQDEQRINKGKGKKN
UP000006174	Ustilago hordei	I2FQX0	Kynureninase	0.667	1070-1079	KLIARAHKRA
UP000006174	Ustilago hordei	I2FRH3	Uncharacterized protein	0.99	93-114	QKGKGKGKSKGKSKGGERGRVA
UP000006174	Ustilago hordei	I2FRI4	Uncharacterized protein	0.976	774-786	RKLKKRAKDKKRK
UP000006174	Ustilago hordei	I2FRI7	Uncharacterized protein	0.654	265-274	KPAKMVKNKK
UP000006174	Ustilago hordei	I2FRJ8	Probable CHD1-transcriptional regulator	0.953	261-275	PKSKSKRKAKRSAAP
UP000006174	Ustilago hordei	I2FRJ8	Probable CHD1-transcriptional regulator	0.858	1402-1435	KAGKKVRKSTSPTHSPAPTGKAGRGGGGADKKRP
UP000006174	Ustilago hordei	I2FT19	Eukaryotic translation initiation factor 3 subunit J	0.862	58-70	PPRKKKSVKQKIA
UP000006174	Ustilago hordei	I2FT19	Eukaryotic translation initiation factor 3 subunit J	0.729	203-222	AEKEAKKTGGQKVPVGKAKP
UP000006174	Ustilago hordei	I2FTQ4	Uncharacterized protein	0.963	625-647	ENRQKMIEKEKERLKSKRGWRKK
UP000006174	Ustilago hordei	I2FU04	Uncharacterized protein	0.998	365-409	NPKRKEEERKEKEEEEKKKKEEEEKKKKEEAKKGGDDKKEGDKKK
UP000006174	Ustilago hordei	I2FVA6	Zn(2)-C6 fungal-type domain-containing protein	0.998	53-72	RELRKKRAKKKRSFPKRKSR
UP000006174	Ustilago hordei	I2FXK5	Probable ERG25-C-4 methyl sterol oxidase	0.713	292-303	RARARQAEKKRQ
UP000006174	Ustilago hordei	I2FZ80	Uncharacterized protein	0.797	90-98	RRSKKGKRK
UP000006174	Ustilago hordei	I2G181	Zds_C domain-containing protein	0.988	709-734	KLEEKSQRKREKHEKRERKEREREER
UP000006174	Ustilago hordei	I2G181	Zds_C domain-containing protein	0.81	367-393	RRAARTKMRKASGDASRASLASRRRPP
UP000006174	Ustilago hordei	I2G188	Related to Endothelin-converting enzyme 1	0.999	394-416	SKKKETKKGKKDKKNKKGKKSRP
UP000006174	Ustilago hordei	I2G188	Related to Endothelin-converting enzyme 1	0.907	287-311	PGRSPKPHPPRESPRPAPPSGKRQK
UP000006174	Ustilago hordei	I2G469	Uncharacterized protein	0.886	1269-1296	RKREKKISPPPPLPPPPPPPPLPLPPPP
UP000006174	Ustilago hordei	I2FNZ4	Uncharacterized protein	0.961	422-431	SQRRRRKRKK
UP000006174	Ustilago hordei	I2FNZ4	Uncharacterized protein	0.695	208-221	RKAASTSPKKGGGA
UP000006174	Ustilago hordei	I2FP95	Uncharacterized protein	0.742	81-86	HKKRRK
UP000006174	Ustilago hordei	I2FRD8	Probable PRP2-RNA-dependent ATPase of DEAH box family	0.947	116-126	PERRRRRKEKK
UP000006174	Ustilago hordei	I2FTG2	GYF domain-containing protein	0.941	241-259	GRSTTRKSKSKKNKLKAPK
UP000006174	Ustilago hordei	I2FTG2	GYF domain-containing protein	0.836	110-119	RRRAERKRRP
UP000006174	Ustilago hordei	I2FTG2	GYF domain-containing protein	0.768	145-155	KSKGKQKGRAK
UP000006174	Ustilago hordei	I2FTG2	GYF domain-containing protein	0.665	363-368	KKKAAK
UP000006174	Ustilago hordei	I2FTJ0	RRM domain-containing protein	0.998	4-25	KGKGKGKGKGKGKGKGKGKGPE
UP000006174	Ustilago hordei	I2FTJ0	RRM domain-containing protein	0.994	1085-1130	RSEEEKEKHWAKYKKELTKVIRKRHREAARKHKRNFKSMPQANKRA
UP000006174	Ustilago hordei	I2FTJ0	RRM domain-containing protein	0.945	39-78	GFRKRKQERKQAGREYLAKKAKEEQLIARKELREARKEKA
UP000006174	Ustilago hordei	I2FTM6	Chitin synthase	0.988	953-967	RSRLRKKKREEKRRR
UP000006174	Ustilago hordei	I2FUI6	Uncharacterized protein	0.843	259-272	RGIRKKRSARLGSR
UP000006174	Ustilago hordei	I2FUI6	Uncharacterized protein	0.747	7-15	HKRSRRPRP
UP000006174	Ustilago hordei	I2FWQ3	Replication factor C subunit 1	0.995	950-980	KLVKKSKAPVGVKEKSKAAARGGRGKAKRTK
UP000006174	Ustilago hordei	I2FWQ3	Replication factor C subunit 1	0.933	99-124	APKAKAKPASAKNSPRKSTTIKRKAK
UP000006174	Ustilago hordei	I2FWQ3	Replication factor C subunit 1	0.781	209-226	NKGAAPAKAWPAKKPAPA
UP000006174	Ustilago hordei	I2FYL6	Uncharacterized protein	0.63	182-184	KKK
UP000006174	Ustilago hordei	I2FZE9	Uncharacterized protein	0.996	173-194	EKHHRKVEKRERRRRRERLRRI
UP000006174	Ustilago hordei	I2FZE9	Uncharacterized protein	0.714	606-611	KSKKKK
UP000006174	Ustilago hordei	I2FZW1	Uncharacterized protein	0.978	214-239	RKRGRPRKHPLPHPNNPAPPKTKRKL
UP000006174	Ustilago hordei	I2FZW1	Uncharacterized protein	0.952	461-486	REATRKVREATRIAKKDRKAREKSLK
UP000006174	Ustilago hordei	I2FZY4	Probable RPL4A-ribosomal protein L4-A	0.701	186-199	KIRAGVGKLRNRRH
UP000006174	Ustilago hordei	I2G0P6	Related to ring finger protein 14	0.743	117-129	KGKQRNGRNRARK
UP000006174	Ustilago hordei	I2G1J3	Uncharacterized protein	0.999	43-84	RREEARKVKRQAQVADRGEAKKKKKNKQGKHGKHGKHGKHKE
UP000006174	Ustilago hordei	I2G1W0	Uncharacterized protein	0.834	527-544	KKPPDRSRRHQRKYERPR
UP000006174	Ustilago hordei	I2G683	Uncharacterized protein	0.823	954-965	KRSKKAQKRQKE
UP000006174	Ustilago hordei	I2G683	Uncharacterized protein	0.643	88-95	LKSERGRK
UP000006174	Ustilago hordei	I2G683	Uncharacterized protein	0.602	85-86	RG
UP000006174	Ustilago hordei	I2G6D2	Methyltransf_25 domain-containing protein	0.942	842-853	GGKKSKKKVKRP
UP000006174	Ustilago hordei	I2G6Z3	Uncharacterized protein	0.841	365-380	RPGKRRDEKRPPEHIR
UP000006174	Ustilago hordei	I2FQ58	Related to phosphatidylinositol-4-kinase	0.697	1824-1831	KKSKSEKK
UP000006174	Ustilago hordei	I2FQA6	Poly(A) polymerase	0.761	563-572	GKRTKSGKKR
UP000006174	Ustilago hordei	I2FRS6	Histone acetyltransferase GCN5	0.706	193-205	KRKLRDASRSRSR
UP000006174	Ustilago hordei	I2FT36	Related to RAD4-Excision repair protein	0.795	355-391	RHRRERREQQRYKEAKEPQSKSAAEADGRSKSKGKAR
UP000006174	Ustilago hordei	I2FT36	Related to RAD4-Excision repair protein	0.704	5-14	RRPARRQPRK
UP000006174	Ustilago hordei	I2FT36	Related to RAD4-Excision repair protein	0.698	1198-1206	PAGKRQRRL
UP000006174	Ustilago hordei	I2FT36	Related to RAD4-Excision repair protein	0.667	501-509	NPLRAKNKG
UP000006174	Ustilago hordei	I2FT44	Related to RRP9-protein associated with the U3 small nucleolar RNA	0.817	32-52	AGPSRAKPSSKSSSRMRKGGK
UP000006174	Ustilago hordei	I2FT53	40S ribosomal protein S26	0.821	87-108	RSREGRRNRLPPPRVRFNKDGK
UP000006174	Ustilago hordei	I2FT53	40S ribosomal protein S26	0.69	4-12	KRRSGGRNK
UP000006174	Ustilago hordei	I2FTS6	Chromo domain-containing protein	0.974	355-375	RRAKKRLNKRSLRVKRGRCRR
UP000006174	Ustilago hordei	I2FTV1	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.926	732-747	RGGGGRAARRGKKGGR
UP000006174	Ustilago hordei	I2FTV1	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.851	130-139	SSKPKKARKK
UP000006174	Ustilago hordei	I2FUD4	Uncharacterized protein	0.995	441-459	AKRRVRKKRKIGSKKVRTK
UP000006174	Ustilago hordei	I2FUD4	Uncharacterized protein	0.847	263-281	RAKPKEHEKKAAAVKKEAP
UP000006174	Ustilago hordei	I2FV81	DNA mismatch repair protein	0.819	1147-1159	KHYKLKRGRERRA
UP000006174	Ustilago hordei	I2FWN6	G_PROTEIN_RECEP_F1_2 domain-containing protein	0.888	792-801	QRMKRRRRKA
UP000006174	Ustilago hordei	I2FWN6	G_PROTEIN_RECEP_F1_2 domain-containing protein	0.816	814-827	VGKKAVGKLRKRWN
UP000006174	Ustilago hordei	I2FY32	Probable 40S ribosomal protein S9	0.751	169-176	AGRVKRKR
UP000006174	Ustilago hordei	I2FZQ2	BHLH domain-containing protein	0.954	100-117	SKKTAKRKREEEKLKKAK
UP000006174	Ustilago hordei	I2FZQ2	BHLH domain-containing protein	0.847	32-55	SRRKSRVLRRKTDHSIIERRRREK
UP000006174	Ustilago hordei	I2G2L4	Uncharacterized protein	0.998	100-116	GKRKRKRKRAQKKKPAK
UP000006174	Ustilago hordei	I2G2L4	Uncharacterized protein	0.989	14-32	TSKEGKGKRVRKRTRNKKR
UP000006174	Ustilago hordei	I2G537	Related to PPR1-transcription factor regulating pyrimidine pathway	0.661	30-34	AKRKS
UP000006174	Ustilago hordei	I2G6E5	Related to YND1-apyrase (NDPase/NTPase)	0.647	646-652	PRASRRR
UP000006174	Ustilago hordei	I2G711	Uncharacterized protein	0.851	110-131	KRKDTKAVPSAPSPKRSKRADA
UP000006174	Ustilago hordei	I2FM69	Zn(2)-C6 fungal-type domain-containing protein	0.973	719-740	GKRKRGRSRAARGGGFPTRRRR
UP000006174	Ustilago hordei	I2FM69	Zn(2)-C6 fungal-type domain-containing protein	0.851	75-85	KHKRGRKPNKR
UP000006174	Ustilago hordei	I2FNR3	Kynurenine 3-monooxygenase	0.973	897-908	KSAKKKNKKKKA
UP000006174	Ustilago hordei	I2FNR3	Kynurenine 3-monooxygenase	0.796	1410-1418	RRGGKKGKR
UP000006174	Ustilago hordei	I2FNX8	Uncharacterized protein	0.996	137-175	RANKVARPIYREADKRGRLIWKKRIDPARRRALKKARKR
UP000006174	Ustilago hordei	I2FPL7	Uncharacterized protein	0.789	246-259	RRRNRRLRDANRPK
UP000006174	Ustilago hordei	I2FQS6	Zn(2)-C6 fungal-type domain-containing protein	0.951	120-149	SKKSHKAGASRKSQDGPDESARPKPPKRKK
UP000006174	Ustilago hordei	I2FQS6	Zn(2)-C6 fungal-type domain-containing protein	0.719	1020-1028	KSRIRSKKR
UP000006174	Ustilago hordei	I2FRB5	Sister chromatid cohesion protein	0.982	370-381	TKRKKKSKRKSK
UP000006174	Ustilago hordei	I2FRB5	Sister chromatid cohesion protein	0.886	262-278	PKDAAPADKPKRKRTNK
UP000006174	Ustilago hordei	I2FRB5	Sister chromatid cohesion protein	0.885	89-102	KSKPKSVKRRWKPK
UP000006174	Ustilago hordei	I2FRB5	Sister chromatid cohesion protein	0.876	589-603	TKPKKARKLDRQGKS
UP000006174	Ustilago hordei	I2FRB5	Sister chromatid cohesion protein	0.863	312-323	RPPKPNKPKKPK
UP000006174	Ustilago hordei	I2FRI2	Related to aimless RasGEF (AleA)	0.913	234-255	KARRRRRLLQEQLRKRNIKRRS
UP000006174	Ustilago hordei	I2FRL1	DNA topoisomerase I	0.951	864-894	GGSKLKVKKEEQEDVKPAKKGAKKTKATEKS
UP000006174	Ustilago hordei	I2FRL1	DNA topoisomerase I	0.725	744-750	KKKSKKI
UP000006174	Ustilago hordei	I2FRL1	DNA topoisomerase I	0.626	339-344	KAGKVK
UP000006174	Ustilago hordei	I2FRT2	PINc domain-containing protein	0.658	153-159	RRSRHRP
UP000006174	Ustilago hordei	I2FSF9	Uncharacterized protein	0.897	71-101	PHRSPPKLKLRSSGALHQAKARYKRPKNSRK
UP000006174	Ustilago hordei	I2FSF9	Uncharacterized protein	0.87	425-438	AKLKARPGKKGGAG
UP000006174	Ustilago hordei	I2FTS1	Uncharacterized protein	0.92	329-338	GGKKKGKKGK
UP000006174	Ustilago hordei	I2FTS1	Uncharacterized protein	0.892	42-56	GKKRKKGQHQKHANS
UP000006174	Ustilago hordei	I2FV37	Eukaryotic translation initiation factor 4C	0.943	3-17	KNKGKGGKNRRRGKN
UP000006174	Ustilago hordei	I2FVS2	Related to potassium transporter TRK-1	0.974	193-208	EKNKQKNRRKRKPIRA
UP000006174	Ustilago hordei	I2FVY1	DH domain-containing protein	0.63	815-825	RPGLPPKNPLR
UP000006174	Ustilago hordei	I2FWI3	Uncharacterized protein	0.944	1052-1077	KARIRKEGQPKSEVGGNRMKKHRKKV
UP000006174	Ustilago hordei	I2FWI3	Uncharacterized protein	0.866	1088-1100	KLHKLARQKRKER
UP000006174	Ustilago hordei	I2FWL2	HMG box domain-containing protein	0.995	893-914	RRRLGKKPGLKGKKRKNSTRKG
UP000006174	Ustilago hordei	I2FWL2	HMG box domain-containing protein	0.985	369-399	AKAAERRQNAAARLNKRRLKRKEQASGKPRR
UP000006174	Ustilago hordei	I2FWL2	HMG box domain-containing protein	0.936	496-507	RKKKRRVTRSRK
UP000006174	Ustilago hordei	I2FXA7	Related to LCP5-U3 small nucleolar ribonucleoprotein involved in maturation of 18S rRNA	0.702	325-330	DARKRR
UP000006174	Ustilago hordei	I2FXA7	Related to LCP5-U3 small nucleolar ribonucleoprotein involved in maturation of 18S rRNA	0.668	375-380	GKKAKK
UP000006174	Ustilago hordei	I2FZI3	Probable Pre-mRNA splicing factor cwc22	0.995	759-827	SRSRSRTRSDSRSVSPRRRPLSHSRSLSRSPSRSPSRSRSPYAYKGRGRRSRSRSEDAKPRRARRSPSR
UP000006174	Ustilago hordei	I2FZI3	Probable Pre-mRNA splicing factor cwc22	0.977	53-89	RSRSPPPRSRRRKSSRDRSPPFSSGEDKVSRRKAARA
UP000006174	Ustilago hordei	I2FZI3	Probable Pre-mRNA splicing factor cwc22	0.976	736-753	RSPSPRRRRRRSRTRSAS
UP000006174	Ustilago hordei	I2FZI3	Probable Pre-mRNA splicing factor cwc22	0.813	837-865	RSRSRSPSPVRRRQRSPSYSRSPSPQPRK
UP000006174	Ustilago hordei	I2G115	GTPase EF-hand protein of mitochondria 1	0.845	467-477	RPRKTDKKKKG
UP000006174	Ustilago hordei	I2G1K8	Ysc84 domain-containing protein	0.98	95-122	KEKGKESFIKKKRKVLRKIPPQVIKRAK
UP000006174	Ustilago hordei	I2G1K8	Ysc84 domain-containing protein	0.848	358-387	KKEKEEAKRREEEERAAVRALPPPPRHKKV
UP000006174	Ustilago hordei	I2G3A8	Type 1 phosphatases regulator	0.848	152-163	HHGKHRKPKGTK
UP000006174	Ustilago hordei	I2G3E0	Probable PRP8-U5 snRNP protein, pre-mRNA splicing factor	0.725	172-182	REKRDRRHFKR
UP000006174	Ustilago hordei	I2G4J4	Uncharacterized protein	0.735	894-905	RKVQMRKSKVKK
UP000006174	Ustilago hordei	I2G558	Related to coenzyme A diphosphatase	0.76	360-372	GGGGKGAIRKPKL
UP000006174	Ustilago hordei	I2G6W3	Related to serine/threonine-protein kinase	0.804	893-913	KPRPWAPKRPKTLEEYRARKR
UP000006174	Ustilago hordei	I2FNW7	Uncharacterized protein	0.842	402-420	KARKTQEKAEAKERKRAAK
UP000006174	Ustilago hordei	I2FPK4	Uncharacterized protein	0.805	270-287	KPAPKPRKNASSNPRRST
UP000006174	Ustilago hordei	I2FPK4	Uncharacterized protein	0.644	7-10	KRRR
UP000006174	Ustilago hordei	I2FPR8	PH domain-containing protein	0.836	1307-1320	RQAKSHKARRIRKQ
UP000006174	Ustilago hordei	I2FPX4	Related to SEC65-signal recognition particle subunit	0.832	366-379	LGRRQRKKVVRIGR
UP000006174	Ustilago hordei	I2FPX4	Related to SEC65-signal recognition particle subunit	0.779	194-202	EPRKKRVRP
UP000006174	Ustilago hordei	I2FQN0	Probable PHO91-similarity to Pho87p and Pho90p	0.738	238-246	LRKKPTRRR
UP000006174	Ustilago hordei	I2FQX2	Threonyl-tRNA synthetase	0.731	65-72	EKKPKAKK
UP000006174	Ustilago hordei	I2FRA3	Zn(2)-C6 fungal-type domain-containing protein	0.657	185-188	RKRK
UP000006174	Ustilago hordei	I2FUI2	ZT_dimer domain-containing protein	0.804	191-202	RRRHSGKGRNKR
UP000006174	Ustilago hordei	I2FVX7	Uncharacterized protein	0.637	61-66	RPKEKR
UP000006174	Ustilago hordei	I2FW71	Uncharacterized protein	0.873	200-213	RREKGRMRGRKVRK
UP000006174	Ustilago hordei	I2FWW7	Peptidyl-prolyl cis-trans isomerase	0.985	475-557	PHKRRSNGRDRGDDDRSRRGHDDDRGSHKRHDQDDRRHRDSGSRRHETGRSDRSGYGDRRERERERDSRRKEDRHRHRDEARR
UP000006174	Ustilago hordei	I2FWZ6	Zn(2)-C6 fungal-type domain-containing protein	0.977	228-248	KLKKERAKPKPRSKSATKITR
UP000006174	Ustilago hordei	I2FX79	Related to THI21-Hydroxymethylpyrimidine phosphate kinase, involved in the last steps in thiamine biosynthesis	0.769	245-262	KERYPQRKEKRSTASKSR
UP000006174	Ustilago hordei	I2FX97	Related to MET10-sulfite reductase flavin-binding subunit	0.6	45-45	K
UP000006174	Ustilago hordei	I2FXV1	Probable pre-mRNA splicing factor prp1	0.933	108-130	RRRKFREARQREEREKARSEKPK
UP000006174	Ustilago hordei	I2FXV1	Probable pre-mRNA splicing factor prp1	0.83	162-172	KKRKAAAKREA
UP000006174	Ustilago hordei	I2G0B2	Clustered mitochondria protein homolog	0.979	1056-1076	SGKKNKGKKKGGKEQQNGTKK
UP000006174	Ustilago hordei	I2G0B2	Clustered mitochondria protein homolog	0.935	1437-1449	PAKAKGKSKAGRK
UP000006174	Ustilago hordei	I2G6H7	rRNA-processing protein EFG1	0.767	282-293	KGAKADKNKRKK
UP000006174	Ustilago hordei	I2G6M3	Related to mfs-multidrug-resistance transporter	0.611	254-255	KK
UP000006174	Ustilago hordei	I2FP93	Uncharacterized protein	0.695	667-680	KNRQKAESKMRMRR
UP000006174	Ustilago hordei	I2FRA6	Related to PSR1-plasma membrane phosphatase required for sodium stress response	0.999	47-60	ALPKKKKKKKKKKK
UP000006174	Ustilago hordei	I2FU50	CCHC-type domain-containing protein	0.983	200-215	KKRRIPKEKERRKRGS
UP000006174	Ustilago hordei	I2FU50	CCHC-type domain-containing protein	0.766	466-473	KSARKKRK
UP000006174	Ustilago hordei	I2FUW3	Uncharacterized protein	0.885	66-78	RPAKRRKKNTSTP
UP000006174	Ustilago hordei	I2FVA0	Probable ribosomal protein L41	1	3-25	AKWRKKRMRRLRRKRRKMRARSK
UP000006174	Ustilago hordei	I2FX53	Related to RRP14-protein involved in Ribosomal RNA Processing	0.996	459-550	KLLKKAAKRKDKQKEKSGIAWNERKQAEVKQQADRQKKRQDNIAARKAAKGGKGKKASSSTLSKSKTPSGKKPSFGKARPGFEGKKIGRSKK
UP000006174	Ustilago hordei	I2FX53	Related to RRP14-protein involved in Ribosomal RNA Processing	0.995	278-310	RRRQRIDAREKKKQKKMEGKAAAKAAAKAKKAG
UP000006174	Ustilago hordei	I2FX53	Related to RRP14-protein involved in Ribosomal RNA Processing	0.937	104-128	KNKRKKAKSEIEAQERKTKLREAKK
UP000006174	Ustilago hordei	I2FYF5	Chromatin modification-related protein	0.966	535-554	PRGTRKRKPRPLSPQKGGRR
UP000006174	Ustilago hordei	I2FYF5	Chromatin modification-related protein	0.785	648-663	AKHKPPGFKKGVGIKP
UP000006174	Ustilago hordei	I2FYF5	Chromatin modification-related protein	0.749	160-167	KRRRVRKA
UP000006174	Ustilago hordei	I2FYK2	Chromo domain-containing protein	0.98	171-212	SPRGKAKNGRGSTATKRSSPSKSTPKRGGANKRPRTSTSSRR
UP000006174	Ustilago hordei	I2FYK2	Chromo domain-containing protein	0.801	41-52	KKKLRSRPPKAK
UP000006174	Ustilago hordei	I2G073	Uncharacterized protein	0.941	1053-1064	KKKRKAAKAKSA
UP000006174	Ustilago hordei	I2G073	Uncharacterized protein	0.724	14-28	KRKMSLKPKGILKPA
UP000006174	Ustilago hordei	I2G0B9	EVE domain-containing protein	0.875	227-262	AQAKAKKEAPKTEADEHGDKDVKSKATKKKAPASSK
UP000006174	Ustilago hordei	I2G138	Ribosome biogenesis protein NSA1	0.983	569-583	GKRKGKPALPKKSRK
UP000006174	Ustilago hordei	I2G138	Ribosome biogenesis protein NSA1	0.81	240-251	KQRKRKRQLEAK
UP000006174	Ustilago hordei	I2G138	Ribosome biogenesis protein NSA1	0.639	515-518	RGKK
UP000006174	Ustilago hordei	I2G1G5	Uracil-DNA glycosylase	0.909	314-321	KKKKKEKK
UP000006174	Ustilago hordei	I2G6U0	Related to veA protein	0.967	274-292	KVRVRKHPRSRRRSSKRTK
UP000006174	Ustilago hordei	I2FNH7	40S ribosomal protein S25	0.969	5-28	KAAIAAAASKTAKKKKWSKGKVKD
UP000006174	Ustilago hordei	I2FPB8	Uncharacterized protein	0.607	408-408	R
UP000006174	Ustilago hordei	I2FPF0	Protein SDA1	0.987	631-665	RKHKRTVKERLIAAREQRQKKRAKLQRKAERQARR
UP000006174	Ustilago hordei	I2FPF0	Protein SDA1	0.985	310-338	ARKVKKKTRSGDRKMREAAALSKKKRKVK
UP000006174	Ustilago hordei	I2FPF0	Protein SDA1	0.982	813-884	EKGREDREKYGSKKGKKNKEKESSSTNREKQKTKNFQMIARSWSVRSKKNASLRDKSRRLRKHVETSKKRFK
UP000006174	Ustilago hordei	I2FPY4	Uncharacterized protein	0.979	796-808	KEKPSRKGKGRRK
UP000006174	Ustilago hordei	I2FPY4	Uncharacterized protein	0.625	711-715	GKEKS
UP000006174	Ustilago hordei	I2FPY4	Uncharacterized protein	0.601	717-717	R
UP000006174	Ustilago hordei	I2FTW4	Related to RSC2-member of RSC complex	0.847	29-40	KRGRGRPPKNRD
UP000006174	Ustilago hordei	I2FXV0	HSF_DOMAIN domain-containing protein	0.839	897-907	KPRSSKKPKKS
UP000006174	Ustilago hordei	I2FZF8	RNase III domain-containing protein	0.971	67-99	PQKLGKRARRALRAKQRQEDERPAKETRAKAKA
UP000006174	Ustilago hordei	I2FZF8	RNase III domain-containing protein	0.678	697-710	KRLSEKDRERNRAK
UP000006174	Ustilago hordei	I2G0C6	Related to subtilisin-like serine protease	0.694	909-918	PKPKPGPGGP
UP000006174	Ustilago hordei	I2G0C6	Related to subtilisin-like serine protease	0.639	179-182	KRRR
UP000006174	Ustilago hordei	I2G106	RING-type domain-containing protein	0.938	630-648	RQRRNRRRDKERREDRAKI
UP000006174	Ustilago hordei	I2G106	RING-type domain-containing protein	0.907	895-916	AKPKRVKKKLILTGGGGGRGSR
UP000006174	Ustilago hordei	I2G106	RING-type domain-containing protein	0.612	80-81	RR
UP000006174	Ustilago hordei	I2G3G5	Uncharacterized protein	0.957	234-251	RKAKRDRKKEEKKQHTAA
UP000006174	Ustilago hordei	I2G3G5	Uncharacterized protein	0.62	255-257	EKK
UP000006174	Ustilago hordei	I2G5L0	DNA mismatch repair protein	0.911	199-211	KGRKRNAAKRARK
UP000006174	Ustilago hordei	I2G6I6	Uncharacterized protein	0.766	26-63	RERKEREAAAKLAAREAQEREQKERERKILVQRMARQK
UP000006174	Ustilago hordei	I2G6I6	Uncharacterized protein	0.693	342-356	KMNKPSERPRVSAKR
UP000006174	Ustilago hordei	I2G6I6	Uncharacterized protein	0.654	431-439	AKRPAADPK
UP000006174	Ustilago hordei	I2G6I6	Uncharacterized protein	0.644	453-460	PPKRETAR
UP000006174	Ustilago hordei	I2G6I6	Uncharacterized protein	0.637	470-472	KKK
UP000006174	Ustilago hordei	I2G6I6	Uncharacterized protein	0.601	590-590	K
UP000006174	Ustilago hordei	I2FM77	Uncharacterized protein	0.989	876-890	KRKKKKRKLDPRVGR
UP000006174	Ustilago hordei	I2FU13	Uncharacterized protein	0.692	34-39	KHRRRK
UP000006174	Ustilago hordei	I2G4C7	Related to WD repeat protein PWP1	0.823	286-293	KKKRKQSK
UP000006174	Ustilago hordei	I2G4U8	Uncharacterized protein	0.623	78-82	RPPRA