ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB3	Uncharacterized protein	0.994	291-316	PRDGKKGKANGKGKGKASASSKRKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB3	Uncharacterized protein	0.991	333-355	PKKGKGKKAMRQANGKAKRKRAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB3	Uncharacterized protein	0.984	376-387	KAKRKRKKKQRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB3	Uncharacterized protein	0.974	399-411	PRRKKRGKSKVKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB3	Uncharacterized protein	0.621	148-151	KRVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVA9	SAC domain-containing protein	0.995	1355-1409	GRSKRKGKGAAGKAKKATKRQSTAGPGGTPAKKARTSTGSNASPALPAPPRKARR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVM9	Putative Lactoylglutathione lyase Glo1	0.988	326-349	KRRAELERREKEKWKRQRERRKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVS9	Proteophosphoglycan 5	0.998	328-340	SKKKRRKKKKKSG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVS9	Proteophosphoglycan 5	0.932	242-282	KNQRKKLREREKQAQRKRQLEEESRKEAEGEAAGERPPKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW51	Aspartic protease	0.923	3-23	KRERGGAEGDRRTRARRRPGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW51	Aspartic protease	0.891	478-491	RRRSRRDERRKASR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWH0	Proteophosphoglycan 5	0.843	624-643	KKRRESSAHPAGDGREKRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN1	Proteophosphoglycan ppg4	0.999	646-675	PAKKRKAPATKKKAAPKKTPAAKKGKGKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN1	Proteophosphoglycan ppg4	0.999	707-724	KRKPKKRKKAARKPKKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN1	Proteophosphoglycan ppg4	0.994	593-620	KGKGKKGRVPAKAKAALAKGKAKGKKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN1	Proteophosphoglycan ppg4	0.994	805-826	AKDHKKDRMKAKREKMKKRAKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN1	Proteophosphoglycan ppg4	0.99	1109-1142	SGGRKRKGKKKEEAEDEEQLGGKKKRGKKGKNGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN1	Proteophosphoglycan ppg4	0.818	758-767	PKKKSAKKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN1	Proteophosphoglycan ppg4	0.681	352-359	PKRKNPPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWX6	TBP-associated factor 4	0.965	240-257	LGKDGKPKKTRAKKVKGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWZ5	ATP-dependent DNA helicase	0.858	774-786	DGRAPKKSRSKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX35	Proteophosphoglycan ppg4	0.645	928-931	GRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX35	Proteophosphoglycan ppg4	0.641	940-949	RSKTPVPKHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXY2	Adenylate kinase	0.644	200-202	KKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYD1	Proteophosphoglycan 5	0.906	502-557	KEEALAPKPPRPRTPTPPPPKPPIVSPPPPPELGAPEAAPKPTLKRGKLGAAKIAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYL8	Proteophosphoglycan ppg4	0.963	523-556	RREERHERERREREEAEREKERLRRVREQRRRSE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYL8	Proteophosphoglycan ppg4	0.83	14-30	KVAGFFRRIKSRKSLRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP7	Proline rich protein	0.986	41-67	TRRPKRSRTKGRRRATDDRARRDEGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYY6	Leucine Rich Repeat domain-containing protein	0.997	841-855	SVRKKKGKGKKKGGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYY6	Leucine Rich Repeat domain-containing protein	0.961	606-619	SKSPVKPKRRKPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYY6	Leucine Rich Repeat domain-containing protein	0.653	542-547	LGRRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0T3	Uncharacterized protein	0.772	235-246	GKRRARSNSRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0W8	Nucleolar complex-associated protein 3	0.997	681-715	VVRWNKEKNHKGRKGGKAKEAMAKKGSKKARQARK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0W8	Nucleolar complex-associated protein 3	0.991	3-61	GKKRPASAKPAAPSKRQKGGASSSSKKGGKGASTAGTGTPKKERSAKSAAKKDRKGKGP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0W8	Nucleolar complex-associated protein 3	0.952	165-184	KSELKAAKKRDIERKKRIKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0W8	Nucleolar complex-associated protein 3	0.665	331-336	KKAKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T128	RED_N domain-containing protein	0.995	222-258	MGKGKEIAGAASGWKAVGAAGDGEKKKRKKKKVAPAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T128	RED_N domain-containing protein	0.758	423-431	KRKAQKKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T128	RED_N domain-containing protein	0.73	462-471	KKEGKKGGKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T128	RED_N domain-containing protein	0.694	53-62	PRKTAFKPKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUZ0	Proteophosphoglycan ppg4	0.828	276-285	KVKKKMRKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV45	rRNA-processing protein EFG1	0.969	252-293	PKKLNRKQRKELKRAKEAGTAEPAQAASPARPAEKKAAKGGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV80	Uncharacterized protein	0.752	256-268	GKGASGRRRDGKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ0	Kinesin motor domain-containing protein	0.867	764-790	RARRSPKKGVSFPSGAKRVASPGAKKN
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ0	Kinesin motor domain-containing protein	0.751	1033-1043	ARRSPRKPSLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXD7	Putative Zinc knuckle containing protein	0.8	135-144	ERRNERKRKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXR0	Proteophosphoglycan 5	0.892	211-233	SKKKRPPSSPPVPPPHRHTRRSP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYB6	EXS family protein/ERD1/XPR1/SYG1 family protein	0.957	956-972	KKRTHQRRMAARKRKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM6	Proteophosphoglycan 5	0.812	128-138	RARRVLKRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYN0	COP9 signalosome complex subunit 4	0.953	464-477	RKHKRKHSHRKSRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZI3	Pathogenesis-related protein 1-like protein	0.695	107-114	GRSKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZI3	Pathogenesis-related protein 1-like protein	0.64	532-538	RRSERRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZS0	Transcription factor iws1	0.999	76-112	RLKKMGKISKKKRSAEDEGDEPRPRKKRPSKKAKRRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZS0	Transcription factor iws1	0.934	131-154	RRKQLASRLDAIVKKPTGKGKKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T037	DNA_MISMATCH_REPAIR_2 domain-containing protein	0.963	88-107	KLKAKKPRKATTPLKKEAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T037	DNA_MISMATCH_REPAIR_2 domain-containing protein	0.724	606-612	KRKKALK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T037	DNA_MISMATCH_REPAIR_2 domain-containing protein	0.647	127-131	KKGRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T068	Proteophosphoglycan ppg4	0.966	79-114	THKSSHKKTFKERTKPKPAWAAKSTKAIQKKPTPKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0C1	Putative nuclear protein SNF4	0.832	41-50	PKRRRPRPYR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0I9	Vacuolar protein sorting-associated protein 35	0.848	320-343	RRQEEEAKRKLADEVRKQREKRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0N4	OTU domain-containing protein	0.997	329-373	KVRSRSSAGKEKLRPPPRTRRGPSAKEKKELARQRRMERRRAKGI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0N4	OTU domain-containing protein	0.689	10-28	RSKGKGVQKTYGKGRDRTR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y0	Uncharacterized protein	0.993	380-402	PPKPKKPKKRSNAERKALAKARA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y0	Uncharacterized protein	0.989	493-511	VRRAGEGGKKKKSKKGDKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y0	Uncharacterized protein	0.988	19-71	RPANPNKRPPRQDGPSPQPHSDRPAGGRDERRGPRGPGKPGQKGTDKAAAKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y0	Uncharacterized protein	0.676	438-442	KKGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1B3	Proteophosphoglycan 5	0.915	232-247	KLKRMLRRTHRRRRGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L2	Proteophosphoglycan ppg4	0.972	663-672	GKKKKKRKNK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L2	Proteophosphoglycan ppg4	0.926	560-577	SRARKTRAGRSKLSKRKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T228	Proteophosphoglycan ppg4	0.809	710-719	RKGARRKARR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T228	Proteophosphoglycan ppg4	0.76	533-541	PRKGRERRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T228	Proteophosphoglycan ppg4	0.747	741-749	PRKGRERRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ4	Proteophosphoglycan ppg4	0.998	191-224	NRTKTKHGKGRFGRKKEAKEGREKHKSSSRKKKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ8	Proteophosphoglycan ppg4	0.761	784-808	KAKKKGVTGVLGKGKAGGAGSSKLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ8	Proteophosphoglycan ppg4	0.651	564-569	KKGKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUT3	Uncharacterized protein	0.986	390-432	KERERRHRRRMKSRSTSAEPQRPASEKKRSRRYGTGSRGRRSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ4	Putative Sulfite oxidase	0.993	979-991	PPRKKRRRRRKGP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ4	Putative Sulfite oxidase	0.933	177-224	RASRIHRNIKPARRLSTSASRPSALARHSRDGNKLRGRHKEEGRRMMR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ4	Putative Sulfite oxidase	0.754	1565-1589	RRLDKGKAKADGAGAGEEAAARKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVK3	Proteophosphoglycan	0.968	249-277	KKVRAAAQKKATQDQDAGRPKKAPKRKRI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVK3	Proteophosphoglycan	0.92	333-366	HRRRGATKKRVAASRTAGKAVDEVRVRKRATKGS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVK3	Proteophosphoglycan	0.725	301-307	LPKRRKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVK3	Proteophosphoglycan	0.668	375-380	RRKEKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVK7	Proteophosphoglycan ppg4	0.662	68-74	RKPRRTE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVK7	Proteophosphoglycan ppg4	0.61	77-78	KR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVV3	WD_REPEATS_REGION domain-containing protein	0.725	481-491	RDKKVKIRRAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW60	Uncharacterized protein	0.897	22-40	KMKRNPRKLKWTKAFRKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW60	Uncharacterized protein	0.815	141-155	AEKKRERQMRNQKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW60	Uncharacterized protein	0.723	171-182	KIKQKVKVKKQS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWD1	Proteophosphoglycan ppg4	0.847	134-162	RRKALAEKGTNRADEPFSGRAKGKGKARA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWD1	Proteophosphoglycan ppg4	0.737	251-257	RRKRRRT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWW0	Proteophosphoglycan ppg4	0.819	575-582	PKKKKKTV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWW0	Proteophosphoglycan ppg4	0.766	379-389	AKEKERDRKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX15	G domain-containing protein	0.999	473-528	KDEKAGKKRQSEIKFKAHEALRQQKKARVQGMPSSFGKARRPPPPKAGAKRRKSRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXS7	Proteophosphoglycan ppg4	0.998	1563-1599	KGKGEKEKGKEKKREREKERNANERKAGTLKSKGKER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXS7	Proteophosphoglycan ppg4	0.996	2431-2480	AARAAKKERAERKKVRDRLRNKDKGKDVALQSKGKERAHDASPPPKKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXS7	Proteophosphoglycan ppg4	0.961	1379-1403	AKVRGKKKATALKPAPTARKPKGQG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ81	RING-type domain-containing protein	0.974	83-99	SGRHKRRRGGRGRGGGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ96	Mitochondrial DNA polymerase catalytic subunit	0.74	443-448	TKRKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ96	Mitochondrial DNA polymerase catalytic subunit	0.633	387-391	RKEKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZB3	Proteophosphoglycan ppg4	0.964	396-409	RPNGKKRKRGRGRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T001	Cell wall surface anchor family protein	0.991	658-674	APSPLKMKKRRKRKGAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T001	Cell wall surface anchor family protein	0.969	316-335	PKKPKKLKKPRESSPLSMSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T001	Cell wall surface anchor family protein	0.897	369-380	KKKKGGKRSVGM
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T001	Cell wall surface anchor family protein	0.848	151-159	APPKKKRKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T024	Proteophosphoglycan ppg4	0.63	210-214	KRRNG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T025	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.984	101-120	PAPAPKPKEVKEKAKKKKGM
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T025	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.966	697-717	EREGKREREKERKRAERGSSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T025	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.807	137-145	RPRKKVKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T056	Bromodomain-containing protein	0.858	906-935	RPKKPSGARTSSGGMGGMGGGGQRKPKRPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0C5	Uncharacterized protein	0.842	531-557	NIRSLRSRLIKAEEERRKRAAVMERSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0C5	Uncharacterized protein	0.781	1039-1049	RERREGRKGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T183	Cation-transporting ATPase	0.988	1465-1492	RRWRRMRGRRKESGKAYKAISRLRRRSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D4	RNA methyltransferase	0.964	494-546	SKKGKGHKSTSTKKKTHHSSTPSKKGHLSGHKSTPAKKGHSSGHKSSGSKKGH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1E3	Uncharacterized protein	0.951	130-145	AKGKGKAKATRKRRVR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1E3	Uncharacterized protein	0.792	424-434	HRRKHRPRQHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1E3	Uncharacterized protein	0.754	388-400	RKKADRAEKVKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1E3	Uncharacterized protein	0.68	539-546	RKLAKRMR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUN9	Uncharacterized protein	0.919	490-510	GKLTKKKKNLKERFKASVLRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUN9	Uncharacterized protein	0.896	547-561	GETKARKERKKEDKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUN9	Uncharacterized protein	0.791	158-167	KEKKKIRKER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUZ6	Cys/Met metabolism pyridoxal-phosphate-dependent enzyme	0.998	152-206	HVKGKGRASEPAPKLDEHGQPVKRRPGRPKGSKNKPKPPPTDGTPAPAPRKRRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUZ6	Cys/Met metabolism pyridoxal-phosphate-dependent enzyme	0.871	228-246	GAKGKAKKKVVVQGNKGKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL9	S5A_REDUCTASE domain-containing protein	0.916	215-230	KREKQAKEKKGKGKES
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVS4	Putative Ribosomal protein L35	0.909	190-213	GKRLPLDMRAKKTRAIRRRLTRHE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWM6	Proteophosphoglycan 5	0.841	116-124	RRNKKKERR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWV2	Proteophosphoglycan ppg4	0.868	304-317	KRREEARRREKRER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX16	USP domain-containing protein	0.681	400-405	KDRRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX39	G-patch domain-containing protein	0.965	197-211	KLAQMEKKKGKKKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX39	G-patch domain-containing protein	0.909	585-594	SKKAKKKKEP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXA6	Proteophosphoglycan ppg4	0.855	465-480	ARNRRRRAEEGRPKVG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXE8	Uncharacterized protein	0.979	294-334	KPNKTKRGNARKRAAGREEYVRKMEKSARAKAAGGRAQAKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXH2	RNA helicase	0.728	91-98	EEARRKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXH2	RNA helicase	0.689	72-76	EKRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXH2	RNA helicase	0.6	88-88	R
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYW9	Proteophosphoglycan 5	0.649	276-281	KVKKLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD9	GTPase-activating protein gyp10	0.857	582-592	PRKGGKTRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZE9	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.967	773-795	GKRKKRSRTPASSSAAKVKRKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZL4	RING finger domain-containing protein	0.961	209-231	PKPKKKKGEVRSARLAPLRRGGP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZS9	Uncharacterized protein	0.723	162-173	RGRKTERDRKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW4	RhoA GTPase effector DIA/Diaphanous	0.996	69-88	GGGGGRGRRRKKLPRKKFNK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW4	RhoA GTPase effector DIA/Diaphanous	0.916	4-17	RRRYPRKEKKEKPV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW4	RhoA GTPase effector DIA/Diaphanous	0.679	1911-1925	PPPPPPPPPPPPPPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZX1	Serine/arginine repetitive matrix protein 2	0.991	226-280	AKKRRQAQAGGAVDKPTGNKQGGKKASGSQANKGKKKSVQKSPEREPRDKGKGKQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ3	SWR1-complex protein 5	0.9	254-270	SKPAPPAGGAPKRKKAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ3	SWR1-complex protein 5	0.75	54-61	KRGRKRTK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T012	Signal transducer	0.993	752-781	RTRKHAEAKRKARKEKEKDPSAPRASRSRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T012	Signal transducer	0.895	139-170	APGKGNKTKTSEKRRAQNRQAQRNFRERKEKH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0A2	Asparagine synthase	0.712	400-412	RKLKAKEGLKGKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0A2	Asparagine synthase	0.627	1133-1136	PPKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T193	ERCC4 domain-containing protein	0.922	628-647	KRKDFKRGQAPPTKRRRVRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1B6	ATP-dependent RNA helicase DHX8	0.718	82-95	KSKSSSSKDKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1B6	ATP-dependent RNA helicase DHX8	0.605	197-197	R
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1B6	ATP-dependent RNA helicase DHX8	0.604	199-199	R
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1J0	Uncharacterized protein	0.887	271-324	RRKAEEAERKAKEMREAEAKKAEEERKQAEEQRQEEERKKDEQRKKDEEAKAQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1R0	Proteophosphoglycan ppg4	0.996	24-91	RPAQPKRERKKTVLIDPIVPRRASLESKGAQKGVKRRRSSGASDGDKVDVKRVAKEKRDKGKKRARKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1R0	Proteophosphoglycan ppg4	0.992	265-285	RKEDLERKARRAKGKGRKRIK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1R0	Proteophosphoglycan ppg4	0.94	342-354	GSGGRKVKKRRKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T215	Putative Ras-related protein RSR1	0.602	179-179	R
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUI5	Adenine DNA glycosylase	0.968	573-597	ASKNGAKGKGRAKTGEGGKKGKVEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUI5	Adenine DNA glycosylase	0.698	67-71	KKRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT5	Serine C-palmitoyltransferase	0.72	294-301	DKKYKRKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVU3	CMGC/GSK protein kinase	0.913	253-285	RFKRIREGREKAEEWRNERDERRLSKAGRRRAL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW70	Uncharacterized protein	0.898	876-905	KKIESELARKRPPSKRSGTSGGTSHRAPKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW97	Proteophosphoglycan ppg4	0.744	231-236	RRRRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWE8	Proteophosphoglycan ppg4	0.993	492-516	PRAKNRKRPAPVAGSPKRKKQKRQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWE8	Proteophosphoglycan ppg4	0.807	632-638	TRRKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWE8	Proteophosphoglycan ppg4	0.713	72-81	KRRRSIRERT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ5	WD_REPEATS_REGION domain-containing protein	0.961	92-158	KDKGKGKAKEVDGAAPAASGSVAPKKKKAAAMEEGANGGEAAAKKARAAPAAEGAAAGKKGKGKAVE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ5	WD_REPEATS_REGION domain-containing protein	0.921	184-223	EAEKPKKDKGKEREDASPAVSAGAKREREKDDLRPPPAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX9	Putative Smooth muscle caldesmon	0.992	546-661	KERVRLEAEAKERARLQEEERIKREAEETARKERDAKVEAERVEKERLASERKERERQAKEETRKREEADKKARLDSELEAQEKARQEAKRKEDERKKKERLEEERRAKEAEAKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX9	Putative Smooth muscle caldesmon	0.969	677-758	MRKEEERKAELRKEEEREAKIAELAARQAERDRRALAAREEEAKKAERERQELARLAALARKKKEEEERRRQAADDEARKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX9	Putative Smooth muscle caldesmon	0.872	222-242	RRPSSPPRDPRKSPPKGANKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX9	Putative Smooth muscle caldesmon	0.816	1013-1025	KGKPGRSGKRVRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX9	Putative Smooth muscle caldesmon	0.731	508-530	EKKRREDEAERVRAEAAEKERAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX9	Putative Smooth muscle caldesmon	0.683	771-776	KEKKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX9	Putative Smooth muscle caldesmon	0.67	1155-1160	KKSKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY22	Proteophosphoglycan ppg4	0.978	920-932	KRGRQRKPRKRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY22	Proteophosphoglycan ppg4	0.965	1099-1111	KAKDKKKGKKRTA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY22	Proteophosphoglycan ppg4	0.887	981-990	SKRGRKARKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY22	Proteophosphoglycan ppg4	0.823	385-397	RPEVFRLRRGRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY57	Pol-like protein	0.862	1089-1102	REREKRKERKTHLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY57	Pol-like protein	0.669	337-350	KRRRNEVKELMRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY58	Pol-like protein	0.83	288-330	AKKAANRAFRLRSRMGREGEVNFAERERRRCRNKLKSMLRRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP4	Putative Serine/threonine protein kinase FSK	0.998	338-385	GLGSRKEDKERKEREKAERKEREKREKEEEKERKVERERARSASRTPS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYR1	Uncharacterized protein	0.937	308-328	GKNKRRRVEKGEAEKRGERGE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA8	Proteophosphoglycan ppg4	0.957	208-236	RAKSPSKARAGQKRRASTSAGQPPRKKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA8	Proteophosphoglycan ppg4	0.943	1016-1031	KRKRLDAAPKPKKKEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZK2	Uncharacterized protein	0.649	12-15	KKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZL1	Microfibrillar-associated protein 1	0.626	159-162	HRRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZL1	Microfibrillar-associated protein 1	0.626	539-541	KKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0H6	Proteophosphoglycan ppg4	0.807	646-660	KKKREKENERVKAGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0P3	Putative Kinesin K39	0.991	154-193	RKKRAKKPHPVKRSKSDRTSTSSSTRRNRDKPSKSSSSRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D2	tRNA_int_end_N2 domain-containing protein	0.844	465-480	PRRGPKKPSPYPRLKT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1J5	Uncharacterized protein	0.998	322-360	KARKEDKKEKELREKLERKAERDRIRKEREERRKRKRRH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1J5	Uncharacterized protein	0.834	128-145	WRRERRGEREDGRDRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1J5	Uncharacterized protein	0.798	247-258	HSHRSKRHRRSP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1V1	Proteophosphoglycan 5	0.741	117-125	RKQRRKLAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2B3	RNA cytidine acetyltransferase	0.996	1074-1103	KALKRKGPEQEEGKSGAGGKAKKDKKRRKQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2B3	RNA cytidine acetyltransferase	0.895	89-105	RRQRESKVKREVKKGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ9	Proteophosphoglycan ppg4	0.775	917-924	RKKRKTKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVG9	Proteophosphoglycan ppg4	0.939	52-95	KARKRMLKAQKEAGGGGGGSGGALGSRRRWNRKIDLGRSTRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI1	Putative Rab escort protein	0.748	153-163	RLSRPAKRSKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVM6	CBF domain-containing protein	0.991	472-494	KPAKGKKRSRGGDVKGKKGGKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVM6	CBF domain-containing protein	0.967	19-47	KSAASPKRKNGDKKDKRGGGSTEGKGKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVM6	CBF domain-containing protein	0.626	832-835	RKSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.995	1529-1591	AKPKAPRKRKVELDENGQPKAKRKRRTKAEMEIFRAEEAERKRKREEERLAKKAEKAAKGGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.993	206-249	KRVKKEQEKEERLKKQREAARRKREEDRLKREHENEQRKARAEE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.981	501-536	KGNEKREREARKKAEKEALEKARKEEEVREAKRQAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.869	1449-1476	RRKRLEETKRDAGQRGAAKREDNRRQKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.79	38-46	PPKRKRPSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.756	304-310	GARKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.687	351-357	GRKGKGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF4	Chromatin-remodeling ATPase INO80	0.625	420-422	KKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWG6	Origin recognition complex subunit 4	0.984	160-187	RAKRGRAASTKTAAKKPTRAPPKKRVKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWG6	Origin recognition complex subunit 4	0.78	61-86	RRSPSPRPRAPTRRMSTPSTPSKSKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWG6	Origin recognition complex subunit 4	0.641	199-203	KKTRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX03	Hob3p	0.811	947-965	RAKKAAAAKASGGSKKETK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX03	Hob3p	0.706	420-427	KKPTPRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX03	Hob3p	0.69	632-641	LRSRRERHAT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX98	Proteophosphoglycan ppg4	0.817	410-419	RRNPKKRRTP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX98	Proteophosphoglycan ppg4	0.708	107-117	EKEGKGGKAAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX98	Proteophosphoglycan ppg4	0.668	480-491	KRRKSEANLRKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX98	Proteophosphoglycan ppg4	0.636	986-989	KKPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG7	Proteophosphoglycan ppg4	0.983	929-975	SARRRPSKRPPPVRNNRPSAPFAPKPRSGGKTPPSPTPSPPVEKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG7	Proteophosphoglycan ppg4	0.874	145-167	RPAWKKHSRTAGGAKKYGSKRGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG7	Proteophosphoglycan ppg4	0.84	775-791	PKRLGKRTPRRTSPKHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG7	Proteophosphoglycan ppg4	0.794	104-112	RSKKRRRQS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXS3	Proteophosphoglycan 5	0.88	500-526	ASPIPKKRKHDQRDGSSKFKAQKQDKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX8	Cell wall surface anchor family protein	0.694	480-484	RKKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY38	Zn(2)-C6 fungal-type domain-containing protein	0.778	49-59	AKKRGPAPRPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYB0	Cohesin complex subunit psm1	0.908	1646-1687	PRTRSPQSERRSKDSFERGVKPIVFPSRPVGSARRRRRSPPY
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYB0	Cohesin complex subunit psm1	0.878	1811-1828	MRRERRRHRDDVAARKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYB0	Cohesin complex subunit psm1	0.863	1575-1598	ARSGKSAKKRVVATLAAKAHRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ02	Sperm nuclear basic protein PL-I isoform PLIa	0.693	36-43	RRPPPKRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ33	Serine/arginine repetitive matrix 1	0.922	213-228	AKRKGKEKEREREREK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW6	Proteophosphoglycan ppg4	0.943	97-111	EKQKSRRRVKKKVAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T011	Proteophosphoglycan ppg4	0.988	102-123	PTKPKAAPKTRAPPKKRKIAKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T011	Proteophosphoglycan ppg4	0.935	48-87	PPPAKRVPRKSTGKGKAASGSPETSPAPPGPARRASTRRQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T011	Proteophosphoglycan ppg4	0.675	391-400	KEEPKAKSRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T083	Polynucleotide adenylyltransferase	0.998	533-584	GLSKKGMKKMQQEARDREKRERTIARLERKMEEKEKKSLRRKEKKAARKAEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T083	Polynucleotide adenylyltransferase	0.935	740-761	AKRVKKAASDNGQAKKKKKSSQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T083	Polynucleotide adenylyltransferase	0.875	113-124	VPGSRRRGGKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0R4	Uncharacterized protein	0.99	127-156	RHHSSSKDHHRSTTKRGGSRSRRKGKKLKW
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T125	MIF4G/MA4 domain-containing protein	0.964	37-68	KGSGRLGRKDRRKAERSQAKQNKAQHQQGKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T125	MIF4G/MA4 domain-containing protein	0.83	125-146	ALEKLVAKQERGKGPDPARKKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T125	MIF4G/MA4 domain-containing protein	0.717	99-106	KPAKKKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T125	MIF4G/MA4 domain-containing protein	0.628	120-123	QKKL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T185	Pre-mRNA splicing factor	0.941	121-140	AKREKRDKGERSRDKVRKRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T185	Pre-mRNA splicing factor	0.828	69-91	RKTSKRAEQNAADARRKAEKEKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T185	Pre-mRNA splicing factor	0.744	161-178	KRRREEDRNAREAARRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T3	Nucleolar protein 9	0.967	3-42	RPRQRKSANSRKEEKKLKKEQEEREAAAQLAREKRERERK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T3	Nucleolar protein 9	0.937	768-787	GKKAKAGGDAERKAKKAKTE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T3	Nucleolar protein 9	0.894	295-309	KDGGGKGKGKGKGRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T3	Nucleolar protein 9	0.742	702-713	RWGRKREEWKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T3	Nucleolar protein 9	0.632	749-752	KKRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ3	Helicase SWR1	0.823	532-559	REVRKKWKMAVNVVRARRKAEQQKEAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ3	Helicase SWR1	0.74	580-589	KANGRRARRT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ3	Helicase SWR1	0.691	274-285	RAGGKKAVGPRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUQ3	Helicase SWR1	0.604	958-959	KK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUY2	Alpha-1,3-glucan synthase	0.924	88-106	EKDGRRERRAGRGGRAGER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUY2	Alpha-1,3-glucan synthase	0.685	844-849	RRGRKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV58	Proteophosphoglycan ppg4	0.983	879-911	PPPSSKGKGKGKAKTAKVVPDGPAPRRGRPPKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV58	Proteophosphoglycan ppg4	0.826	1749-1785	KRERDAATKARNLKEAAAAKEAAEKKAKQAQEAALKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVQ6	Uncharacterized protein	0.807	69-76	RRKNRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW31	Putative Peptidyl-prolyl cis-trans isomerase	0.992	177-222	AAKPKTPPPASPSASSRSRSRSRSVSRSPSPDRKRSRSSRRRSRRH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW31	Putative Peptidyl-prolyl cis-trans isomerase	0.991	234-265	RRHRHRSSSHKHRSSRRHKHRSSRRSTSPARK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW31	Putative Peptidyl-prolyl cis-trans isomerase	0.685	291-307	RRRREEEEREAELRRRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW31	Putative Peptidyl-prolyl cis-trans isomerase	0.673	328-335	KGRGRMKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW94	Proteophosphoglycan ppg4	0.965	646-681	KLRKKEEKISSGTGNSSKKEKKDGERREEKSKSARR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW94	Proteophosphoglycan ppg4	0.781	393-406	RPASREEPRRRPPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW94	Proteophosphoglycan ppg4	0.751	446-469	RKRESRKEKESYRVPEEKRSSAHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW94	Proteophosphoglycan ppg4	0.728	282-316	RPGSRDPSRSRNASPAMRPLSQNRKRIPSPSPVRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW98	NADP-dependent alcohol dehydrogenase	0.994	32-96	ARKEREQERKAQAKLRKEREQERKHKAAERQKEQREKARVQAQRQKDKASAERNKLRSSLKPPKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW98	NADP-dependent alcohol dehydrogenase	0.639	208-212	RRRAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWE7	Lipoyl synthase, mitochondrial	0.798	72-78	RRKRRRL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWE7	Lipoyl synthase, mitochondrial	0.668	1008-1013	KRRREG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWG7	Proteophosphoglycan ppg4	0.672	347-353	PRKLRRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL2	RNA polymerase II subunit A C-terminal domain phosphatase	0.82	209-220	RNKPKKYRKIRI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL2	RNA polymerase II subunit A C-terminal domain phosphatase	0.669	730-738	KTARSRKSG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX26	Uncharacterized protein	0.92	352-372	GSGKRKKSAFDKAVKRANSKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX26	Uncharacterized protein	0.869	200-207	AKGKKKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX26	Uncharacterized protein	0.663	268-276	KSKKDERDR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXF9	Hydroxyproline-rich glycoprotein DZ-HRGP	0.995	116-176	KSKKGKGKKSPQKVKDSEEGGLPKKGKRKAKAAAADGAEEDGEVKPSKAKKARTPKKAKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXF9	Hydroxyproline-rich glycoprotein DZ-HRGP	0.922	40-50	GRKSNKKKKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXZ8	Proteophosphoglycan ppg4	0.953	794-808	ERRKARKEEAKRKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXZ8	Proteophosphoglycan ppg4	0.734	966-975	SRRRPGGKDR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYK0	Transmembrane ATP-binding protein ABC transporter	0.994	388-427	APKKKRTRKRKYTPEEAAARRKEQEKERQAKRRKTEKQRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD6	Cell wall surface anchor family protein	0.998	1398-1431	PKPAKKAPIPKASPANGANSGKKKRRKRKSLVMP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD6	Cell wall surface anchor family protein	0.927	1486-1525	VKKARKEAANREEVRESSTARSKPTQAKGRPAQQKKVKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD6	Cell wall surface anchor family protein	0.924	1195-1212	RKKRARDATPPSKAKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD6	Cell wall surface anchor family protein	0.774	996-1005	RPPGKKAHRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD6	Cell wall surface anchor family protein	0.71	1335-1340	RKRKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD6	Cell wall surface anchor family protein	0.605	1434-1436	RNR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZE8	Pol II transcription elongation factor	0.986	194-221	TGASKTKSDGFEKLKKSRTEKGKKKAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZE8	Pol II transcription elongation factor	0.941	259-270	GAKKKGKGKKAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZE8	Pol II transcription elongation factor	0.918	25-40	AKGAGGGGGGKKRKRQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZE8	Pol II transcription elongation factor	0.604	192-192	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZN0	Glycoside hydrolase family 5 protein	0.965	154-164	NGKKSKRRRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZT6	Small nucleolar ribonucleoprotein complex subunit Utp14	0.99	509-536	RAERKAKRVAKIKSKAYRRIHRKAKERA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZT6	Small nucleolar ribonucleoprotein complex subunit Utp14	0.96	75-100	RASFGARKGKGKQQAKGAAAKGKGRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZT6	Small nucleolar ribonucleoprotein complex subunit Utp14	0.885	883-892	GRKGKKGKRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZT6	Small nucleolar ribonucleoprotein complex subunit Utp14	0.805	984-994	KGAKKAKNARK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZT6	Small nucleolar ribonucleoprotein complex subunit Utp14	0.783	281-299	KKRKSRDGEDEDGGKKKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZT6	Small nucleolar ribonucleoprotein complex subunit Utp14	0.683	578-589	LKHSGKGGRWAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZU6	Uncharacterized protein	0.928	151-170	QARKEREEETRKKKQAKRQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T019	Proteophosphoglycan ppg4	0.972	302-323	PAPKRKGGRKKSAAAAAKTAAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T019	Proteophosphoglycan ppg4	0.618	358-360	KKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J7	Proteophosphoglycan ppg4	0.63	1329-1332	RKER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q9	Serine/arginine repetitive matrix protein 1	0.988	423-457	DERRSRRSRKERPPSDESPPPKARSRSSRRRRPER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q9	Serine/arginine repetitive matrix protein 1	0.889	489-512	RASRSKRDGASRPRTRSSRSRPRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q9	Serine/arginine repetitive matrix protein 1	0.847	541-553	SRRSRSSRRRPRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q9	Serine/arginine repetitive matrix protein 1	0.649	297-300	RRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q9	Serine/arginine repetitive matrix protein 1	0.602	284-284	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Z9	Putative MFS transporter	0.749	79-90	KQRKAGQRRRVR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Z9	Putative MFS transporter	0.725	54-60	KARRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T119	Uncharacterized protein	0.998	302-346	RKRREKEELGDVVKREREREKEERKRKIEEKRREMEEKRKKARGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1A6	Uncharacterized protein	0.886	172-202	RKRVVEAAKARREERYGWRKAIAREERQRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C5	RGS domain-containing protein	0.67	191-195	RRKHK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C9	LigA	0.71	301-308	KPPRKRVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1I0	DNA replication ATP-dependent helicase/nuclease	0.793	40-58	ARPAHPAKRVKPATPSPRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1I0	DNA replication ATP-dependent helicase/nuclease	0.69	178-186	RRQARERKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1J6	Uncharacterized protein	0.994	180-196	RGKKSKKGKGKEKARKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1J6	Uncharacterized protein	0.947	25-44	RQKRRAFEQKKKGRDARRNK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L9	Putative Ribosomal protein	0.947	1006-1018	IRKRQARSKKKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L9	Putative Ribosomal protein	0.863	1231-1240	KKRWKKQKKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L9	Putative Ribosomal protein	0.777	1081-1092	KNRKSQARKAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L9	Putative Ribosomal protein	0.733	1281-1298	KGAPKVGITGLKRSSGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1N2	Putative Microtubule-associated protein	0.828	288-313	RRDSSPSRRNGPRPPQSRSRQPAPKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T6	Proteophosphoglycan ppg4	0.708	589-599	APPRPPRSTKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Z3	Uncharacterized protein	0.968	259-268	VKRKTRRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Z3	Uncharacterized protein	0.897	196-207	RAGKDRRPRRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T203	Proteophosphoglycan ppg4	0.935	8-47	KRPAGKKGPRQVTGKRQPKITLRPAPARDPAAPTADKGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T203	Proteophosphoglycan ppg4	0.827	500-512	EEAKKKTRRAGAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T282	Ribonuclease P/MRP protein subunit	0.982	88-139	RHLRRRAASHNIRRLPSRLRERAKAEVPKDAAKPKRVSRSMLGRHRQKPGIK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T289	Proteophosphoglycan ppg4	0.823	754-767	PAAGRGRPAKRARL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T290	Salivary gland secretion 1	0.706	560-570	RHPRRMRRVPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUD3	Transcription elongation factor Spt6	1	59-97	RRRRRRLKKKKRRERKQREAGGEADEGGEGRDSSRKRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUD3	Transcription elongation factor Spt6	0.998	199-225	GRAARQGKKKRDERRKRAEKAGARRRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUD3	Transcription elongation factor Spt6	0.883	124-136	KPKGKLRRLRRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG4	Proteophosphoglycan ppg4	0.918	337-353	RKARRTSRKPFPAKKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG4	Proteophosphoglycan ppg4	0.636	416-430	RQLRNKLSARNFRHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG9	Uncharacterized protein	0.846	628-661	KVRRQLAEIERRRKEMEGAKVAPERTQGKKAARA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB2	Kri1_C domain-containing protein	0.999	626-678	EKRKEKKRRYKERKEAREAGEGGAGDGSRGADGEPPKKKKRAGKSERKRLKAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB2	Kri1_C domain-containing protein	0.994	478-493	PRKKSKKDKKGKGKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB2	Kri1_C domain-containing protein	0.898	346-377	RARAREAAKERKEQEKLQRKEELNRLKALKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB2	Kri1_C domain-containing protein	0.841	270-278	KPKKKRKTK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB2	Kri1_C domain-containing protein	0.684	596-602	QRKKLKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVU0	Set1 complex component ash2	0.853	379-389	RKNKGGKEKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVU0	Set1 complex component ash2	0.666	46-52	RRPTKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW22	ATP-dependent RNA helicase ROK1	0.999	241-261	AKGKGKEGKKGKGKKGKKEKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW22	ATP-dependent RNA helicase ROK1	0.989	62-74	RKAKKKERKRKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW22	ATP-dependent RNA helicase ROK1	0.987	592-644	GEEGGAKTEKSKKRERIMGGKGGVFKKGKKGEDGMADKASESKGERAAKKAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW22	ATP-dependent RNA helicase ROK1	0.664	572-581	LKMRPLGRKD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW38	Putative Oxidoreductase, short chain dehydrogenase/reductase family	0.871	10-21	RRGLRRRKRSSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB4	Salivary gland secretion 1	0.986	659-690	RRRPAKRRSSAPPAPADTPLRRRRSRGSKRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB4	Salivary gland secretion 1	0.965	344-371	RARRSPNSPPRRKKLRHFARGIGSLRDK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB4	Salivary gland secretion 1	0.899	1029-1041	HAPKPRRGRRPPH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB4	Salivary gland secretion 1	0.816	775-784	PRPRRRAERR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB4	Salivary gland secretion 1	0.787	415-425	RRPAPRRKNRY
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB4	Salivary gland secretion 1	0.757	58-72	KPRPRRSSTRPPSPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB4	Salivary gland secretion 1	0.619	430-434	RSRPA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX67	Proteophosphoglycan ppg4	0.99	48-75	RRKREEARAAGRRRSRGTAGRGKGAKGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX67	Proteophosphoglycan ppg4	0.653	259-267	RSPRARSPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX89	RING-type domain-containing protein	0.854	367-383	RRRRDEEAERERRKPRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXM2	Smg4_UPF3 domain-containing protein	0.998	221-273	AGKGAKGGKKDKAKEKKGKGKSKESSRSATPVPGAAASGSGAAKGGKSSKPPT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXM2	Smg4_UPF3 domain-containing protein	0.995	399-438	GGQRGRGRGGGRGGGDGGGRGGRGRGRARGRGGAAAAGGP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXT3	Putative Fatty acid desaturase	0.777	45-53	TKRKGARRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY04	Cell wall surface anchor family protein	0.888	246-256	SKRRKGKGRAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY04	Cell wall surface anchor family protein	0.712	141-149	KAKGKAAKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY04	Cell wall surface anchor family protein	0.708	1440-1447	GGRKRSPG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY04	Cell wall surface anchor family protein	0.628	9-14	GGRGGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY04	Cell wall surface anchor family protein	0.617	1375-1379	RAAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYC8	Uncharacterized protein	0.978	293-325	GARNAAGGARGRGRGRGRGRGAFAPSSGRPAPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYC8	Uncharacterized protein	0.861	45-57	RGRGRGRGRGRGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYC8	Uncharacterized protein	0.683	527-534	RLTKKLKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYC8	Uncharacterized protein	0.681	262-280	RKKELAEQKKVEMEEKRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYK1	Non-specific serine/threonine protein kinase	0.999	713-762	QQRPKGKKFEDKDEKKKRRQEVKEQNREKRATKMKKKDKARKVKKTSGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ82	Proteophosphoglycan ppg4	0.991	78-108	RKKTKKNKSGGGKDGKGGGASAKGKGGRKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ82	Proteophosphoglycan ppg4	0.898	818-827	AHKGKKRRRT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ82	Proteophosphoglycan ppg4	0.607	43-45	RDK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZC0	Proteophosphoglycan ppg4	0.645	148-152	KKRGE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZG4	Proteophosphoglycan ppg4	0.772	568-577	GKRPERRGPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T014	Splicing factor PWI	0.723	18-29	KRARERLREKAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T014	Splicing factor PWI	0.62	35-37	RRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T085	Non-specific serine/threonine protein kinase	0.999	811-829	TPPRKRQRRRRGAKKKKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T085	Non-specific serine/threonine protein kinase	0.97	630-649	KNEEEGKRRSGRRTRGRGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T085	Non-specific serine/threonine protein kinase	0.644	171-174	RKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J2	Serine/arginine repetitive matrix 1	0.852	791-812	KDARRWERRHQDLAKKRARVIR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0N6	Uncharacterized protein	0.97	28-44	PRRWRKREREREKRDRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0N6	Uncharacterized protein	0.771	216-226	AKRKRESRDAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0N6	Uncharacterized protein	0.753	296-305	QRRDERRKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q5	Protein kinase domain-containing protein	0.626	542-544	RRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q5	Protein kinase domain-containing protein	0.6	591-591	R
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D6	Polynucleotide adenylyltransferase	0.997	165-187	RSSSKERPAPGAKKGGKKGKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D6	Polynucleotide adenylyltransferase	0.994	664-691	RRAAERTARAKKARREKRAEKRDRALQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D6	Polynucleotide adenylyltransferase	0.954	28-41	PKKPRNRHRPRRKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T201	Proteophosphoglycan ppg4	0.801	434-441	AKRKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T201	Proteophosphoglycan ppg4	0.784	911-921	RHRRRKSEPRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T201	Proteophosphoglycan ppg4	0.757	674-684	RRLGGKGKGKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T201	Proteophosphoglycan ppg4	0.688	878-883	SRRRRH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T229	Uncharacterized protein	0.999	150-213	KGKGKEVEEPSKKRKRDEDESKQEKRRSKAEREAEKAAKKAKKEEEKAARKAEKRASRGASREK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T229	Uncharacterized protein	0.992	306-333	RAKKAARRAEKEERRLAKKAAKKALKEL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T229	Uncharacterized protein	0.635	251-255	AAKKL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T296	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.993	258-288	RIREVEEKKERRREGQIREAKRRREEKRRGN
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2C5	Proteophosphoglycan ppg4	0.879	426-435	KPRKKTKAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2C5	Proteophosphoglycan ppg4	0.799	174-197	PSKGKGRARSDSPASSSTKRRRTR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUF5	Proteophosphoglycan ppg4	0.614	297-299	PRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVE0	WD_REPEATS_REGION domain-containing protein	0.695	483-498	KDVPRKMNRSRAILRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL1	Mitochondrial genome maintenance protein MGM101	0.81	292-300	KKARRWRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW13	Uncharacterized protein	0.679	115-123	RRPPTRRPN
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL1	Rnp24p	0.991	368-397	KPKSDKKREQKKKREKGAPLDLAKAKDAGI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL1	Rnp24p	0.986	26-43	VKKSKGKGKAKDGSKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL1	Rnp24p	0.935	526-557	PPRAQRGPRPQRDDARKGGREDGGGAKRPKPG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL1	Rnp24p	0.902	91-102	SRKERRQAKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL1	Rnp24p	0.889	460-480	KSGGGGGGRGIAGPRRRGPRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL1	Rnp24p	0.756	492-500	RGAGGKKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX83	Cross-beta structure silk protein 2	0.996	284-317	VKLGGEGKKRKRLSKERRERAWARRSAAEKGAKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX83	Cross-beta structure silk protein 2	0.626	121-124	KRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXC5	Proteophosphoglycan ppg4	0.989	257-284	GRRGKKRVKGGIGGSTTKKKGAARKKLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG6	DNA polymerase beta	0.979	447-473	VKERERARKKQAKLEAAKQKKLGAKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG6	DNA polymerase beta	0.955	580-596	PKGKGKAKAKAKVEKRV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG6	DNA polymerase beta	0.716	66-74	RLAGKKRMR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG6	DNA polymerase beta	0.656	97-100	PKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXR8	Proteophosphoglycan ppg4	0.891	839-859	RRRGTPSGSSAPPNKRRRRNP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXY0	Sterol regulatory element-binding protein cleavage-activating protein	0.796	741-751	SSRRRRKQEAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG8	Proteophosphoglycan ppg4	0.999	228-262	AKKGKAKAKAPANGKGKGKAAPAKKGGRKGKAPAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG8	Proteophosphoglycan ppg4	0.999	296-337	SKKKGKKRASSVGSGASKGKGKADKPKKERKPPAPKPGDAEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG8	Proteophosphoglycan ppg4	0.649	101-104	KKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG8	Proteophosphoglycan ppg4	0.638	198-201	KKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG8	Proteophosphoglycan ppg4	0.619	124-126	RKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ6	Uncharacterized protein	0.894	63-85	RARGKKTPAGRVREREAGKSKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ6	Uncharacterized protein	0.774	14-21	KKRAKKPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM7	Proteophosphoglycan 5	0.911	671-680	MRIKRKRKRV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM7	Proteophosphoglycan 5	0.9	540-564	AGRASSRSGSRAASRGRAQKPRPRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM7	Proteophosphoglycan 5	0.757	650-659	RGRSRSRRRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM7	Proteophosphoglycan 5	0.647	236-240	RRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ29	Uncharacterized protein	0.994	118-141	EEKTAKNRLKRQRKKEARGKPKGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ29	Uncharacterized protein	0.636	160-163	KKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T028	Proteophosphoglycan ppg4	0.982	637-650	SKAKGKEGRKRRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T028	Proteophosphoglycan ppg4	0.671	1062-1070	KKREGRERR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T028	Proteophosphoglycan ppg4	0.636	681-689	KRGREEERP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T051	Proteophosphoglycan ppg4	0.67	21-26	RRTKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T089	Pol II transcription elongation factor	0.882	1263-1280	KTSGSRRRAALKKAAGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0L6	Proteophosphoglycan ppg4	0.62	911-914	RRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y8	Alpha-ketoglutarate-dependent sulfonate dioxygenase	0.978	86-123	RKAELAVRESEKEKKRAKKAREGDCGLAGRRKRAAMGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T117	Uncharacterized protein	0.958	216-240	PIAGKKRKSERGAAEQSKKSKKASS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T131	Restriction of telomere capping protein 4	1	767-800	KRNARAEKEEKKRKRKKAAAKAAKTRKARQERGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T131	Restriction of telomere capping protein 4	0.995	615-635	EKRKKRSRSADGSAKKRKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T131	Restriction of telomere capping protein 4	0.979	282-300	SPRRSPRRKDKGKGRERTR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T131	Restriction of telomere capping protein 4	0.952	238-264	KQPKSKKRRSSQSEAGPSKLKKARGGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T131	Restriction of telomere capping protein 4	0.85	119-148	HKAKGIARAQVRLPRAPSDSPNKKAAKERK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T131	Restriction of telomere capping protein 4	0.665	174-181	KKRAMEKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1N7	Proteophosphoglycan ppg4	0.975	152-200	PPRSASRRRSSVSAAKPPVSPTLQKPKSPPVLPKPSGPRKLVRKKSKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1N7	Proteophosphoglycan ppg4	0.756	50-58	RRPSRRKSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T242	Uncharacterized protein	0.96	8-40	KPPANAHKAKSSTQKKSQPKDPKKGARTIPPKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T242	Uncharacterized protein	0.704	87-94	AREEKAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T287	UBX domain-containing protein	0.946	292-320	ARKKREKEEKMKRLLGKGLGMGGSKGSVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T287	UBX domain-containing protein	0.715	133-144	AAKNKAKAARWP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2A4	RNA binding protein	0.917	224-234	RSARRNRKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2A4	RNA binding protein	0.852	434-451	ERIAEMERRKKEAGSKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2A4	RNA binding protein	0.688	417-429	ERKHRLEAKEREI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2A4	RNA binding protein	0.604	431-431	R
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB5	Sperm nuclear basic protein PL-I isoform PLIb	0.99	91-110	AEQNRKKKERKLRSKARKEA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUL2	Proteophosphoglycan ppg4	0.777	555-575	PSAGLRRPKTAPENRPSRPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV20	Minus agglutinin	0.994	90-127	GRVEKRKKRREEPETRRERKVRYRRERERGEGAEHKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV20	Minus agglutinin	0.982	260-283	RHDGRRTPSPKPARKVSKRRKDRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV20	Minus agglutinin	0.962	193-218	PERPKSMKGKGERRRAVEPKSRWLKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV20	Minus agglutinin	0.78	161-170	ERKGREKRGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV20	Minus agglutinin	0.655	11-17	RGREKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV20	Minus agglutinin	0.645	42-46	RERKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV38	Proteophosphoglycan ppg4	0.965	274-303	RRFARRVKEIKREARGEKSDRREARERKEP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV38	Proteophosphoglycan ppg4	0.903	849-864	RAKRERRAAKRSALKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV77	DNA replication origin binding protein	0.99	4-31	RKARAASTPKKTPSKPSAKAKGKRKATD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV77	DNA replication origin binding protein	0.964	219-236	PRKRRRTAAPAKAKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV97	Proteophosphoglycan ppg4	0.955	41-58	RRANGKGVNRRKGKGKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV97	Proteophosphoglycan ppg4	0.659	370-373	KRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ3	Ribosomal protein S8	0.877	567-582	RRAGGEKGRPVPRRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL3	Ribosome biogenesis protein NOP53	0.967	393-422	RGKVPVERANESKKGGKRGGRGHDKGHGMR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL3	Ribosome biogenesis protein NOP53	0.942	271-288	KRRAAKRKTKAQRNTKLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL3	Ribosome biogenesis protein NOP53	0.776	92-111	KRVKAKLGKVDRATKEKLKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL3	Ribosome biogenesis protein NOP53	0.634	336-340	ARKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW43	Histone acetyltransferase	0.877	477-486	APRKKKKVAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWG8	Transcription termination factor Rho	0.865	26-43	GRGRRRDRLERDKGRRSV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ1	Uncharacterized protein	0.936	100-112	GSKRRRLSKKRRQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ1	Uncharacterized protein	0.77	387-398	RKSGPRRQKPKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWK1	Seryl-tRNA synthetase	0.676	978-991	KRKTAAAEKALAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG1	WD-repeat-containing protein	0.865	164-173	ARRKRTRGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG2	Kinase	0.973	1308-1327	RHRKDGDRSHRRSRSKKRKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG2	Kinase	0.95	879-896	KLREGRRGWKEGKRRKMR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG2	Kinase	0.898	717-729	LRKSNGRRRRRAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG2	Kinase	0.699	134-150	AKRSGSRESPSKSRHPS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ1	Putative Microtubule-associated protein	0.979	74-113	KPLAVKKTGKHVLKLVKKASKSRHLKRGVKEVVKSIRKGE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ1	Putative Microtubule-associated protein	0.971	42-56	QKKKSKKEKKEKAAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ1	Putative Microtubule-associated protein	0.605	146-147	RK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYL7	Nuclear export factor	0.915	42-67	ERGRGRGRGTGRGGAGRGAGGPGVKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYL7	Nuclear export factor	0.837	923-948	RRSLERWRRATKRSLVHKAEERARRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYL7	Nuclear export factor	0.762	1399-1405	PRKKRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZS1	G-patch domain-containing protein	0.897	97-112	RKAAEEMRGGPRRKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZS1	G-patch domain-containing protein	0.642	52-56	RDRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T021	60S ribosomal protein L3	0.922	67-82	PRKRAARHRGKAKSFP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T021	60S ribosomal protein L3	0.689	287-296	KKLPRKTHKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G6	DEAH box polypeptide 36	0.958	2095-2117	KKAKKAKGANGAAGSGRPGRKRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G6	DEAH box polypeptide 36	0.879	48-71	RRRGGGGAVGRKRGGAGGGAGPSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G6	DEAH box polypeptide 36	0.877	1997-2017	RRAAANGGRAGSERPQRKRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G6	DEAH box polypeptide 36	0.796	1962-1983	KPKIRKQRASTGGMGMKKGKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G6	DEAH box polypeptide 36	0.645	2052-2055	KKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H8	Putative Chloride channel protein k	0.998	340-359	AKKKGKSPGKGKKSRRGRRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H9	Proteophosphoglycan 5	0.977	86-103	RPARLRKRRKALDRRKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1K6	Glycosyltransferase 2	0.7	1171-1177	RRAKRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1N8	GATA-type domain-containing protein	0.959	787-801	NGGVAPKKGKKKGKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1V4	54S ribosomal protein L4, mitochondrial	0.909	233-249	ALLERRRQNKGRRARAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1V4	54S ribosomal protein L4, mitochondrial	0.796	217-229	EAGRQRKREKAQL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1V4	54S ribosomal protein L4, mitochondrial	0.633	51-58	KPRAASGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUC2	Dolichol-phosphate mannosyltransferase subunit 1	0.646	316-319	RKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUY9	Chitin synthase	0.887	269-298	LRRPKRGAAGGAMPGGAYDRGRRAKEAKKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVA3	Tyrosine--tRNA ligase	0.808	388-400	AKKKVKKYTPKPE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ5	Catalytic activity: RhaA is able to hydrolyze alpha-1	0.885	697-713	GRRRVWKRTKAVKRRLF
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ7	C3H1-type domain-containing protein	0.996	286-344	ERKKRWPSKKVVEEKEKARAERIAAGLEAPPRERGGRGRGRGRGLADVRGRGRGRGGRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ7	C3H1-type domain-containing protein	0.868	498-510	PLPKRKRPAPPPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT9	Putative BZIP transcription factor AtfA	0.873	607-620	KKAPAKRGGRKAAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT9	Putative BZIP transcription factor AtfA	0.725	666-673	KGGRGRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVV6	CDT1_C domain-containing protein	0.626	526-529	KAKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVV6	CDT1_C domain-containing protein	0.623	536-540	DRARR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW9	Proteophosphoglycan ppg4	0.977	204-247	PPKKKKAASKSYATGEKPKSSQKKRTVEDAKATPPPAKKPKKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW9	Proteophosphoglycan ppg4	0.827	141-150	RRAKAKKKQS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW9	Proteophosphoglycan ppg4	0.623	178-182	KEQKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY0	Proteophosphoglycan ppg4	0.998	855-900	RERRRRERKERERVKVEEREKKARREAAEKERRAREKKAREREEHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW79	Vac14_Fig4_bd domain-containing protein	0.899	328-344	AKREKWAREVERKRRRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWA9	Proteophosphoglycan ppg4	0.967	46-69	VRTKGGEKREPAKGGKGKMRSAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWA9	Proteophosphoglycan ppg4	0.95	608-641	PTSGQRAKRIKATEARRKLERLRIDEGKRAGTKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWA9	Proteophosphoglycan ppg4	0.785	131-138	KKRRKEAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWD4	Uncharacterized protein	0.723	366-372	KEKGGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWD4	Uncharacterized protein	0.703	277-288	KRPRVIRPRLLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX5	DnaJ domain-containing protein	0.953	672-696	AKKGKKRSSTGGEDGAKGGKKAKKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX5	DnaJ domain-containing protein	0.952	587-600	GKEKRKKKADKEAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX5	DnaJ domain-containing protein	0.901	623-634	SKGGKGKGKGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXX5	DnaJ domain-containing protein	0.67	714-718	RRGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY34	Proteophosphoglycan 5	0.981	204-224	ASVSQKKRKPLPKKRVAPRRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY34	Proteophosphoglycan 5	0.855	33-46	PKTVPKKVKRKALA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY92	Uncharacterized protein	0.832	11-46	RKQRKTRADSRLYGIKAKAWRGYKPASGGKSVARRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYD3	Required for respiratory growth protein 9, mitochondrial	0.925	330-353	PAEERERRERKRQEEKRAETARRH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYT4	Cysteine synthase	0.799	896-906	RKWGRRGRGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYT4	Cysteine synthase	0.64	505-508	RRKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ20	Mediator of RNA polymerase II transcription subunit 14	0.924	341-361	KEKKWNEERREVIKKRRRDRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T023	Proteophosphoglycan ppg4	0.996	268-298	RKKPWEELEAKPPKPKRKTAKKAAKPVAPKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T023	Proteophosphoglycan ppg4	0.84	900-911	AKTATKGRRRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T023	Proteophosphoglycan ppg4	0.707	698-703	KRRKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T023	Proteophosphoglycan ppg4	0.64	72-76	KKKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J9	Proteophosphoglycan ppg4	0.98	407-428	KGGKDLPNGGPGGKSRKKRRRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J9	Proteophosphoglycan ppg4	0.786	328-336	RRRRRERER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0M4	Uncharacterized protein	0.993	116-129	SRTKRKKGKKKQGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVA6	Metallophos domain-containing protein	0.99	526-549	RRPGRPKKKPARPAAGSNGGRRLV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC1	Uncharacterized protein	0.968	561-587	KGRPWTSKKPIRTAPWEKPKAKRSKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC1	Uncharacterized protein	0.959	104-113	IKRRRKKPKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC1	Uncharacterized protein	0.918	503-516	LTGVAPRKKKGAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC1	Uncharacterized protein	0.661	492-500	RRRAAAKAT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI3	Uncharacterized protein	0.752	751-763	NGGVKEEKKPKIK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI3	Uncharacterized protein	0.73	355-363	KAEKKPKVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW86	Structural maintenance of chromosomes protein 5	0.78	1167-1177	KRKLNKRKGLP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWA7	Uncharacterized protein	0.698	204-217	RREWEKKDAEKRGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWI4	Putative DNA repair protein Pso2/Snm1	0.999	29-87	SAKKKAKKAGSPSDGAGGTPKTSGKGKAKAASPASAKGKKGKAVKGKKGKAVKGKKRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWI4	Putative DNA repair protein Pso2/Snm1	0.736	903-910	AEKKRRAD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX77	Mot1	0.968	369-399	RERNKLKRKRKVEEKAGIAPSAAPVPAAKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB9	Pre-mRNA-splicing factor CWC2	0.943	14-27	PPKKRMVKRKPARK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG4	Uncharacterized protein	0.687	81-86	RRRRSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG4	Uncharacterized protein	0.662	549-560	RPPAMAARKVRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG4	Uncharacterized protein	0.658	496-505	GGAGGKSRGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG4	Uncharacterized protein	0.634	567-571	GGRRN
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXZ5	Pherophorin-dz1 protein	0.719	693-703	DRKAKEAKTKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXZ5	Pherophorin-dz1 protein	0.661	157-161	RKRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYA6	Proteophosphoglycan 5	0.756	142-149	SKKPKPRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYI7	Cysteinyl-tRNA synthetase	0.824	686-711	KAAAVREKAAKKAAAAAAAEAKRLER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYI7	Cysteinyl-tRNA synthetase	0.749	750-758	KSRGKKLKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZM6	Proteophosphoglycan ppg4	0.993	563-614	KGAKRKKVVPAPAKKRPMPTVKKAGAATRSSPRKAALSSRAAPSTSKTAKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZM6	Proteophosphoglycan ppg4	0.98	506-526	AKSKGGKRKGKAVSPASKKRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZM6	Proteophosphoglycan ppg4	0.973	638-706	KRLPPKKRTRASTERPSSTQRARRTSSGASASPASSPKAVKKAAPAKKSTPAPVKSQRPIKEGSRRSAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZM6	Proteophosphoglycan ppg4	0.719	357-373	RRRSERAPSPPSERKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T002	Phosphatidylinositol 4-kinase	0.866	514-550	PKAVPPVHLAPKAPAPPPKEPPAPPPKTASARVARHH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T002	Phosphatidylinositol 4-kinase	0.809	627-636	RLRKARRKDK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0B5	RRM domain-containing protein	0.987	663-688	RGFARKRHREAVKRSKKTGGRRGAGP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0B5	RRM domain-containing protein	0.971	111-129	EKGGENSTGRPKKRKKASK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0B5	RRM domain-containing protein	0.949	189-232	RGTAKAKPSKAARASQREGSFAARPALTRAKRMRIDPRRWGRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F4	Nucleolar rRNA processing-related protein	0.917	556-563	GRRKRKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F4	Nucleolar rRNA processing-related protein	0.88	761-775	RKRMRKPARSASRNK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F4	Nucleolar rRNA processing-related protein	0.861	510-545	IRGAKKAAGAAVAGVKVNKQLARRAREAEEKLRKRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F4	Nucleolar rRNA processing-related protein	0.749	39-45	NKRRKRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G0	Uncharacterized protein	0.785	43-52	ARSKRRRSFR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y1	DUF155 domain-containing protein	0.955	61-80	RPQKHKAKKSKSGKEQPWRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y7	Proteophosphoglycan 5	0.84	107-122	RRPQRKASLRARRGRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Y7	Proteophosphoglycan 5	0.655	566-574	RRRNLLRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T157	Rab guanyl-nucleotide exchange factor	0.748	297-309	RVPRPARRQRPER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D8	J domain-containing protein	0.956	457-483	PRKRKRVSGKIRELRKEHAEVIRERRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H7	Cohesin-associated protein Pds5	0.998	1233-1285	KAEKKKPTGGKRVSTAAANGESKPKRVKTKKAGSSTAKKRGPAKGKAAKKAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H7	Cohesin-associated protein Pds5	0.998	1372-1412	AKKGKPKAATPKKKAATPKKKANGRAATSSLAKKGVKGKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H7	Cohesin-associated protein Pds5	0.989	277-302	GKGGRGKRKAKTKAQAKLKDGRDKAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H7	Cohesin-associated protein Pds5	0.937	240-251	KGKGKGRKGRRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H7	Cohesin-associated protein Pds5	0.865	1319-1332	KKGKKPARGQRGGL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H7	Cohesin-associated protein Pds5	0.774	1424-1440	KPRKALSGLKQPRKMKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1V8	Proteophosphoglycan ppg4	0.697	363-371	KKAPPPKRI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Y0	Uncharacterized protein	0.971	354-389	GGKRGRKTGEAGKRKAKDAEGDVGGAVVRKKRKTSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Y0	Uncharacterized protein	0.601	168-168	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T294	Uncharacterized protein	0.619	34-37	PRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2A1	Pol-like protein	0.93	799-840	KPAEKGAGGAKAALAGVKSMEKGPAGGHEPKKRVRGEEKEEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2A1	Pol-like protein	0.763	2050-2058	RERRKERRT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2A1	Pol-like protein	0.713	1292-1306	RRTRNEMKEVMRRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUL0	RPA43_OB domain-containing protein	0.626	303-305	GKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUZ2	Uncharacterized protein	0.869	66-79	RPPRRKGPPPKPAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV90	Putative Transporter	0.922	837-847	KRRRDKKRMRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVH2	ATPase	0.952	1123-1137	KEKDAPRKGRRKGRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVH2	ATPase	0.715	316-323	GKRKLRNK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVH2	ATPase	0.698	241-251	RGERSRRSSRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI5	STE/STE11/cdc15 protein kinase	0.917	159-182	KPRGKTGLQKRSQRKIAKAIKRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWE6	tRNA (uracil-O(2)-)-methyltransferase	0.833	546-562	RKGEWKARKPEGKAGER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWT3	Cytoplasmic protein	0.982	580-623	TADDKKARKAAVKAERAARRQEKKGTKEAFESETKRQKRIQGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX41	Uncharacterized protein	0.999	365-403	RKKPRPDMVAAERPSPKKRKKKESPDERRARTKGKNKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX41	Uncharacterized protein	0.994	171-205	EKGQQKKKGGDASPKWREATQDKGKGKDKKKRKHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX41	Uncharacterized protein	0.953	450-465	SKKGGKKRKGSAYKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB6	Uncharacterized protein	0.995	212-245	GKEGAEGEPKEKKKRRRRQQRTPTPPPLAPKEPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB6	Uncharacterized protein	0.963	320-335	GEAGGNGPPKKRRKRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB6	Uncharacterized protein	0.874	299-308	GRRKKGKEKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB6	Uncharacterized protein	0.753	386-397	RRGRVKGSKNKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB6	Uncharacterized protein	0.745	188-197	KAKSPKKARE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB6	Uncharacterized protein	0.645	456-460	KKVRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXC0	Chitin synthase	0.667	621-630	RRAPSTRRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY10	Phospholipid-transporting ATPase	0.837	239-253	FWGKRSMRVGRRKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY96	Pre-mRNA-splicing factor CWC26	0.983	142-167	KAAEQERKRRKAEKEEARRKAEARAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY96	Pre-mRNA-splicing factor CWC26	0.967	28-36	GKRRKKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY96	Pre-mRNA-splicing factor CWC26	0.839	269-279	KKKEKKTKGPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T043	Putative Chloride channel protein k	0.798	59-77	RVDRAPANGWSKKLRRRSL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T043	Putative Chloride channel protein k	0.715	92-102	KARKERGSDRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T049	Uncharacterized protein	0.995	149-201	RRRNKEETERIERAEKERKVKEERERIEREKRTREERERIRKLEERKKRKSEE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T049	Uncharacterized protein	0.989	19-42	AERRAARKSRKKRPARDESLTPPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.998	996-1053	RRRRAALRDNRRKKLKERIKAEKSDGAKKRANEPSNGRKGGGKANAVQDDERPRKKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.996	1147-1268	LDPEKREKKEEKERWEKVMLKAEGEKVRDDEKRLKKMAKRQEREKRKSAKAWTDRKATVEKSISDKVAKRNANLAARSKAVKDKKMGIKNKKSGSGKKVSTSSGKARSKGRPGFEGGGRKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.979	59-92	AKKRSAAKGKGKGKAMAPQPLSRAKQVDKPSRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.875	342-358	NGAAPRASPRKDKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.836	25-32	RPRKRRKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.836	655-674	STGRGRGGGGRKASGGSGRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.816	813-837	TKAQRKALKKAKQDETVRAAKNEAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.791	314-334	KAKREKEEAIAALKAKRGRQS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.745	211-228	APTKPATKTSNTSRRKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0E3	Proteophosphoglycan ppg4	0.608	1141-1143	KER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J3	Uncharacterized protein	0.703	19-25	RKKKAPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J3	Uncharacterized protein	0.677	348-354	GGKRGRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D0	Pre-mRNA splicing factor	0.942	198-209	KATRRKRKAKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1D0	Pre-mRNA splicing factor	0.605	242-242	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG3	Putative Late endosome to vacuole transport-related protein	0.741	1741-1750	PRMKKRPSLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUK9	Uncharacterized protein	0.997	1983-2019	RAKEGKWERKGKAPAKKAKKEESEAEAKRSRVEKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUK9	Uncharacterized protein	0.989	2077-2098	KAKGKGKAKAPEPKKAVSKKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUK9	Uncharacterized protein	0.834	2158-2197	KRKQSTLGRFFGKKPAEKEEAAASVAKKETKQKEKGEEKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUK9	Uncharacterized protein	0.803	1331-1343	HKANAKAKGKAKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUK9	Uncharacterized protein	0.791	2036-2047	RRAAPAKKLPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUK9	Uncharacterized protein	0.683	2129-2144	KPKSKPSSPAQPAFKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV56	Ribosomal protein S8	0.725	536-542	RKRKVRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW32	Uncharacterized protein	0.789	1009-1020	RRRRHHHQRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXF7	Uncharacterized protein	0.977	63-87	RRKKADKERERRERKEIEGGARKSG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP0	WD repeat-containing protein	0.721	440-447	KRSAKKRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYS5	Pol-like protein	0.918	378-402	PAGGQEPKKRERGEEKEAKDKPARA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYS5	Pol-like protein	0.912	972-992	AEREKRRRRNEMKSMMRTKKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYW6	Peptidase M14	0.987	240-257	KGGRSHKGKRHKHKKHGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZP2	Aa_trans domain-containing protein	0.995	56-76	GEARKEGSKKRKSGGRKKRSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZP2	Aa_trans domain-containing protein	0.993	91-105	SRRPAKRKKGKRRIK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZP5	50S ribosomal protein L34	0.987	106-135	KRKRKHGFLKRLRTKSGRNILRRRFSKGRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.997	1498-1522	AKKKAPAKAKAPPAKKAAAPKKKKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.95	1379-1398	AAKPKAAAAAKPKAPAKRKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.949	1348-1361	KPKKKAPAPKKAKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.939	1315-1334	NKARSLKKAKSAGKGTAKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.932	1419-1443	PPKKKKATAAAGTAGKKAAASKKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.912	1464-1484	KKPAAHSPKGKKATASKAKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.802	124-135	KKAPAKGKGKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T007	DNA topoisomerase 2	0.752	397-402	KKKGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T055	Pre-rRNA-processing protein ESF1	0.998	691-709	KAEKNKGKKRKVKGKKGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T055	Pre-rRNA-processing protein ESF1	0.995	551-569	YKRKEKERKERKKAERKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T055	Pre-rRNA-processing protein ESF1	0.979	258-270	GGKKGKGKGKRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T055	Pre-rRNA-processing protein ESF1	0.96	627-645	KKGKKDAAKPSKKERREQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T055	Pre-rRNA-processing protein ESF1	0.77	475-485	KKSKKLSKRER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T055	Pre-rRNA-processing protein ESF1	0.667	815-821	GGRGKRT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T055	Pre-rRNA-processing protein ESF1	0.635	763-766	KRRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J1	Uncharacterized protein	0.999	684-719	KRAKRPPPKKRKAGKGAGSRARPSAEGSTKDKKEGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J1	Uncharacterized protein	0.991	403-458	KRRRPRRAESAPPSSSPAHTPRKKTASKRRRFADRHGSGSAAAAPRRPASSARRQI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J1	Uncharacterized protein	0.922	348-381	NGKKRPYSPHRHGPSRIDNPPHRTKGPQSRKKRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J1	Uncharacterized protein	0.863	161-193	PRKPVQSRPSRPSRSPSPPDTRTPTPPPRKRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0J1	Uncharacterized protein	0.602	485-485	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0K3	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.969	179-191	KPGRGKGKGKKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0K3	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.899	463-472	KGSKKKKGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0V2	Proteophosphoglycan ppg4	0.74	58-63	KRKKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0V2	Proteophosphoglycan ppg4	0.611	76-77	KR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0V2	Proteophosphoglycan ppg4	0.607	171-173	KGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C1	Proteophosphoglycan ppg4	0.643	442-446	RKSKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1I2	P-type phospholipid transporter	0.98	66-99	RRRFKRFASRRQKKAESGSALKPRRTIFGRRKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1I2	P-type phospholipid transporter	0.931	160-174	GKGWLKKGKKEKGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T248	Salivary gland secretion 1	0.628	169-175	RSPARGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUL4	Ubiquitin carboxyl-terminal hydrolase	0.909	634-648	PRHQKKKKHGHPAGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV87	Proteophosphoglycan ppg4	0.985	297-374	RKKLFGKKAASVKKPSGIKEKPSGKKEEAPATGASGTKRKTRSSMAAAERAEDEASERAAKKRKTSPASKGKEPARAS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV87	Proteophosphoglycan ppg4	0.928	689-698	GKKRRRKARM
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV87	Proteophosphoglycan ppg4	0.672	217-223	QKKDKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVR5	60S ribosomal protein L41	0.988	245-268	APKKTDPGSKARKPRQRKTKAPKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVR5	60S ribosomal protein L41	0.746	495-502	RNKRKKGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT7	BZIP domain-containing protein	0.915	37-58	ATAKKGKSKASKGQDRKAQNRI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWH2	Uncharacterized protein	0.708	340-352	KRLKERDKLFKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWI7	Uncharacterized protein	0.999	75-144	KARQVKVRKRRRSEGVEEEARTKRRKEERAEEPPEVEEKSRKERTKRKKGKEKAVEASDKPKKKSKKRVR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWI7	Uncharacterized protein	0.89	27-53	PSKRSASRRASLNISRSRVKGKGKERA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWI7	Uncharacterized protein	0.821	289-298	GAKKKRPSAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWW6	Proteophosphoglycan 5	0.968	1001-1027	QRKHLEREYRREERPERRRGSRRSRTR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWW6	Proteophosphoglycan 5	0.7	1999-2004	KKGGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWW6	Proteophosphoglycan 5	0.614	1705-1706	RK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXD4	Non-structural maintenance of chromosomes element 1 homolog	0.998	343-369	MKKKGKGAAAKGKKAAASGKKGKKRTK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY40	Ubiquitin carboxyl-terminal hydrolase	0.787	81-95	RRRKPASELRRNKRD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY47	Putative Microtubule-associated protein	0.781	684-694	RRRLRPGPKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYE7	Methionyl-tRNA formyltransferase	0.886	410-437	RKKDWKKDVKKPEAPPPPHPVPPHLRDR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ07	Proteophosphoglycan ppg4	0.997	190-222	GRAKRKADKKRKLEEKAAQKAAKRAAKEASRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ07	Proteophosphoglycan ppg4	0.94	269-290	TRPKPLKKKAKIASPEAPVKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ07	Proteophosphoglycan ppg4	0.908	1587-1599	ARRAHRRARRRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZC4	GTPase	0.613	41-43	KAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZY3	Phosphoribosylformylglycinamidine synthase	0.617	1351-1354	KWKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q2	tRNA (guanine-N(7)-)-methyltransferase	0.779	165-181	KRQKVEAKDAKKSKVRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q4	DNA-directed RNA polymerase	0.774	1265-1277	KVERAKSKKATKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q4	DNA-directed RNA polymerase	0.768	1060-1070	EKPGKNKSKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0W2	Acetohydroxy-acid reductoisomerase	0.902	390-400	RKKGKGRRALR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H4	DNA polymerase epsilon catalytic subunit	0.815	13-36	GGGGQSSGRSGGSWRGRRGGGRGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H4	DNA polymerase epsilon catalytic subunit	0.815	1528-1546	KKRKEAEAERLKKDKSAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV14	Putative Cytoplasm protein	0.919	610-620	ETGRRRRRRRV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV14	Putative Cytoplasm protein	0.787	74-86	EVKKRGEAGARRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC7	Proteophosphoglycan ppg4	0.937	305-338	RRSPRLSPSLPPTPERRPGSPAPSPRRSPRPRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC7	Proteophosphoglycan ppg4	0.775	157-165	KKGKKAPRW
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC7	Proteophosphoglycan ppg4	0.668	221-224	RKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW41	Ribonuclease P/MRP protein subunit POP5	0.727	145-156	RKRSAAARQRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW58	Aspartyl protease	0.713	140-145	RRRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWY4	Trf4 polyA polymerase	0.885	281-310	RRRRQSEGERNRESSDRSRRRSASPHRRHS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWY4	Trf4 polyA polymerase	0.876	199-215	KKLRYGRKKAKEEREKM
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWY4	Trf4 polyA polymerase	0.813	229-255	RDEEKRRDGERSRSERRESDERSRRDR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX08	Proteophosphoglycan ppg4	0.645	396-402	RRAERRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX21	Uncharacterized protein	0.759	202-208	RRRRRGE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX42	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.9	335-350	KAPDKRVKRNKKGPNG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX42	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.791	133-145	GGRGRGRGRGGLG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX42	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.613	177-181	RGGAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXC2	Bi-functional protein secreted alpha-amylase/dextrinase	0.836	196-216	ERPSDKRVRTNSERHRRKFKI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXE2	FAD-linked sulfhydryl oxidase ALR isoform 2	0.627	14-16	RRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXY3	Transducin family protein/WD-40 repeat family protein	0.999	675-688	GKKKKKKKPKKPKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY73	bVLRF1 domain-containing protein	0.966	595-692	EKERREEEKRSKLRAREAERAEQERKREEEERRAEEGMREKARELAAASAGGSGPKRLGGGPPMPVRERERAGLSEEQKMRVMREERARAAEARLKRL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYS9	Uncharacterized protein	0.865	258-272	KRLQAAKKLRDKRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA6	Proteophosphoglycan ppg4	0.994	961-979	RRGRDGRRKKSKKRPEGKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZH2	B-related factor 1	0.936	515-528	KPINKRPRKKTKPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZH2	B-related factor 1	0.74	372-383	KPSAKALGKRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ2	Proteophosphoglycan ppg4	0.99	97-124	PPKKKAKGKGKEKAVEPEAPAAKPAKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ2	Proteophosphoglycan ppg4	0.988	163-184	SKKARRKQKKAEKAEKAEKAAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ2	Proteophosphoglycan ppg4	0.96	209-261	KKVTAPAASAPSKKRKRAESPAPPEAGPSRSAPATDSAKTPNATRDRKHKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ2	Proteophosphoglycan ppg4	0.909	450-463	GKKRRVRPSKAARK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ2	Proteophosphoglycan ppg4	0.907	854-862	KKKRKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ2	Proteophosphoglycan ppg4	0.772	38-46	KPPKSPKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZZ2	Proteophosphoglycan ppg4	0.651	1326-1332	GKGKVRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T074	Sperm nuclear basic protein PL-I isoform PLIb	0.995	297-312	PPKKKRKKAGKAKGRH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F3	THO complex subunit 2	0.996	1601-1722	RDRRSRDSRDADRGRQRSRDRAREKEREQEREKERERDREREKEREKEREKEKEKERERARSVESSHSSRASRGDARDSRESRRDDRHDSRSDRRDDRRDDRRDDRRDSRDDRRGADRDRRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F3	THO complex subunit 2	0.943	1775-1818	SDRAKLSREAEAREAEKEKQRERDRQREAQREKERKDERDRRVR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F3	THO complex subunit 2	0.902	1975-1998	GRESSSGRGDRGERGGGGRERSRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0F3	THO complex subunit 2	0.616	1836-1838	KPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0R8	Stress response protein NST1	0.999	883-1063	REAKKAKEAQKKKDKKKAEKLKKEEERLKKEAEREAAERAAKEAEEARLEAERQRNEEQRQKREAERRAREEEKARREERARLAREEERLKKEEKARQAKEAKAQAEKEAREKRQREEAERKAREAAERKEREERAERERKEREQREKEEKERKAREAAERKAKEEKDRAEKAAAAAAKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0R8	Stress response protein NST1	0.998	349-364	AKKKNKKKKKKERERA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0R8	Stress response protein NST1	0.993	32-45	TKPKKKKKAKAKRQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0R8	Stress response protein NST1	0.74	585-602	KPTRDHKNVRPAAVKKKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Z0	Putative NADH dehydrogenase subunit	0.801	310-316	REKRKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T162	Glycosyltransferase family 69 protein	0.995	1207-1251	KKKAGDDVPGGQKPKGKGAAKKDAAKKDGAAAKKDDGGKKREKRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1A5	Uncharacterized protein	0.883	1003-1012	AKKRKRRSSP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L6	Proteophosphoglycan ppg4	0.831	305-320	RMPKRTSTRRPGVKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L6	Proteophosphoglycan ppg4	0.808	279-289	KKRKGLKDRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L6	Proteophosphoglycan ppg4	0.63	1491-1496	RGARGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1U6	Glycerol-3-phosphate dehydrogenase	0.913	807-823	RRSERKAKRAGDKKSSP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T292	GAR domain-containing protein	0.627	743-746	AKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUT8	Hydrophilic protein	0.989	303-328	RREAEKKEKKSKKFAKKLQELRKKTK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUX9	Proteophosphoglycan ppg4	1	421-449	KRKRQKKIRKHKYKKRRKAQRAMRKRLGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI2	Extracellular metalloproteinase	0.983	852-870	KKEPKGGKGKKDRKDRQKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT0	Putative Zuotin	0.985	296-375	RIKAFRAAEKAAREAKRRGGAPGSAPVDPKVKAEEERKRKEEEEKAKAEQAAKEASDKADREAAKKAKAAAAKNVKKDKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT0	Putative Zuotin	0.964	261-284	KRHQEKKNKAERDRRKKEDNTRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT0	Putative Zuotin	0.82	126-141	KKAHRRKVLRHHPDKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVU4	MYB protein	0.999	472-486	KKPPKKKRKKRAPKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVU4	MYB protein	0.981	515-540	KRQKTASGTRGRGRGRGRGRGRGGEM
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY1	Proteophosphoglycan ppg4	0.981	680-712	AAEAKRAGKGKAPMRMAGKGPGKGKGLMPPPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY1	Proteophosphoglycan ppg4	0.901	780-799	PSKAPRKAGKMPAKQPRQRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY1	Proteophosphoglycan ppg4	0.872	1267-1309	KASPAPKVVAAKAPRAGLVAAKAPRSAAASKASKAPKSASSAS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY1	Proteophosphoglycan ppg4	0.822	904-913	VKPSKKKGKM
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY1	Proteophosphoglycan ppg4	0.771	1329-1337	KPAKVAKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY1	Proteophosphoglycan ppg4	0.697	612-621	AKKPPPPAPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVY1	Proteophosphoglycan ppg4	0.604	1311-1312	GK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW83	Proteophosphoglycan ppg4	0.961	510-525	SRRRRRERGRGGRGQG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW83	Proteophosphoglycan ppg4	0.682	398-403	KPRRRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWC6	Putative Cytoplasm protein	0.995	77-92	KAKKSNRKKKKKAAKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWC6	Putative Cytoplasm protein	0.716	120-127	KSKKAKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF0	BZIP domain-containing protein	0.874	39-54	WVVPPRPKPGRKSAKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF0	BZIP domain-containing protein	0.677	142-152	VGGKAGEKGKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF0	BZIP domain-containing protein	0.601	37-37	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ8	SDA1 domain-containing protein	0.988	346-371	INKKRKSTERKAKRDIRSANAKRKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ8	SDA1 domain-containing protein	0.969	919-949	KKRQSLHQKSRKMRNHVKHQKSGRRRNGEHK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ8	SDA1 domain-containing protein	0.961	685-701	KARKRRRVEAREAKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ8	SDA1 domain-containing protein	0.752	878-893	REKFGSHKHKKLDSKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ8	SDA1 domain-containing protein	0.618	901-903	KKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWK8	Proteophosphoglycan ppg4	0.991	489-525	KRHQQRRLRRQALPRRRSKAGPSRVRSGRREPVPARD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWK8	Proteophosphoglycan ppg4	0.811	902-911	VAKGKKTRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWK8	Proteophosphoglycan ppg4	0.642	884-886	RKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWK8	Proteophosphoglycan ppg4	0.613	288-290	KVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWY1	Mediator of RNA polymerase II transcription subunit 13	0.89	206-227	RAAKDKDGDASGPPAPKKAKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWY1	Mediator of RNA polymerase II transcription subunit 13	0.802	408-427	AEDGGKGKGKEAEDAKEKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWY1	Mediator of RNA polymerase II transcription subunit 13	0.789	842-856	ERKRKEREEQERAER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX22	Ribosomal processing	0.999	1063-1132	PKKKDGKRAKGKKGGNKKRKADDGESEAASASPKKRAKADAGGDEDKPAKEGSRIGSLIGRKRKMKKGRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX22	Ribosomal processing	0.995	18-67	PAKRSRGDGPSQRGGRGRGRGGGGGRGGGRGGHGGQRGPPREKKEPFKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX22	Ribosomal processing	0.992	500-524	GKEGKKKEVREKKKKEKESSGGGGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX22	Ribosomal processing	0.966	1021-1040	KRRAEKAERAREKARRAKER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX22	Ribosomal processing	0.886	230-257	AKKKLKEGEKPEGADKNWKVKGKAPAPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX22	Ribosomal processing	0.773	952-974	KLGKGLKAGEKEDRLKRLQEKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX22	Ribosomal processing	0.764	335-352	KKGKQIDWKKALKQRAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXL5	Double-strand siRNA ribonuclease	0.617	141-142	KR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY87	Uncharacterized protein	0.912	825-845	KKRIQQQQKRAQAARRKERKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY87	Uncharacterized protein	0.63	9-12	RRSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY89	Uncharacterized protein	0.99	327-338	KKPKKKKKRAGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY89	Uncharacterized protein	0.938	118-134	VKKQKKRAKELAAKRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY89	Uncharacterized protein	0.748	710-717	AKKKEKRL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY89	Uncharacterized protein	0.726	390-405	RREAAKQKIKELKARS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY89	Uncharacterized protein	0.698	68-83	KSRIDKARNQKERMRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY97	Proteophosphoglycan ppg4	0.818	90-99	KRRRRTKANR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYC9	Proteophosphoglycan ppg4	0.877	78-93	AASGSPAPSPKKRRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYC9	Proteophosphoglycan ppg4	0.646	348-351	KKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM5	Uncharacterized protein	0.972	700-731	EKKRKKIAETQRRKELDQLRKKIHGRRTKRSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM5	Uncharacterized protein	0.899	151-168	RAGRRPYGRRGAKKSVKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM5	Uncharacterized protein	0.829	55-66	RMRKGRTKKQKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZQ9	RING-type E3 ubiquitin transferase	0.949	799-809	AGRKKGKGKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZQ9	RING-type E3 ubiquitin transferase	0.632	52-56	KGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZV9	Uncharacterized protein	0.996	149-170	ASRASRRAEKEAKKKEKKKPRV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T070	Importin	0.975	241-289	RRSKRHRSSRHSSSRHHRSHRSSHRDSSRRDKDDKSRSRTRSPRRSSKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T070	Importin	0.946	199-226	KSRKSKSSRREHKSSSSRHHRSSRHKSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T094	ATP-dependent RNA helicase DBP3	0.994	60-75	KERRKREKKERKKRQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T094	ATP-dependent RNA helicase DBP3	0.969	97-115	AKADGERKSKKSKKNKNKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T094	ATP-dependent RNA helicase DBP3	0.776	17-26	RKADKKAKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0I0	Putative alpha-agglutinin	0.817	278-298	GKSHPGRLRERTRSSRRVRHS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0L4	Phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)	0.95	547-568	PKPKKKFRGWGPKIQHGVRVKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0L9	UDG domain-containing protein	0.955	99-109	SPRKRKKKPAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0L9	UDG domain-containing protein	0.631	265-267	RRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1K5	Uncharacterized protein	0.964	110-134	RLRAEKKELKRQRKAAIKARNALKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L8	Putative Microtubule-associated protein	0.975	676-692	GKHGGSKRKTKKKARAT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1L8	Putative Microtubule-associated protein	0.736	624-631	KGKKKSSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Q8	Copper transporter	0.948	408-427	SRRSDRSRRRRSPRSLARRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1S6	Chaperone regulator	0.954	243-256	RNFNKKRKTKKKGP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1S6	Chaperone regulator	0.683	178-184	KERVRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1S6	Chaperone regulator	0.677	221-228	KKRKMEEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1X2	Alpha-1,3-glucosyltransferase	0.985	95-117	RKARAARKAEARERRRRDKERAV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1X7	Putative Microtubule-associated protein	0.977	568-582	ARPISRKKRSKKKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1X7	Putative Microtubule-associated protein	0.683	1261-1268	SKKLKTRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T217	Proteophosphoglycan ppg4	0.995	291-322	REAERRAKERERQARREKKAGRKLGRSEAAAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T270	Uncharacterized protein	0.859	19-31	KRKKRPAAARAHH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T270	Uncharacterized protein	0.619	98-100	RKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUS1	Pirin domain-containing protein	0.993	526-564	GRKKRAKEDEERRKEERRRAREAGSSSPVKKGSPLKKLA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUS1	Pirin domain-containing protein	0.96	756-768	EKVKKKASPKKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUS1	Pirin domain-containing protein	0.892	605-632	KMREAMLAEARKGKGKAREEPAASTSPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUS1	Pirin domain-containing protein	0.892	841-871	KGKRPRPSDGVSDLEKEKPRRVKSLRGQKRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUS1	Pirin domain-containing protein	0.75	807-824	AKATAHSRPKQIKRTRMP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUS1	Pirin domain-containing protein	0.642	736-741	KTRKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF2	Eukaryotic translation initiation factor 3 subunit E	0.987	231-256	KYGTGKEREGERRERRRKAGKAERMR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF2	Eukaryotic translation initiation factor 3 subunit E	0.942	714-745	RRPLVDRLGPAQKRQRRESKPPGPPAPPPKGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF2	Eukaryotic translation initiation factor 3 subunit E	0.812	76-92	RIKRRRSISPGGPPRGP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB4	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.939	312-338	TAKGKGKEGSVPKRNTRELHKLRKRKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB4	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.633	460-463	RGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG5	Proteophosphoglycan ppg4	0.843	52-64	KTARLRRKRAHPS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG5	Proteophosphoglycan ppg4	0.737	514-525	RRRGRGGAARAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG5	Proteophosphoglycan ppg4	0.669	103-116	PRRRAQETGRVRKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXM1	ORC_WH_C domain-containing protein	0.865	652-663	KGKQANGKKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY26	Proteophosphoglycan ppg4	0.64	678-684	KRRTEAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYH2	Proteophosphoglycan 5	0.997	424-470	GGKNGRKLTHEESERERRRKEREERDKRGRGERGMERMKKREERERK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYH2	Proteophosphoglycan 5	0.63	254-258	RIRRD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYT1	Uncharacterized protein	0.657	53-57	RKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ86	Mediator of RNA polymerase II transcription subunit 5	0.611	222-224	RGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD2	Proteophosphoglycan ppg4	0.983	1048-1075	GKRVRKPTAPKLAMSPKAPKKSQAKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD2	Proteophosphoglycan ppg4	0.866	645-660	DKKKDSKKERERAAAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD2	Proteophosphoglycan ppg4	0.858	995-1003	KRQPKKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD2	Proteophosphoglycan ppg4	0.793	1418-1427	SKARQRRKPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD2	Proteophosphoglycan ppg4	0.786	948-965	RPKAPTPPPAPGPRPKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD2	Proteophosphoglycan ppg4	0.772	1302-1309	RRPRRKVR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZD2	Proteophosphoglycan ppg4	0.747	385-396	GRVEKDKAKKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZE5	Membrane protein	0.894	1018-1046	KGKGKGKAKEAEGAAPASNDRAQPKKGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZL8	Putative Endonuclease	0.925	90-104	RPRVQKAPKKKRPSA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZL8	Putative Endonuclease	0.891	1025-1035	AKGKRQPKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZL8	Putative Endonuclease	0.863	177-188	GKGKGKGKGKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW0	Ribosomal RNA-processing protein 8	0.615	35-37	KRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0A3	Putative Microtubule-associated protein	0.85	403-414	KQKMERRRKKEE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0T0	Serine/arginine repetitive matrix protein 2	0.958	50-61	SGKKKAAKKKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0T0	Serine/arginine repetitive matrix protein 2	0.954	119-132	SKKKGKKAKSAAKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0T0	Serine/arginine repetitive matrix protein 2	0.668	268-274	NAAKKSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0U3	Nucleolar protein 58	0.999	514-546	ERAARKKAKKEKKRAREEEDGSPKKKSKKSKTR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0U3	Nucleolar protein 58	0.997	482-502	RKKREKKEKKERRKSEKAAGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T147	Ubiquitinyl hydrolase 1	0.869	431-451	KPKTPGLGAGKEKEKEKPKGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T155	Surface antigen protein	0.761	472-482	RLRRRNRRSIR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T171	Proteophosphoglycan ppg4	0.804	821-828	KKKKAKIE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T189	Proteophosphoglycan ppg4	0.916	183-239	RWKKVEKSRKGREAPARTMTTAKGEQGEKTGAKGKVLSRARQVAVPAPKEELRRKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H6	Acetyltransferase	0.999	652-706	KARKEKEEAEEKARKEAEEKEVAAAAAGGKKDKKKGKGKKPADKPATEEPAKKEP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T233	Proteophosphoglycan ppg4	0.931	805-821	RKARKIAKRRQREEERR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T233	Proteophosphoglycan ppg4	0.888	232-256	RKSIKRGAEDKRDELLKKGVKKGRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2D8	Spliceosome associated protein	0.905	566-584	KRRRIADKKKSESAKEKFK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2D8	Spliceosome associated protein	0.889	24-37	KSRGQLKRLKKKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2D8	Spliceosome associated protein	0.65	139-144	RKQRKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUH2	40S ribosomal protein S2	0.994	9-33	GGFGRGRGGDRRGPRRGPRRGARKD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUL8	Proteophosphoglycan 5	0.819	2010-2027	KIPRRAGMRIRKTIRRVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUL8	Proteophosphoglycan 5	0.799	1949-1964	KRGSKGVGLGRRRRVL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUL8	Proteophosphoglycan 5	0.759	2664-2672	SRDRKGKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUL8	Proteophosphoglycan 5	0.723	2180-2195	RHRHLPGRKHLHGQKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVC0	SNARE protein syntaxin 18/UFE1	0.606	363-365	KAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVN1	Proteophosphoglycan ppg4	0.826	115-136	KNKRDGKDGKRDKGNQGGSGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW3	Cell wall surface anchor family protein	0.638	1410-1413	RRKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW3	Cell wall surface anchor family protein	0.625	1419-1422	RRAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWH9	Putative HLH transcription factor	0.982	440-456	GKKKKGKGTGRGRGRKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWH9	Putative HLH transcription factor	0.948	259-284	SRGTRRKSRGGPAAGTGREKKPRTGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWH9	Putative HLH transcription factor	0.608	321-324	RNAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX93	ISWI chromatin-remodeling complex ATPase ISW2	0.931	147-157	SKKRKGKGKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXA2	Ribosomal_L18e/L15P domain-containing protein	0.965	80-112	SRKRVGRGRGSGLGKTSGKGHKGQKARSGNGKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXA2	Ribosomal_L18e/L15P domain-containing protein	0.679	287-292	GKRKLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXD9	Proteophosphoglycan 5	0.998	363-414	EPRKGPKRDRKAERRRAEMRRKMGLKPRASIDKALGVEGDGRKARRSGRATA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXL0	DNA-(apurinic or apyrimidinic site) lyase	0.995	313-330	GAKKGSVKGKGRKKRKKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXL0	DNA-(apurinic or apyrimidinic site) lyase	0.817	374-383	GKRRSGRKRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXL0	DNA-(apurinic or apyrimidinic site) lyase	0.815	11-25	RKKLEGIAKGKRIKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXL0	DNA-(apurinic or apyrimidinic site) lyase	0.789	261-269	RWGKGKRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXM6	Uncharacterized protein	0.961	637-653	VRRDKGGGKRRREEKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXM6	Uncharacterized protein	0.91	339-352	RGKKGVKRELRKKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXQ9	YL1_C domain-containing protein	0.988	118-157	KRLQREAKEAKKAERTKKKKGFQAPVHPFARQTKAARKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXQ9	YL1_C domain-containing protein	0.837	298-312	KGKGKEEKMEKGRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXQ9	YL1_C domain-containing protein	0.711	183-187	KKKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXU3	Proteophosphoglycan ppg4	0.874	668-688	GKSKSGKGGKGKTGAGNKANG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXU3	Proteophosphoglycan ppg4	0.737	271-276	KKRKKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXU3	Proteophosphoglycan ppg4	0.631	801-803	KRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXZ7	Putative Diaminopimelate decarboxylase	0.806	423-444	KPGRQPRDLPPPPRPPSPRRPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY35	tRNA-splicing endonuclease subunit Sen34	0.984	120-148	LHRDKIEKKRREKEELRRKREEEAQAKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYX5	Proteophosphoglycan ppg4	0.67	994-998	KRRAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ27	Putative Kinesin K39	0.675	277-285	RGRRGGQGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZG9	Histidine kinase	0.675	1012-1019	RRSARKQK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZR2	Proteophosphoglycan ppg4	0.969	577-588	GRSGKKRGKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZR2	Proteophosphoglycan ppg4	0.883	1456-1476	RPKVKPASSAKDRREGRGGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T077	WD_REPEATS_REGION domain-containing protein	0.777	239-247	RRSKGRRKT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T077	WD_REPEATS_REGION domain-containing protein	0.69	188-192	RRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0H7	RING-CH-type domain-containing protein	0.684	539-547	RRKDSRRIV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T130	Proteophosphoglycan 5	0.671	844-851	AKRTTRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C4	Proteophosphoglycan 5	0.977	514-547	RLWNERNRMKRRGGKRGRSGTAGADREAGLSNKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1M6	zf-LYAR domain-containing protein	0.992	130-142	PAKKKKKKSKKSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1M6	zf-LYAR domain-containing protein	0.708	99-105	EKKRARE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1M6	zf-LYAR domain-containing protein	0.607	52-53	GK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T241	Uncharacterized protein	0.942	668-692	SDRRAARRAAKHRRQESRNSSKSRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T241	Uncharacterized protein	0.883	2328-2345	KHEKKHRRDWSRRKSTRT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T241	Uncharacterized protein	0.647	340-348	AAKPSPPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB6	Uncharacterized protein	0.99	377-407	ARMKARSRKGKLKASEWYRGRGKRGLKKRPQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG1	PINc domain-containing protein	0.752	1249-1277	KARRRQLKAIIRQARSATRSSGKASLKVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG1	PINc domain-containing protein	0.739	355-362	GRQRRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG1	PINc domain-containing protein	0.681	300-308	SRRPARSKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUG7	Proteophosphoglycan ppg4	0.911	591-615	PKPAQANSKSPSKTTPKRKRGSPTK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUH0	Phosducin domain-containing protein	0.866	402-417	PPPRRRRLPPPPAKGI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUH0	Phosducin domain-containing protein	0.722	627-634	AKKGKGKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVS0	mRNA export factor elf1	0.919	103-119	FKAAKGRKKLTRKQLKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW15	Complexed with Cdc5 protein Cwf19	0.923	831-847	RKWRKPRRLDRRDNPKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW15	Complexed with Cdc5 protein Cwf19	0.886	509-518	RKAKGRRGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW15	Complexed with Cdc5 protein Cwf19	0.813	13-48	KKHSRSSHRDDRDSKRHRSSRDEASSKDKDRHKSSG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW15	Complexed with Cdc5 protein Cwf19	0.647	283-287	RRKSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW30	Putative Nucleus protein	0.955	131-159	PKEHKVRKKLEKYKPALDKENEREKRRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW30	Putative Nucleus protein	0.889	618-644	NAKKGDKKLSKKQLYLLKKEELKRKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW30	Putative Nucleus protein	0.619	582-584	AKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW37	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.938	355-369	GKGGKGKKRGRNGEP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW37	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.921	128-184	KLSGAQKKALAKQRAQEQWEAKKKAKAEAKAAAAAQAGQDGEGEGKKKLKGQNKNRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWF7	Ribosome biogenesis protein YTM1	0.919	277-284	RKKKRRKQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWG1	Proteophosphoglycan ppg4	0.993	371-405	RAARRAIRQAKKQHRAARRLEKAQRKLERRAKKER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWM4	RRM domain-containing protein	0.992	223-314	RRAKIEEQRKKLNTEREKAAKNKRLKEGESEDGNKTGRWKLAAEKQKEGGEGAEGAPEASGEAKGAKGGKKVRDRRLKPGAQKDEAAKQKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWM4	RRM domain-containing protein	0.987	93-111	PKKKKRQRGKTKAQREREA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWM4	RRM domain-containing protein	0.955	11-30	RKLTKREKKALEFRAKKKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWM4	RRM domain-containing protein	0.794	65-72	KGSKKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWQ9	U3 snoRNP-associated protein Rrp5	0.928	122-135	KDKGKAKRRKLERA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXD0	SUN domain-containing protein	0.976	304-326	PRGIRDGEIWYGKKRKGKRGSRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXD0	SUN domain-containing protein	0.959	281-299	KRRKSKGKGRASTGGRSAL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXD0	SUN domain-containing protein	0.954	181-196	KAPASAGKKRKKHAPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXE1	Nucleolar protein NOP2	0.997	62-126	GGKAHPGAPERKGKRKLVAEAKGERAQGPRATKRAKKVSEGGAEVKGKGKAKAGKGKAKADQKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXE1	Nucleolar protein NOP2	0.987	721-747	RRKIAKRKGLNPKADKSKAGKKARVEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXS2	Uncharacterized protein	0.944	338-365	EKQKEEEEKAKKEEEEKKKEEQKKESKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY44	Transcription initiation factor tfiid 55 kDa subunit	0.943	189-203	KHVRKRRFRRRANRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYH1	Putative ATP-dependent Clp-type protease	0.979	200-214	AKPKKGKKAARKEKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYH1	Putative ATP-dependent Clp-type protease	0.772	244-255	EAKPAKSSRRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYH1	Putative ATP-dependent Clp-type protease	0.628	231-234	APKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZF0	Dihydrofolate reductase	0.91	258-289	AAASPKPEEPKKAEPKKAAPVSPAPASPAPAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZF0	Dihydrofolate reductase	0.905	223-241	RLKRERLEAWKKKKAAEAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZF0	Dihydrofolate reductase	0.728	67-84	RRRDRDGGSDGRRRDRDR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZN8	Proteophosphoglycan ppg4	0.748	259-266	LRSRRRKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T066	Proteophosphoglycan ppg4	0.975	119-152	SPKPAKPAPQPRRRSTRTKKATAAASAKEARSKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T066	Proteophosphoglycan ppg4	0.959	191-209	APKRKRSKASKPGHIPRPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0P2	Proteophosphoglycan 5	0.745	71-78	RRKGRPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q6	RAD26-like SNF2 family DNA-dependent ATPase	0.987	81-122	KEEKAKRRELVKDLKKRGEEIPAELKKPIKGKKQAKGAPAMK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q6	RAD26-like SNF2 family DNA-dependent ATPase	0.98	17-46	PRSSPSPPRRRKKRSPPSSESEGGGGVGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q6	RAD26-like SNF2 family DNA-dependent ATPase	0.927	514-544	KRREAEDQKRKEERRRETQAKIADERKKKMA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q6	RAD26-like SNF2 family DNA-dependent ATPase	0.92	1364-1381	RGRKKAAPGPSPSKKVKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q6	RAD26-like SNF2 family DNA-dependent ATPase	0.649	1341-1344	KGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q6	RAD26-like SNF2 family DNA-dependent ATPase	0.617	232-234	RRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T195	ABC transporter	0.702	362-368	RRARRKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1S0	Uncharacterized protein	0.802	473-487	SEKKLTGRQRARRKQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1S7	Proteophosphoglycan ppg4	0.767	103-112	PQPPPRKRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Y6	Proteophosphoglycan ppg4	0.975	339-422	PPPSGRRSSYPPPPARQRQRYDDRPRGPPNNRDARSPPPPRNNPGPSQPRSYDRSRRPRTPDRRPATPPHSWPHKRGPRRTPSP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Y6	Proteophosphoglycan ppg4	0.778	776-786	ARRQGAKKPKI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T271	Proteophosphoglycan 5	0.932	693-748	PRAKEMREDLKPAAEREREQRRRQLELAKARRKSQAGTGVGLSRRRPSLGVGPKPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T271	Proteophosphoglycan 5	0.892	990-1026	RAGEKGRERAMAGEVESRARKVRATKEARARFKVGEG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T276	Sas10 domain-containing protein	0.961	511-527	RAQKAKKAKGKGASKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T276	Sas10 domain-containing protein	0.911	717-743	RKILSNRGLTPKRNKLNRNARVKKRHQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T276	Sas10 domain-containing protein	0.611	684-686	KAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T276	Sas10 domain-containing protein	0.605	598-599	RR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUJ4	Impact family protein	0.996	172-202	KPKSPPKPVKVIKGAKRGRKRGGSSRDKLLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV63	AMP-binding domain-containing protein	0.667	261-265	RKGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV75	GTP binding protein	0.996	1125-1187	KDAKRKEAKQARKVERAKKLAKEDEKRGEREKKEKQEFFAAQGRAEKRKAEGGRFANKKRKRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV75	GTP binding protein	0.979	10-40	AHRPAKAPKKGPEKGKNPKAFTSASFRRAEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV75	GTP binding protein	0.692	196-201	KKRLKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB9	Golgi apparatus membrane protein TVP38	0.997	89-113	KKKQKKRRKSDKGGAEGSEKKKRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWL9	RNA binding protein	0.986	152-181	HKKARLERKKQSRRDDPARRKKLAAKAAAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWZ3	Uncharacterized protein	0.991	186-201	KGRRRKRKGKTAGRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWZ3	Uncharacterized protein	0.889	888-900	AKKPVRKGKGKER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWZ3	Uncharacterized protein	0.712	621-629	RKRRVHRTK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWZ3	Uncharacterized protein	0.707	707-713	THRRKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXA8	DNA-directed RNA polymerase subunit	0.897	1448-1459	RGKKEGKRRGGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXA8	DNA-directed RNA polymerase subunit	0.782	1234-1244	KQRLLRPKKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB0	Uncharacterized protein	0.915	101-122	RLREEEERRRREEEEGRRRRRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB0	Uncharacterized protein	0.806	218-232	PKIFKSREDRKKRDG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB0	Uncharacterized protein	0.777	342-367	SSRSKPESPKSPRTRSRTDMPERRHS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY15	Conserved oligomeric Golgi complex subunit 1	0.898	98-112	PARLKRGHARKRPGQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYN8	DIS3-like exonuclease 2	0.872	648-659	KKDKEEKKRRKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYN8	DIS3-like exonuclease 2	0.674	81-91	HGRRSSRGGGH
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ05	ATP pyrophosphate-lyase	0.856	100-121	EKEPPVKEKKRGLFGGLLKRRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ13	Branchpoint-bridging protein	0.847	864-885	RVGTGARPGAKGMGTRRRVRRW
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ13	Branchpoint-bridging protein	0.776	254-275	RESGARISIRGKGSVKEGKGRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ13	Branchpoint-bridging protein	0.728	809-826	KKPLAAIAGPLSKPKKIG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ14	Proteophosphoglycan ppg4	0.641	121-125	PPKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ14	Proteophosphoglycan ppg4	0.626	93-95	RKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ44	LuxR family transcriptional regulator	0.803	288-298	KKTKKPKSGAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ56	Proteophosphoglycan 5	0.742	473-481	LRKRPEKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ73	DnaJ and TPR domain protein	0.971	357-392	AREKKAQDEKEREEREERRRREQEEREERRRRAKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZF6	3'-5' exonuclease domain-containing protein	0.91	873-885	PKAKKPKKDKAQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZF6	3'-5' exonuclease domain-containing protein	0.886	831-840	DKPKKRRRQE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZF6	3'-5' exonuclease domain-containing protein	0.857	917-931	EQDKRQRKKEAKAEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q0	Pex14_N domain-containing protein	0.935	467-505	RRRDGGLSRPNGRATSARAKRSQARLASQKKKRVDAPAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q0	Pex14_N domain-containing protein	0.839	127-139	AARPRDPKAKKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q0	Pex14_N domain-containing protein	0.63	516-520	KLKRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q0	Pex14_N domain-containing protein	0.62	1332-1339	KAGAGGKN
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T150	Proteophosphoglycan ppg4	0.918	9-23	PRKKAGKATGAKKKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T150	Proteophosphoglycan ppg4	0.63	480-483	RRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T172	Proteophosphoglycan ppg4	0.915	497-511	KKGRRGRQRTRKASA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1M3	Uncharacterized protein	0.983	740-761	RPSKRSGNDADKRDKKKRKERR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1M3	Uncharacterized protein	0.724	813-825	GRKRGERNSRSSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1N4	Proteophosphoglycan ppg4	0.615	745-747	RRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1U2	Putative Clathrin-coated vesicle protein	0.773	1147-1154	APKKKKAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1U2	Putative Clathrin-coated vesicle protein	0.633	489-491	RKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T273	60S ribosomal protein L6	0.696	55-65	KAKASRKSVKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB7	Autophagy-related protein 4	0.921	575-596	RKKKSLSSLGRKGKSPVKARKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB7	Autophagy-related protein 4	0.708	329-342	GEGRLARGLRKTRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB9	FK506-binding protein	0.965	240-285	NQKKKLAKKQKAENGEAVAPAAEEKKAVEPKKAEAKKEEPKKETRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB1	GTPase subunit of restriction endonuclease	0.878	565-573	GGRKRRRKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB1	GTPase subunit of restriction endonuclease	0.786	734-742	KKKRKNASK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL7	RNA binding protein	0.844	792-800	LKKRKGKGS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL7	RNA binding protein	0.759	521-528	KKAKKRIE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL7	RNA binding protein	0.671	254-259	KKKFKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVL7	RNA binding protein	0.653	497-503	KKEKERR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVU5	Proteophosphoglycan ppg4	0.786	72-79	KPKRKRNR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWK7	Shy11	0.634	68-71	PKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWR7	Glutaredoxin	0.869	6-31	RGRGRAWRRKREETQAAGDGAARRRQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWR7	Glutaredoxin	0.836	490-497	KPRRRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX36	Putative dCMP deaminase	0.822	78-94	RRSRSTNPSPKPRKRVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX43	Sip1/TFIP11 interacting protein	0.839	424-449	KIRRKGEGIKSGERSKGALLEERRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX43	Sip1/TFIP11 interacting protein	0.786	482-489	AKPKKEKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXM7	Serine/threonine protein phosphatase PP2A-associated protein	0.907	162-172	LRTRRRKRRTR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXW5	Proteophosphoglycan ppg4	0.992	434-477	PKKKPKRPAPTVKKARGRPSRGQDDEPEPAAQRPVSRASGKRKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXW5	Proteophosphoglycan ppg4	0.953	556-583	PAPPTPKKRGRPPKQDAEASPTKKSKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXW5	Proteophosphoglycan ppg4	0.907	796-811	VKAKPASQAKKKGRKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXW5	Proteophosphoglycan ppg4	0.864	1109-1127	GPASGRKKSSAGTKRKSAA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXW5	Proteophosphoglycan ppg4	0.619	503-505	RRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXY6	Proteophosphoglycan ppg4	0.999	337-370	KEQKKREKAEKKARKEAKRAKESGASPKKKKVKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY28	Proteophosphoglycan ppg4	0.793	146-154	ERKRRRHLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY77	CnHHK4 protein	0.916	874-888	QRREKKRERERQREK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYY7	Phenylalanyl-tRNA synthetase beta subunit	0.79	60-69	GRHGRIRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYY7	Phenylalanyl-tRNA synthetase beta subunit	0.613	141-142	KR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZM5	Vitellogenin	0.998	178-193	LAKLRKRKKRNRRKSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZM5	Vitellogenin	0.653	159-163	LRKKL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T053	Proteophosphoglycan ppg4	0.997	405-454	KEEEAKKAKGARGGKRKKAGAAADDAAVPSKRKAPAKRATGKGKGKGKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T053	Proteophosphoglycan ppg4	0.985	192-216	KAERERLKQRKKEEKERKAKLAGKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T053	Proteophosphoglycan ppg4	0.618	509-513	KARAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0A4	WD-repeat-containing protein	0.999	334-361	RKKLARRRKREREKKEKGKAGKGKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0A4	WD-repeat-containing protein	0.701	276-282	PKKKLKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0W4	Putative Transcription factor iiia	0.998	250-262	GKKKRRRRHKKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0W4	Putative Transcription factor iiia	0.795	312-319	HGGKKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T137	Proteophosphoglycan 5	0.701	1428-1434	GIRRHKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T0	DUF1767 domain-containing protein	0.742	403-416	KRRKTAGSASSKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T0	DUF1767 domain-containing protein	0.674	119-127	KKEARRVRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T261	Vacuolar membrane protein	0.823	62-73	KRMREKPRRKWK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVB8	Glycosyltransferase family 49 protein	0.698	129-134	KKGKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVJ1	Uncharacterized protein	0.815	408-421	RARAKKIGHKGDKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW7	Glycosyltransferase family 90 protein	0.786	63-76	SRPARKDRSRSRER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX24	Ribonuclease H	0.959	61-73	KLEKGKAKKRRKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXH1	GTPase activating rab protein	0.99	805-831	SRRRKEGDKAVDKPSEKAKKLKKKGSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXH1	GTPase activating rab protein	0.731	952-961	KRQKKLAKLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXI9	Uncharacterized protein	0.962	532-556	RTKPPKPPKPPRRTAEARAEREAAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXI9	Uncharacterized protein	0.779	595-606	ASRGDGRRGRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXI9	Uncharacterized protein	0.68	472-479	KRDARRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXP1	Uncharacterized protein	0.979	104-134	VRKKGKARAGTSTRARKSGSTKSGKGKGRAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXP1	Uncharacterized protein	0.849	161-171	LKKRAAKGRKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXW0	Uncharacterized protein	0.868	327-339	RRRRRRLSPGPPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXW0	Uncharacterized protein	0.652	791-796	LKPKSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY17	Proteophosphoglycan ppg4	0.757	1053-1074	RRPVSIAPRGSPAADKRRPSTR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYA8	Putative Nucleoporin	0.736	36-51	RKGARRSSGPASGKPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYH9	Glycoside hydrolase family 63 protein	0.705	109-121	KRRGAGGARGGSS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ5	WD repeat-containing protein	0.953	60-78	GGKRKRARVDRKDQKGKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZT0	Proteophosphoglycan 5	0.938	415-426	RSAKDRKKRRRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T062	Putative Cyclin binding protein	0.851	2021-2038	LKKARWEARKRQRETQRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T062	Putative Cyclin binding protein	0.833	111-119	PRKRRRNAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T062	Putative Cyclin binding protein	0.74	2115-2124	RRRQPRRQPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0A9	Proteophosphoglycan ppg4	0.999	475-522	VRAEIRALERKGIEAIERKEKKKRERKEREKKLREDVGKKRDELKDKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T127	ATP-dependent RNA helicase dbp-4	0.977	722-736	RQKEKRQEKKRKRRD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T1	Aldo-keto reductase	0.995	370-405	KGAKGKAGGAKGRKRVGDTYGAGPRKKARKSKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T264	Uncharacterized protein	0.883	216-227	TKRKRERPAKLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T264	Uncharacterized protein	0.857	165-173	GRRRRKKVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T277	Deoxynucleotidyltransferase	0.971	359-400	KRKTKEVMSKTMSGRKRQRKGAKGSYAMGASGNGREKKKRAL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T277	Deoxynucleotidyltransferase	0.814	107-123	EAARERAQKAKESKGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T277	Deoxynucleotidyltransferase	0.619	237-239	KGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUC3	Plus agglutinin	1	251-305	RRKLQKQEGIVERRKGRIRREMRRALGGERGEGKVGKGKKEKEGKKRRKGKKRAS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUP1	Putative Pseudouridylate synthase 4	0.94	54-71	KGWKKGKQGRGRRANKVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV15	Proteophosphoglycan ppg4	0.942	283-298	KKPKKKDLKKEQAKKV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV15	Proteophosphoglycan ppg4	0.636	663-673	KKAADKDRLRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV53	Non-specific serine/threonine protein kinase	0.963	727-746	RSGKEGRKGSAKKAGPKSRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV53	Non-specific serine/threonine protein kinase	0.64	652-655	PRKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW20	Uncharacterized protein	0.9	190-208	RVKRRGGTGLHKAVRRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW25	Serine/arginine repetitive matrix protein 2	0.864	193-201	SRSKKRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWH8	Proteophosphoglycan 5	0.871	91-119	GAAKKGAKRGAQADKVALDKDGNPKKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX80	TatD DNase family Scn1	0.946	343-359	RPKPKLSNREKKRERKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY52	EVE domain-containing protein	0.998	252-273	RGKKGGKKGAKGKGKRKEKEES
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY52	EVE domain-containing protein	0.96	279-299	GGEEKGEKEQMGRRSKRAKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYE4	Condensin complex subunit 1	0.99	1359-1393	KKVAKSRRRGAAAPKAAAAAPARRAARRAKARSET
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYE4	Condensin complex subunit 1	0.988	573-592	PKKRKPLKGKGKARASAPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYE4	Condensin complex subunit 1	0.873	191-208	TGRGKKSAASKSKSKSKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYE4	Condensin complex subunit 1	0.645	1016-1020	RRKAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYE4	Condensin complex subunit 1	0.609	1023-1025	KAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYG5	50S ribosomal protein L22	0.841	242-257	ERRREKKQEQWRKKIR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ22	Proteophosphoglycan ppg4	0.638	317-319	KRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ55	Proteophosphoglycan 5	0.997	326-374	KSRREKPPPLPRTSSATAFPPSPRKSPKKKHTIPRRRRERHGDKSSPPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ55	Proteophosphoglycan 5	0.966	210-272	PRSPQPPKSPRKTRSPHHPAWPRRHPFKRSTTETTIRASPRKSPQRSPRRTPHPPGSPSKTRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW5	Proteophosphoglycan ppg4	0.923	664-678	RLRLRREAVRRRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW5	Proteophosphoglycan ppg4	0.803	430-447	AAPPAPPKSPLKPRPPPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW5	Proteophosphoglycan ppg4	0.711	154-160	RKAKGKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW5	Proteophosphoglycan ppg4	0.697	718-723	RRRRRT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0A0	Kinetochore protein SPC25	0.929	312-325	REKERRKARERRER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0P8	Vacuolar fusion protein MON1	0.886	1296-1312	VARRLLRKKRSMTKKEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0P8	Vacuolar fusion protein MON1	0.856	149-169	EGRTRGARGGQAKGAGKGKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0P8	Vacuolar fusion protein MON1	0.675	873-877	RRRPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T108	DEAD/DEAH box helicase	0.993	886-920	SKKDKKAAEDDGKKKKGGAKPGSKAAQAAKKDATA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T108	DEAD/DEAH box helicase	0.757	1389-1403	ARAKAAEKAAAKKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T108	DEAD/DEAH box helicase	0.71	633-639	KKKRDRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C6	Structure-specific endonuclease subunit SLX1	1	413-470	GRKKASPKKRGRKKKAARASDAEKPAKKSRARAGAKVKKTPTKTRAATSKKGKGKAKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C6	Structure-specific endonuclease subunit SLX1	0.937	373-393	RRKEESEGRRKKRVRQMVRKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C6	Structure-specific endonuclease subunit SLX1	0.923	561-584	KSRAKKAISSPAPASPKRRGRQPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C6	Structure-specific endonuclease subunit SLX1	0.661	667-676	KAASPKATKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H3	Proteophosphoglycan ppg4	0.997	194-238	KTKSFGGRKTKVPATNGKASGKTNGKKRPAAKKKASTKPAAARRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H3	Proteophosphoglycan ppg4	0.995	69-98	IEQKGKKGVGKKGGKAPAKSKAPVAKKARA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1R4	Uncharacterized protein	0.732	50-59	SRAPRKREQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1S2	PH domain-containing protein	0.779	203-214	KRGERRKTWKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T235	Uncharacterized protein	0.987	193-221	EKPAKGKKRMISGAKKEDKPTSKRRRVKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T235	Uncharacterized protein	0.75	150-166	LRKEWEKEKKEWLKSRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUS4	Mediator of RNA polymerase II transcription subunit 17	0.897	4-13	PWRKRGRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV42	Structural maintenance of chromosomes protein 4	0.996	511-528	RKRKGKGKAKGKKTARKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV42	Structural maintenance of chromosomes protein 4	0.797	292-301	AKSKAKGKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV42	Structural maintenance of chromosomes protein 4	0.716	232-237	SKRKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV88	Uncharacterized protein	0.909	177-204	RRHGVKHRFHVGGKRHSHARSRSARKLK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVG0	DRIM domain-containing protein	0.994	2531-2568	AKRKAKRAEQKKTQKKRKAASMASQKERYGVGAKRRRE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVQ2	Ribosome biogenesis protein ERB1	0.962	337-376	KSRFLPSKWEHKKVMRIVRAIRAGRITPRRPGAPKPPEKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVT6	Uncharacterized protein	0.833	629-642	RIRTVKKTGKGKKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW53	WD_REPEATS_REGION domain-containing protein	0.995	117-181	PVYRRHSPGPPRGYGPPGRGRDFSRSPPPPSRRYPSPGPPSRRRSRSPPPPGYRSRRRSISRSPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW53	WD_REPEATS_REGION domain-containing protein	0.97	212-271	KARRASHADSGGRARSRTPLSPSPPASRGRSPSPFSGPPSRRRSPSPRGGSYRHRPRSPS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW53	WD_REPEATS_REGION domain-containing protein	0.862	1779-1790	GKEPEKKTKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW53	WD_REPEATS_REGION domain-containing protein	0.815	1736-1747	GKEAPKAKGKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW53	WD_REPEATS_REGION domain-containing protein	0.653	1716-1722	KKAGKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW53	WD_REPEATS_REGION domain-containing protein	0.605	1819-1820	RK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWM1	Uncharacterized protein	0.848	387-401	ERERRRKRVEEANRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWS2	Proteophosphoglycan ppg4	0.944	49-75	EEEKRARTLDSKRRWARKHRAGGGDVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWS2	Proteophosphoglycan ppg4	0.938	531-554	GRRPRRGRSISPSSQKGGRRRGGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX72	Translation initiation factor IF-2	0.982	124-199	RKAAAARGIKESALRGPGAGGPGGPRFGGPRPGGPGGPGGARFGGPRRGGQGAGPGGAPNPYAPVRRPPRKSFKPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX92	KRR1 small subunit processome component	0.984	383-394	AKEKKKKRKREE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX92	KRR1 small subunit processome component	0.965	261-274	PKFRRRREKKRGPP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX92	KRR1 small subunit processome component	0.768	300-308	AKKQKKEKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX92	KRR1 small subunit processome component	0.679	344-349	EKRKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB7	Uncharacterized protein	0.908	12-31	RKAQRKAELKKNKQRREQAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXB7	Uncharacterized protein	0.697	273-292	PLPPPPGAPTGPRHPRLPAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXG8	T5orf172 domain-containing protein	0.897	358-388	GKKSSGKDPIKAVAARRTPISTPSPRRRRKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXU4	Inositol-pentakisphosphate 2-kinase	0.927	42-52	RLRKRKKRAGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXY7	Putative Mannitol-1-phosphate dehydrogenase	0.956	396-411	RRCRRFRRSTRRRKRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXY7	Putative Mannitol-1-phosphate dehydrogenase	0.786	1895-1911	RQSEGRPRRLPPPAKAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXY7	Putative Mannitol-1-phosphate dehydrogenase	0.743	1381-1412	ERRRQQREEDEQRKQREKEERAAQIPRERIKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY25	DNA-(apurinic or apyrimidinic site) endonuclease	0.931	447-456	APKKKRAKKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY25	DNA-(apurinic or apyrimidinic site) endonuclease	0.73	116-122	RKRPRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY78	Proteophosphoglycan ppg4	0.85	482-499	KKVPKSLQRRIERARKRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYB1	SMC hinge domain-containing protein	0.643	127-131	PKKIK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ68	Peptide-binding protein	0.985	101-115	GKKKEKKEKPKEKKP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ68	Peptide-binding protein	0.871	166-193	REEREEREKEEAEAKAKSASPASGKKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ68	Peptide-binding protein	0.759	252-258	PKKKKAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA3	Uncharacterized protein	0.951	528-539	KRNKKRKKAGSG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA3	Uncharacterized protein	0.907	401-413	WKKARKEKKAGVR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA3	Uncharacterized protein	0.869	566-580	HAKKKRKVEEETKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA3	Uncharacterized protein	0.797	627-635	KRKDRKGKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA3	Uncharacterized protein	0.65	482-486	KRAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA9	Proteophosphoglycan ppg4	0.991	491-513	RNSNKKEKSRGKDKKHKKGGWHP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA9	Proteophosphoglycan ppg4	0.839	624-638	KGKKGAPKEKEEGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZA9	Proteophosphoglycan ppg4	0.807	915-940	KRHKWGVLGVNGGRKERRSMEKPGER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZB2	60S ribosomal export protein NMD3	0.923	407-420	PARKKAKRARNWKL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T098	Putative Serine/threonine-protein kinase	0.729	253-258	GKKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0K5	Uncharacterized protein	0.994	1143-1159	KRRKRRAAKGKGKARAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T133	SAD1p	0.703	149-161	KKPSLKPGKQPRQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T133	SAD1p	0.671	262-277	RRWWKERGEGREETRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUH7	Proteophosphoglycan ppg4	0.927	747-759	RRRKRNWAKRKGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUH7	Proteophosphoglycan ppg4	0.627	304-310	RRGGRSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUH7	Proteophosphoglycan ppg4	0.621	675-682	KKPSRQQK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUM1	Uncharacterized protein	0.951	436-447	KIPRRRRRRRSS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUY7	Protein transporter SEC31	0.82	89-102	HRRYGTRRRLRPRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVA7	Uncharacterized protein	0.966	151-168	KEREKETTKKGGRRKKRD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVK5	L-ornithine N(5)-monooxygenase	0.722	213-220	RKKRPTRI
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVX4	Proteophosphoglycan ppg4	0.996	182-212	KPSRKSKGKGKENEADPAKKASPKKRKGRLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVX4	Proteophosphoglycan ppg4	0.984	281-301	ARRKSKRKRESKEEVARRKVQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVX4	Proteophosphoglycan ppg4	0.921	227-244	RLRARRERRRERALIRKD
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVX4	Proteophosphoglycan ppg4	0.726	484-490	RRKRAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVX4	Proteophosphoglycan ppg4	0.72	74-83	RAKEAGRKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW56	Sterol 3-beta-glucosyltransferase	0.997	292-311	RKERREQKKRRKAKKHHRHA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW56	Sterol 3-beta-glucosyltransferase	0.719	61-67	GGKGKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW56	Sterol 3-beta-glucosyltransferase	0.717	454-465	RRAGKEEGKRPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWB1	DNA-directed RNA polymerase subunit	0.815	1795-1804	EKVKKGKARA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN0	SNF2 family DNA-dependent ATPase	0.986	896-906	KPKKAKRKRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN0	SNF2 family DNA-dependent ATPase	0.963	695-710	AATKKKQAKERREKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN0	SNF2 family DNA-dependent ATPase	0.89	1269-1279	VRGKGKKAKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWN0	SNF2 family DNA-dependent ATPase	0.861	1162-1173	KPGRKPAKKIRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXJ2	DNA-(apurinic or apyrimidinic site) lyase	0.956	436-449	KVKRGRKGRRGVKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXK5	TKL/TKL-ccin protein kinase	0.953	680-699	GRNKRDGKVVRLRRGKKRQA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXK5	TKL/TKL-ccin protein kinase	0.932	359-391	PRRRRSSSKVLSSRGADAKPVVRKKLVKRRSGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXK5	TKL/TKL-ccin protein kinase	0.834	541-564	HSPRPLRLAKRKVVARITKVDKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXK5	TKL/TKL-ccin protein kinase	0.795	611-629	RRQRSGSKRDPVGRRRSAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXK5	TKL/TKL-ccin protein kinase	0.741	85-104	RREGSQRTRAADPRARGPRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXL3	Retrograde transporter	0.66	492-498	GKRWKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXN5	SRR1 domain-containing protein	0.965	16-34	KKPARPARNRKGKERFRER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXN5	SRR1 domain-containing protein	0.685	214-220	GKKGKGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXT0	Proteophosphoglycan ppg4	0.929	6-18	RKFARRLKKREKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYD9	Uncharacterized protein	0.927	738-751	RRGRGRRRRGTLRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYL6	Uncharacterized protein	0.935	40-63	RTDPEFRRKIQREHKKLEKKVKQK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYT5	Uncharacterized protein	0.631	772-776	RGRKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYT5	Uncharacterized protein	0.604	782-783	RK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYW8	Uncharacterized protein	0.915	375-399	RDPRMVERKKPGHVKSRKMPTWVKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZY5	Proteophosphoglycan ppg4	0.686	322-352	RGRGEGKQRVWRAHRETSARPVEALRGERKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZY5	Proteophosphoglycan ppg4	0.622	1105-1111	RRAKDAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZY9	Proteophosphoglycan ppg4	0.963	43-74	SRRLASRKIAFGASAHPHPPQKKKRKLLKSQV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T192	Thiol:disulfide interchange protein	0.615	893-897	RRVRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1K8	Proteophosphoglycan ppg4	0.614	429-431	KSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1P5	SET domain-containing protein	0.911	217-244	AHGASAGGKVGKAAVGRQRRARRTQPKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1X3	Splicing factor u2af-associated protein 2	0.989	100-124	AAKEEKKGKKRKAADENGGKQKKPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1X3	Splicing factor u2af-associated protein 2	0.692	239-252	KGKPDQLKARQGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T222	Histone acetyltransferase	0.84	586-595	ERRKRQRRSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T222	Histone acetyltransferase	0.773	43-52	RGKKRAREPN
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T222	Histone acetyltransferase	0.754	303-326	RGRAGRFLPKPPGETVKAKRAAER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T222	Histone acetyltransferase	0.61	113-117	RGPGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T223	Putative membrane protein	0.996	231-259	GAEKGGGRKKKKRKQEEPAAGDTQKKQKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T223	Putative membrane protein	0.77	149-156	GKKPKRPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUV2	VASt domain-containing protein	0.986	628-645	GKKERAKKRLKGFRRPRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUV2	VASt domain-containing protein	0.882	678-687	EGKKKGKKGA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV25	ADP/ATP carrier receptor	0.995	601-620	SAPPKPKKPRAPRTKKPKKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV25	ADP/ATP carrier receptor	0.992	53-85	RAREQARDAANKAADKAKKERKQKKAKQPGEGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV67	Membrane protein	0.997	756-797	RKLERRSGGGGGKKRRRGDPAPRTQAARQRAAEERRRRNLHR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV67	Membrane protein	0.921	1081-1101	RRGGGGVFAALRGKGRRRGRG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVD8	Valyl-tRNA synthetase	0.945	45-83	QKEKDLAAKKALKQAQNQGKPAPAAQAGEGKKKEKPAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI6	DNA helicase	0.999	123-155	GGGSAAKGKGKAKAKPKPAAKGKGKGKGRAGGT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI6	DNA helicase	0.991	1630-1650	PAPPAPPARAATKKKGKKKRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI6	DNA helicase	0.939	1532-1557	RLRAAKERAAKARDEEEKRRKEKEDK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI6	DNA helicase	0.924	1736-1756	AVRKRKGVLKVRKQARERASK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI6	DNA helicase	0.9	1364-1378	RRHRRKRMRTSAAKQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI6	DNA helicase	0.898	1395-1427	PREGPRPMPGMKGSKAIKLAMKAEKEREKEKER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI6	DNA helicase	0.702	1464-1470	RRKKEGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVI7	Uncharacterized protein	0.962	563-589	SPPRRKKLRAHIFERRRSKAAQAGKTP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW95	Protein priA	0.925	313-330	RPGGGSGRCKKVKKSKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SW95	Protein priA	0.633	62-66	DKRSK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWV3	Zn(2)-C6 fungal-type domain-containing protein	0.615	136-137	KR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY46	ATP-dependent RNA helicase MAK5	0.996	175-191	KKKAKKQKKEKGKKRSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY46	ATP-dependent RNA helicase MAK5	0.899	851-865	RTKKQKRAEKTREKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY46	ATP-dependent RNA helicase MAK5	0.893	99-109	PAKKSKKGKGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY46	ATP-dependent RNA helicase MAK5	0.604	515-517	KGG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY51	WD_REPEATS_REGION domain-containing protein	0.975	498-520	KMSRAERGKSSGLKKALRKRRRN
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SY51	WD_REPEATS_REGION domain-containing protein	0.718	59-65	KPPKRAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP5	Uncharacterized protein	0.947	247-271	SKKRKRPKQPSGLAEMIEAKKRKEK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP5	Uncharacterized protein	0.93	98-119	KALKGRSQFERVKKRRRTEAKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYV4	Putative Transcription factor binding protein	0.984	291-328	GGRGKGKKPVGAKAGTKSKVVVTGKKGAKGKSGPRNRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYV4	Putative Transcription factor binding protein	0.937	9-36	KKGGRGGSAAGKKGAKGSSSSGRGTGKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYV4	Putative Transcription factor binding protein	0.739	458-473	GGHGAHGRGGKSPIKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYV4	Putative Transcription factor binding protein	0.604	55-55	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYW0	Uncharacterized protein	0.978	50-94	EEHKKPGSKGGKGKHVQKKVVKHEEHEEKGEEKKDEGERPAGKSG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYW0	Uncharacterized protein	0.876	24-39	EGGSSPKRKKVVAKKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZB7	Proteophosphoglycan ppg4	0.992	38-83	PAPPKKKVASSSSRRKGSVKKAVVGQAGGGVKAKAKGRKGKGAAAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZB7	Proteophosphoglycan ppg4	0.88	307-325	SKKKKVSTGSRSPPRKRVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZB7	Proteophosphoglycan ppg4	0.655	285-292	TRAKMGKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZK7	Uncharacterized protein	0.605	422-423	KK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZW8	Protein-serine/threonine phosphatase	0.782	581-597	PQAKAEKKDKQRAPPSP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZY1	RNA-directed RNA polymerase	0.995	46-74	EGTREGRAEARAPRARPRRRWERRREGKE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZY1	RNA-directed RNA polymerase	0.67	728-732	KKRKF
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T063	Proteophosphoglycan ppg4	0.976	363-394	AAPVRAGGGGVLKGKESLKKEKRREERAKDRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T063	Proteophosphoglycan ppg4	0.966	458-515	RPAKGAKNGRDREASERGSGSESVKAKKVDKDRRRQRDESSPPRASSSNGTKKKKRQK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T063	Proteophosphoglycan ppg4	0.724	433-438	RDKKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G8	Proteophosphoglycan 5	1	1284-1315	GKGKGKAPRKKKKPGPKSRFQQKRSANKKKRS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G8	Proteophosphoglycan 5	0.995	425-448	KGKGKAKEVEKPAAKKGKGKGKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0G8	Proteophosphoglycan 5	0.719	55-71	KKRAASPGADGPARKKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0K6	Non-histone chromosomal protein	0.981	110-123	AKPAKKKAPKKAKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0K6	Non-histone chromosomal protein	0.808	6-27	KPRATKAATGGRAKKDPNAPKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0L7	Mitogen-activated protein kinase HOG1	0.615	537-541	RSSKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0Q1	Uncharacterized protein	0.941	281-296	RRSRRRGEERHRRRAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1Q4	Proteophosphoglycan ppg4	0.698	19-24	EGRRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1T7	Malic enzyme	0.855	216-226	RGRRRRRNGRV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T278	GMC oxidoreductase	0.986	1423-1458	RSSKSSAKRSSKRDKGKGKATAAASSSKLKGKGKSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T278	GMC oxidoreductase	0.882	1303-1315	PAKRVKGKGKAKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T285	Proteophosphoglycan ppg4	0.89	16-26	KGGPKKRGRKQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T2B5	CDP-diacylglycerol synthase	0.628	501-503	KKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB4	Proteophosphoglycan 5	0.673	53-58	LKGRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SUB4	Proteophosphoglycan 5	0.665	941-951	RERRLGSKDKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV12	Transcription initiation factor TFIID subunit 2	0.951	1503-1521	PPKQKKHRDVKPEKKKIKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SV12	Transcription initiation factor TFIID subunit 2	0.921	1183-1200	PVIKPPKKPKDKVVKPPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVE4	Proteophosphoglycan 5	0.999	403-442	EPAKVKKNKKEKKEKKREGETKEERRARKEAKRAKKAKAE
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVE4	Proteophosphoglycan 5	0.615	171-172	KR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW5	Proteophosphoglycan ppg4	0.934	485-507	GRRVRPTGRRKKTFKDRMSNKAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SVW5	Proteophosphoglycan ppg4	0.858	218-227	PKRKTKAKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX44	Putative Ser/Thr protein kinase	0.682	346-350	RRRKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX44	Putative Ser/Thr protein kinase	0.674	104-110	SKGKGKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXP8	GDSL Lipase/Acylhydrolase	0.99	300-320	PKSTPKPTPNKKKGKRKPPVK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXU7	CYCLIN domain-containing protein	0.983	530-562	AAGGAAGGRRGKTEEERERERRERRERGKPGSV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SXU7	CYCLIN domain-containing protein	0.613	519-523	KEREK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYC5	Putative Tubulin binding protein	0.926	740-767	PRSARGSARGSARGRGSAARRGGRVPSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYI9	LigA	0.758	260-269	SRRRAKSPRP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ7	Proteophosphoglycan 5	0.775	701-709	QKRRHRRAG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ7	Proteophosphoglycan 5	0.73	564-576	RRHASGRGRRAER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYJ7	Proteophosphoglycan 5	0.636	250-252	KKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYK3	Mps one binder kinase activator-like 3	0.794	21-37	RTPSPVRPDRRGRLRKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYM1	ANK_REP_REGION domain-containing protein	0.988	661-701	RKRRAGKASAASKREKKAPSPPAANGTSNRPRRAATGRSRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP9	Uncharacterized protein	0.998	222-266	KRVKNAVQARPKLTRQEKKDRATGGKKTKKKMASKMKGTKGRANK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP9	Uncharacterized protein	0.941	49-68	SKRKKAKQTARRNKAIEREK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SYP9	Uncharacterized protein	0.837	9-31	AKKGKGKASGLDENGRPPKIKRV
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ35	RNA binding protein	0.845	508-516	AKGKGKRRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZ35	RNA binding protein	0.776	121-133	RPRPPRPHERRAQ
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZQ2	O-acetyltransferase	0.758	1068-1085	RKVRKLKLVKLVKIRKGR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZV5	Proteophosphoglycan ppg4	0.959	3779-3802	KKRNRNRGPKDPNAKKSAARNKAR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZV5	Proteophosphoglycan ppg4	0.956	1184-1212	KRQPAKEKERRVEKEAKTKAKQVQKEKRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZV5	Proteophosphoglycan ppg4	0.899	2318-2336	RREARRTSNRRRGQKKSLR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZV5	Proteophosphoglycan ppg4	0.783	457-472	ERKPSEKQKQKSKDRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZV5	Proteophosphoglycan ppg4	0.772	1762-1768	RTKKRRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SZV5	Proteophosphoglycan ppg4	0.618	3210-3213	RGRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0V7	Proteophosphoglycan 5	0.857	13-43	RKELRTSRRRTGPRRTSFPAPAHKAMPTPRR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0V8	Nuclear pore complex protein	0.969	1212-1256	HAKGKGKAKEGERERGLSAPSPAPTPKRKTRRATLGGLFGRKEPK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0V8	Nuclear pore complex protein	0.846	1809-1819	PKKVRKPPKPR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0V8	Nuclear pore complex protein	0.604	2232-2232	K
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0X4	U3 small nucleolar RNA-associated protein 4	0.944	937-956	AKRKNKKGVPERREMDRKRA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T0X4	U3 small nucleolar RNA-associated protein 4	0.682	567-574	KKARWGRK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T154	RNA polymerase-associated protein LEO1	0.995	396-433	QRLEKEKAAQEKARKARKEAAKAEGGRRSGGRRSKKAT
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T154	RNA polymerase-associated protein LEO1	0.885	507-517	ERRRKDRRKSR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1C7	Delta 8-sphingoloid desaturase protein	0.962	919-951	NKKGVTEEGKAAKKEKESKKVKNPANKVPQGAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1G2	Vacuolar DHA amino acid exporter	0.72	571-579	RRRERREKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1G2	Vacuolar DHA amino acid exporter	0.608	301-303	RAK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1H1	Salivary gland secretion 1	0.983	372-401	KQRPLAPLVKEDKSKSDKPKSKGKGNGRGK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T1P9	Proteophosphoglycan ppg4	0.905	900-912	KKKKKGLKGFLNK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.996	399-434	GGGSKGKGKGKKGAAATAKWKAKGLKGKVMGKGKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.951	114-135	AGAKGKGKGKAKGETARERMIR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.942	945-957	GKKDKKGKGKAKA
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.768	526-543	PKIKLRGSGGAKGKNGQR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.743	1064-1079	GGRRRSTRASAQKAKG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.738	244-251	VAKRKRDK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.737	456-469	PRPQPTKPKAKAST
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0T295	Uncharacterized protein	0.616	473-474	RK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ4	WD_REPEATS_REGION domain-containing protein	0.881	586-605	TAAGKKGKGKAVERDTKARK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ4	WD_REPEATS_REGION domain-containing protein	0.792	532-559	KDKGKGKAKEVDGAPPAASGSVAPKKKK
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWJ4	WD_REPEATS_REGION domain-containing protein	0.61	649-651	RER
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWX2	Atypical/TAF1 protein kinase	0.99	472-489	KVRSKKKKDKHGRKIKKS
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWX2	Atypical/TAF1 protein kinase	0.971	985-1014	NERRKKRLKEQLEKLKRNQERRLARKNQKL
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWX2	Atypical/TAF1 protein kinase	0.654	192-195	RKKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SWX4	Uncharacterized protein	0.97	528-551	ERREKSLSDKERRKQKAKEAKIKR
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX57	Proteophosphoglycan ppg4	0.887	396-447	DVKPRNLAKAEPKREDEATPQPAPRRTTRRSRAPSVEADNKPDVKPKRRRVG
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX57	Proteophosphoglycan ppg4	0.644	386-391	RRSKAP
UP000006141	Rhodosporidium toruloides (strain ATCC 204091 / IIP 30 / MTCC 1151)	G0SX57	Proteophosphoglycan ppg4	0.63	121-127	KKYREGK