ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQS8	Membrane bud-specific	0.951	522-552	KEXEREKEEKDVGSKEKXKTAKFSKKVKKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRV0	Global transcription activator swi1p	0.977	513-551	PHRSRKRSQDSGRQADGKAAKKPKASRAGTPHGLRGRHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU12	Uncharacterized protein	0.764	438-447	KAKKIRPKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUW8	Nucleolar protein 16	0.977	5-30	RKRKMARSSVGKVSRRKKDTHKKIRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM1	Uncharacterized protein	0.886	84-95	RDSKKKKYKHKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVP1	18S rRNA factor 2	0.826	189-203	SHKSRVKSGGNKKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW50	Uncharacterized protein	0.804	191-207	TKQKXLKQSKSSHKKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ09	Glutamyl-tRNA synthetase	0.88	157-167	KKEAKHKKGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ09	Glutamyl-tRNA synthetase	0.627	521-524	KHKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K043	Cholinephosphate cytidylyltransferase	0.98	343-373	RRKRRPSMTRHSRISPRKRMGLRKMAREGRI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1T8	Putative rn mrp complex component	0.949	62-71	SRKRXKKKKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W5	60s ribosomal protein l44	0.6	61-61	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K309	Uncharacterized protein	0.611	206-208	KHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K385	Molybdenum cofactor synthesis isoform cra_c	0.847	270-279	KAVKKKKAKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K424	Cytosolic Fe-S cluster assembly factor NAR1	0.844	394-412	KGPXTSGRGRAXLRRRRMQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR49	Nuclear segregation	0.992	355-377	PKNPNENLSKSKKSKKHKKRASK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR49	Nuclear segregation	0.654	85-89	LKRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRK4	Xylanase chitin deacetylase	0.875	1066-1085	HRGKASKSDEKSKGRSKGKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW3	Signal recognition particle 14kd protein	0.999	113-129	PGLKKRSKKKKKKKKHQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV22	DNA-directed RNA polymerase subunit (Fragment)	0.851	329-348	GRPIKSIRARLRGKEGRLRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW47	Nicotinamide-nucleotide adenylyltransferase	0.607	20-22	RHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW47	Nicotinamide-nucleotide adenylyltransferase	0.601	15-15	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXF7	Putative zinc finger transcription factor	0.99	525-541	VLKRKGKKSKKRENKXR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXX6	Uncharacterized protein	0.79	367-379	TRSRSKSPRRRDL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR8	Dna polymerase alpha catalytic subunit	0.907	44-57	RKKXVKKVRNKKSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR8	Dna polymerase alpha catalytic subunit	0.649	216-223	XRRSSKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0X5	Forkhead transcription factor	0.899	185-207	KKRSAPQHMEKSSKRSRRLKAPA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQJ4	Duf1212 domain membrane protein	0.691	250-255	KKKGKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQK4	Ypl150w-like protein	0.929	345-359	REKRRYKAEKKKHRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQK4	Ypl150w-like protein	0.701	379-386	KKKGKDKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQX3	Dna replication	0.918	500-535	TRKHLKPSKEYLEARKRKWSANMKELYIPKRKTKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQX3	Dna replication	0.853	414-446	RREKNLRRKLAKVSGGENLRNLKIESKGERKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQX3	Dna replication	0.652	67-75	KNERSLRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTQ5	Uncharacterized protein	0.762	26-37	RKVRRQRQRAKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUC9	Uncharacterized protein	0.697	226-231	PHKKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUM2	Uncharacterized protein	0.99	278-319	REKRKQXFLKFRKIKAEIASRKRFREQNRQKRLAARRIKPKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVI4	RING-type E3 ubiquitin transferase	0.991	12-31	KPKKGYRRRGGQRKPRKPRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVI4	RING-type E3 ubiquitin transferase	0.985	715-727	KKKGKKKKKILLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVI4	RING-type E3 ubiquitin transferase	0.663	576-581	KKXRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVS9	Rna-binding protein implicated in ribosome biogenesis	0.999	9-76	SKKQLKALRFKAKKSDKAAEKLEKVETSIKEVKEKKESEKRKNETADGXHPRKKRKTRRGHHGRGKNG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVS9	Rna-binding protein implicated in ribosome biogenesis	0.99	164-192	KNRIEKIKEKNEKLIKKRVEKIKKEKKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWB1	SAS4 domain-containing protein	0.977	327-342	RSRKRLRKRNKKYGKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWV8	Serine threonine protein kinase	0.643	78-82	RRSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN0	Putative mitochondrial ribosomal protein s9	0.988	284-302	ERKKPGRRKARKMPTWVKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ21	General negative regulator of transcription subunit 4	0.948	87-109	KAERRKREKRQQEKERKDAEMAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ21	General negative regulator of transcription subunit 4	0.606	363-364	KK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ92	Ser thr protein kinase involved in salt tolerance	0.919	714-749	RKRRESMKKKKEFNILTNAKSSXRLKRMQNGKRKSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ92	Ser thr protein kinase involved in salt tolerance	0.656	316-323	RHRHGRNK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ92	Ser thr protein kinase involved in salt tolerance	0.63	247-255	RRHLKCKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZU7	Trna pseudouridine synthase 4	0.964	41-59	EKRNAGRKSRRNRRSNKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZU7	Trna pseudouridine synthase 4	0.688	352-360	RKSXKRLRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Z7	Protein with a putative role in actin cytoskeletal organization	0.965	364-378	GKKEKKKRGMRSRLG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q2	Mitochondrial ribosomal protein of the large subunit	0.966	2-24	RKKAKEKKLERRIAQKRLNAKKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Q0	Rml2p	0.951	361-389	AKGGFKTRTGKHVNKNKVRDRPRGKEARA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Q0	Rml2p	0.891	111-148	KGKPYKPLTMRKVDSAGRNRTGRITVRHRGGGHKRRIR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Q0	Rml2p	0.608	102-103	RK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K403	Putative fungal zinc cluster transcription factor	0.954	105-122	KIRDLRLRGRRQRKKMKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K406	Uncharacterized protein	0.997	175-203	AKAASSGKGGKQTGTTKKGRGRKRKKNDK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K422	Ubiquitin c-terminal hydrolase	0.909	163-176	AHPRKRKLRVKGEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH6	Putative spb4-like dead box rna helicase	0.994	476-535	KKETARKHELLTHERKRQRREKALKKKSQKNKNFSWSDKNSGKETRIERHDKLKRRREAI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH6	Putative spb4-like dead box rna helicase	0.869	568-575	KRKRKARK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH7	Putative trna pseudouridine synthase	0.933	55-74	VHESAKERREAKKIRKINKQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQU7	Mitochondrial division protein 1 (Fragment)	0.759	87-97	ERKLRGKAWKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR27	Atp-dependent dna helicase	0.992	135-152	TKGRKKXKNPKKXKKNEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR68	Ylr290c-like protein	0.741	121-136	SPPKSSQLKDKKDKKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSF3	Ccaat-binding factor complex subunit	0.938	216-233	PEKPKRKHSRHXKHDRXH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT27	Putative-like co-chaperone scj1p	0.604	36-37	GK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT27	Putative-like co-chaperone scj1p	0.602	34-34	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXQ7	Sit4p phosphatase-associated protein	0.954	683-694	KXGVRRRRRRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ94	Uncharacterized protein	0.994	258-303	KKQQEEKERRRKKEEEEQREKKKREEEERRREMQRKEQEAREKAKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZI1	Defining member of the set3 histone deacetylase complex	0.802	136-148	KKTRGNRKEKKVR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K042	Single-stranded dna cleaves single-stranded dna during nucleotide excision repair	0.708	504-511	KXRRKIRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K057	60s ribosomal protein l19	0.848	176-200	ARRLRNKAARTRRQDRLDEKKAVKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K057	60s ribosomal protein l19	0.647	86-97	RGGRHMGYGKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J7	Ubiquitin-protein ligase e3	0.994	210-221	KKKPKKHRRSRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU62	Uncharacterized protein	0.78	37-49	KERKRRAATSKLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU80	Copper-transporting ATPase, putative	0.812	524-537	LFSRLRRAFGRKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU80	Copper-transporting ATPase, putative	0.614	519-520	KK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUH7	Homeobox transcription factor	0.816	101-114	RRAKQRKLEKLKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVX5	Subunit of a golgi membrane exchange factor (Ric1p-rgp1p) that catalyzes nucleotide exchange on ypt6	0.928	221-237	KEESKSERKKRKAXXXR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY20	Cation translocating P-type atpase	0.978	315-332	KRMFGRKKSKKKFKNLKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYQ3	Subunit of the cohesin complex	0.931	74-85	KKEGGRKKRRIA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYQ3	Subunit of the cohesin complex	0.607	26-27	RK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYS9	Uncharacterized protein	0.92	118-128	TNKKKKKSKLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ07	Subunit of the rna polymerase ii-associated paf1 complex	0.912	122-146	SKNKRLRTSKLSELKRQRERKSKQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZF0	Ras small monomeric gtpase	0.686	202-210	RKELKKQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR8	Dna-directed rna polymerase i subunit a34	0.649	194-197	RKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K143	Polybromo 1	0.971	341-378	KPKKQEEEKKPKLKRKIVIPDSIFPFPKRRGRKSNKQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K273	Putative nuclear thioredoxin peroxidase	0.995	20-68	EKEKPAKRAKTDKKVAXKKTGKQAKAXAKAXTKVVKTKKEHTSKAEXKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2H2	Non-smc subunit of the condensin complex (Smc2p-smc4p-ycs4p-brn1p-ycg1p)	0.828	254-289	XKXKTERIRKKENPTDAEAKEAERKQKVKDDAQKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W6	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.792	350-381	KRKKEAAXRIEAARQRTLLVQKKKEERMLKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W6	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.664	633-641	GGRXXIRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX5	Eukaryotic translation initiation factor 3 30 kDa subunit	0.998	48-84	KQKKEKEAKEKAEKAALKKKQKEALERKKKKKSGKPT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX5	Eukaryotic translation initiation factor 3 30 kDa subunit	0.926	246-258	LGGAGKKKAKGKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTZ7	Uncharacterized protein	0.995	15-72	KPKXRXEXVPXKVPETAXEXRKANPRRNTRTKRKKLEISAXKRVVKXRSTRKSLPKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTZ7	Uncharacterized protein	0.988	148-174	KVTKAKSSVPKKRGRKKRVELVGIKYR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV02	Component of the small ribosomal subunit (SSU) processosome	0.815	256-274	KEKEGKQKRQSQKEKXVRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV02	Component of the small ribosomal subunit (SSU) processosome	0.734	205-214	KAARKAARRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW20	FHA domain-containing protein	0.769	11-21	FGRRPRKYRPP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX88	Anti-silencing function protein 1	0.698	244-250	RREKRRM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXP4	Uncharacterized protein	0.994	142-158	SSRGERRRRRRRGRGRD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXZ7	Map kinase kinase ste7	0.829	342-358	KRWAKNVRRMEKGKPVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYJ8	Vacuolar endopolyphosphatase with a role in phosphate metabolism	0.679	212-221	KSSPLKKNKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYZ8	Interferon-related developmental regulator 1	0.656	387-392	VGKRSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZB0	1-phosphatidylinositol-3-phosphate 5-kinase	0.753	501-514	QRLRHRRISRSGRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0H6	60s ribosomal protein l10a	0.78	93-105	LNKNKKLIKKLAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0N1	Uncharacterized protein	0.923	21-40	YRKKIKTIKRTTRRSKLKTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0N1	Uncharacterized protein	0.905	122-137	RLKINNHRRGRFRGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0N1	Uncharacterized protein	0.764	105-113	PPNKKRRGI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0R7	Putative snt2p-like dna binding protein	0.966	468-494	PVKPKRRAAQKSRLSVKPKGSRRTRSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1N9	Putative guanine nucleotide exchange factor eif-2b epsilon subunit	0.608	533-534	RK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Q6	Tom70	0.998	50-75	EKTPSPQKPKXKSHKKRKKKSEKEAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C2	60s ribosomal protein l5	0.988	267-292	SKKYRKKKLSKEERKARVAKKLEELK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2I8	Uncharacterized protein	0.7	88-110	RRRSKXSEGSLPDRSRRENRDRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W0	Uncharacterized protein (Fragment)	0.953	202-228	ARRKSRAKFGRNDRRRGRQEMQESKRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W0	Uncharacterized protein (Fragment)	0.888	60-79	GRSFGRGREEREPRKPREPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K409	Pol polyprotein	0.62	378-387	KRTGXPIPPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQI6	Cell cycle regulatory protein	0.67	35-40	KKSRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRA9	Uncharacterized protein	0.991	5-37	KRRRTTRRDDIAKRRRPVRQAKEKEEKKLREEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRB4	Phospholipid-transporting ATPase	0.992	159-197	NNPKRSKTIFRRDRWGTQRYKSGRPRRKGTLRRGKTXRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS50	Mitochondrial translation initiation	0.913	68-94	RSSDSKPKVKTSNSLKKKKSQKLVXKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS57	Putative epsin-like clathrin-binding protein	0.81	318-328	ESKKKKSHEKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSC3	Gcn4p	0.864	224-240	ARNTEAARRSRARKMKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT19	Negative regulator of transcription	0.886	6-14	KGKRGKKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTD8	60s ribosomal protein l4-b	0.949	181-204	KAIKSKKMRAGHGKMRGRRFTQRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTM7	Protein ldb19	0.833	34-42	RKKVRRRKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTP9	Nucleosome binding protein	0.821	3-16	RKGTRKKKDPNAPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUQ1	Putative ebna-like pre-rrna processing factor ebp2p	0.989	212-237	RKKRRIQRQMSAKGKGKEKTGKKQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUQ1	Putative ebna-like pre-rrna processing factor ebp2p	0.814	141-158	KKAKEDAKRQRELKKFGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUQ1	Putative ebna-like pre-rrna processing factor ebp2p	0.652	178-185	KIKSLRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW49	Uncharacterized protein	0.999	49-85	LKGKVKRTHGKKRKRAKTGSEKPKKMARNALKTSNHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW49	Uncharacterized protein	0.999	136-161	KDKKVRKSTKNVKKXRKKKTTKKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX67	Guanine nucleotide-binding protein alpha subunit	0.673	223-229	KKPRRIR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY92	Cytoskeleton assembly control protein sla1	0.973	211-241	NKKDRKDKKDKKEKEEKEVAGGAESAGKKHP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY92	Cytoskeleton assembly control protein sla1	0.914	86-143	ARLERERQELARERRRQDRRARELKTYEERQRVRLADERERERAXRPHHGKRDLSKPN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY92	Cytoskeleton assembly control protein sla1	0.831	33-59	KLFGRKGKSATSGSSQGPRKNRKNSAR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K028	E3 ubiquitin-protein ligase	0.968	1103-1129	RKSKHGKGLETRKERAHRLAHKRQKKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K028	E3 ubiquitin-protein ligase	0.794	962-967	RKKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1C1	Uncharacterized protein	0.996	64-95	KKNPWKKIGKHEGKKWKHYGKHQKKKWGKKPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1C1	Uncharacterized protein	0.961	119-152	IKNPKKHWKDYGRDQKKYWKHXGKEERRKWAPKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1C1	Uncharacterized protein	0.961	257-284	KYWKHYGKEQKKHWKKYGKHQKEKWGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1C1	Uncharacterized protein	0.927	181-213	KDPKKYWKHYGKDQKKXWKHFGKDQKKKWSPKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D5	Putative zinc finger protein	0.87	98-115	PRLRKKSNKFRKLSGGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2K4	Uncharacterized protein	0.95	395-445	SXSSRSHSRRSSSSHTRGSSRSRTSSRVKKPDSGAGSRSRSRSRSRSRSRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSE7	Uncharacterized protein	0.946	106-148	SNQSKPNKPDKSKSNKYKSDKFKPNKSNQSKSNKSKSRTKXAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD2	Pre-rrna processing protein	0.92	302-319	RTRGNKLKIIKKGREKKM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD2	Pre-rrna processing protein	0.734	166-173	NARXKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWM4	RNA helicase	0.998	112-189	HGKFVHKRIRAPKLPDRSRDHYGKQMEKVRKAVAGGLRVKGYQAKKGPGGELRSVDDIRKSRKLKERRRAKNARPSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX35	5'-3' exoribonuclease	0.777	396-413	KHEKDRRREDNYKRRKIE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYE2	Yml020w-like protein	0.964	312-331	PKSKKKAKSSRNKGKESIKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF0	Fatty acid synthase alpha subunit (Fragment)	0.694	1093-1098	IRRRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0U0	Ubiquitin carboxyl-terminal hydrolase	0.664	536-540	KKKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K118	Protein SDA1	0.896	50-77	KMKVNRKSTRRGKQFEAAIRKINKKRSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1I4	Yor052c-like protein	0.935	117-131	HTRKKSRSKSKSKGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K327	Proline utilization trans-activator	0.986	273-304	GRPHKKRRRKDGSKPGEADENERQGKHSRSQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A0	Mitotic spindle midzone localized microtubule-associated protein family member	0.648	224-243	RSXFKQRRQQSSRSSXXRRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K453	Methionine aminopeptidase 2	0.998	37-56	GEHKKRRKRKNHHKKKAVRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP2	Eukaryotic translation initiation factor 4C	0.963	6-20	KGKGKGGKNRRRGKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP2	Eukaryotic translation initiation factor 4C	0.743	58-71	KKRIAHIRGKLRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT8	Ybr138c-like protein	0.615	357-358	KK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT30	One of six subunits of the rna polymerase iii transcription initiation factor complex	0.999	144-170	KTKKRKEAKKPKKKGGLAALRRKIRRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT30	One of six subunits of the rna polymerase iii transcription initiation factor complex	0.722	638-645	KKPNKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU30	Rna polymerase ii-associated protein	0.835	150-163	LKKYGKSKQKAKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU30	Rna polymerase ii-associated protein	0.689	222-228	KFHKKRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWK1	Eukaryotic translation initiation factor 2 beta subunit	0.987	68-83	IKLKKHHHKKKKKASK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWK1	Eukaryotic translation initiation factor 2 beta subunit	0.981	40-51	AKKKKKSKAKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWK1	Eukaryotic translation initiation factor 2 beta subunit	0.888	13-19	KKKKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXK3	Uncharacterized protein	0.998	280-306	PRSKTKIRIVRSPRKKQQRRRRRKRLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXK3	Uncharacterized protein	0.998	466-491	PSKKQSKKIRQTTNKRRKKRKSKKSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXK3	Uncharacterized protein	0.685	330-337	KPRKXEKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF2	Suppressor protein stm1	0.998	225-296	RGDRRGPRGPRADRGDRRGGRGXRDDRRGGRGGRGGRGGRSXRGRGPRAPRSSRDAAKSAKPAKSASKSASK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF2	Suppressor protein stm1	0.989	31-98	KPQKSTKKSGVPPKADKSKXRKNRAPKFTGNEAGLKHTNKNRSVEGPRVTRRKGGKSKQDDRHSKTGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF2	Suppressor protein stm1	0.779	193-204	KKLRSRARKEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ42	Ribonucloprotein	0.931	12-46	ASKKVNKKILKTVKRASKCKHVKRGVKEVVKALRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ72	Histone-like transcription	0.613	111-112	KR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K049	Splicing factor 3b subunit	0.904	132-145	KTPPRKMRKKSARK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S3	40S ribosomal protein S6	0.864	219-235	RKAEKAEIRKRRASSLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S3	40S ribosomal protein S6	0.858	87-96	RRKGERRRKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S3	40S ribosomal protein S6	0.801	166-196	EKKYTKAPKIQRLVTPQRLQRKRAVRAHKIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1V1	Uncharacterized protein	0.953	96-122	XKPTLNLXXKPPIRPKPLPKKSKTPPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1V1	Uncharacterized protein	0.84	147-156	LPRRRGKEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1V1	Uncharacterized protein	0.729	221-231	RKRPSPPPPRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1V5	Glucan synthesis regulatory protein	0.755	163-170	RKQRPRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2L6	Potassium transport protein	0.922	222-235	PRPDKKRAGKRRNK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2L6	Potassium transport protein	0.889	276-297	RLRLPGHHHRHRKYHRQRRHQR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K323	Uncharacterized protein	0.99	23-50	PRKKKRKTDSLQQEKKKKRVSRSRSRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K323	Uncharacterized protein	0.768	145-160	VRRGRSRTPKDXPRSE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K323	Uncharacterized protein	0.639	164-167	ARRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K323	Uncharacterized protein	0.628	86-92	KRNPSRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K417	Translation initiation factor subunit a (Eif-3a)	0.823	627-678	KLKKLEGEKAAKERLEQQIAARKAEQERAEKEAERRQEEKRQRAIELERKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K417	Translation initiation factor subunit a (Eif-3a)	0.631	774-777	EKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K417	Translation initiation factor subunit a (Eif-3a)	0.604	770-770	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH1	Protein alpha-1	0.981	4-18	NKKKPEKKRKRGFQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH7	Muscle m-line assembly protein unc-89	0.992	257-295	NARXKIKAKXQSKAKXSRRHKPKPQTSIQKPIRHSTRTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH7	Muscle m-line assembly protein unc-89	0.942	338-359	RRLKRIEARSPSXSPKRRRKSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH7	Muscle m-line assembly protein unc-89	0.652	39-45	RLKIRRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL0	60s ribosomal protein l6-b	0.938	247-262	KKPSKKSSKKNAKKVX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL0	60s ribosomal protein l6-b	0.717	105-112	KKSKKSHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRM1	Nucleolar protein 9	0.958	4-23	KVRGRQAKKERKSKHAHHKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS16	Peroxin-13	0.72	256-265	NNSKXPKRHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS16	Peroxin-13	0.605	254-254	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA2	Putative gtp gdp exchange factor for arf	0.65	1027-1039	ARPGKSGLFGRGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT32	Actin cytoskeleton-regulatory complex protein PAN1	0.985	1023-1044	KALEEKEKEHKRKKQERRARRI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT32	Actin cytoskeleton-regulatory complex protein PAN1	0.984	910-982	RAKRIKEKAEKRMRDRLAKLGIRNSERGRGSEGGRSGRSXXXXSKSXSKXXSKSSKSXXSSSKKQXSKAXPKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTQ1	Uncharacterized protein	0.686	5-22	KTRRRSNGSLSPTKRASK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTV9	Uncharacterized protein	0.774	28-36	RHRKXRKXR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW2	Asm4p	0.855	490-505	SKLIKSKKNLPKKSKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW17	Ribosome production factor 1	0.874	7-19	KEKLKLRRERRKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX90	Regulation of g-protein function	0.914	192-246	KEEPKEEPKEEPKEEPKEEPKEEPKEPKEEPKEEPKEQSKEEPKEEIKEEXKEKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX90	Regulation of g-protein function	0.764	327-349	KATPKTAPKXTKPTXKPTSKPAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX90	Regulation of g-protein function	0.6	276-276	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN8	Antiviral protein	0.998	196-287	GKGKKKKGGKNKNKKKGKENMKDAKDQKDVKDEDKKDVKDEDKKDXKDEDKKGDKKVDKKGDQKEDKKGDKKEDKKHYKKEDXKMIRKKIKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYX3	Low-temperature viability	0.953	72-84	SRSKXKKVKRKKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYX3	Low-temperature viability	0.857	179-193	KSKLAQRRRRQKEKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYX3	Low-temperature viability	0.655	158-164	KRIXKKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ10	Uncharacterized protein	0.999	149-163	GKKKKRRKKKSKEGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZY0	Transmembrane protein subunit of the glycosylphosphatidylinositol transamidase complex	0.673	359-375	AIKKIKQTVKVLKSKIG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K058	Putative tea atts type dna binding protein	0.646	222-225	RRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C0	1,3-beta-D-glucan-UDP glucosyltransferase	0.998	206-223	KMSRKARKAKRKSKKARK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0F8	Shared subunit of dna polymerase epsilon and of isw2 ychrac chromatin accessibility complex	0.66	122-131	RKELKQKEKM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D3	Chromatin assembly subunit p90	0.999	98-254	XKXKSPLKKDEPKKKTESXGHKITKEERHKRKLQKDEEAKKRRVKREXEAEERRAKKQKEALEXKAKREKENEERRLRKEKEAEEKXIRREKVAEERRLKKERREKEKEERKLKFEEERRKKKEELEKKXKLKEEEKRKKEEEKLRKQQIEEEKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C3	Swr1-complex protein 3	0.999	39-169	AEKKRKSXXKEXSKEEKDPKKKVTRRKSKEEKEKEKEQLRLEKQIRKQKQREERERLKMLEKEKRERERELKREQRRLERIKEKKEREKEREIREKERAEKRMLREKERLEKLKRKEQRERERKLKKEKMA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C3	Swr1-complex protein 3	0.999	310-353	RQEEKLKLXELAEEKKKEAVXKKSSKKKRRHRKNWGSSRRKTRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C3	Swr1-complex protein 3	0.849	488-496	VKIRRRRRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2C3	Swr1-complex protein 3	0.602	476-476	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2E3	Uncharacterized protein	0.849	290-305	RKKRXELIKAARRKSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR50	Lipoyl synthase, mitochondrial	0.846	38-48	KPPKAVKRRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR56	Tfiia large subunit	0.954	209-226	RRKLAEQRXKSRKHKKRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR80	60s ribosomal protein mitochondrial	0.626	119-122	RRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL1	Peptidylprolyl isomerase	0.999	49-131	KDEGKKKQSGKKRKAEKEESGAEGKSKKSKKAKKDEEERRVKFDKDLIKGPTQTEKKEKKEKKEKKEKKEKIEKKKKKHPVRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSB6	Putative argr fungal zinc cluster transcription factor	0.748	418-426	KKMKVKKKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTS9	CCHC-type domain-containing protein	0.874	272-284	QARIGGKLKKKKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUZ0	Protein transport protein Sec61 subunit beta	0.699	14-24	KRRANKENKLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV40	Uncharacterized protein	0.853	177-187	KKRIKGNKKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZN8	Uncharacterized protein	0.994	22-41	PKKPKADKHKHRRTRREKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1U7	Uncharacterized protein	0.999	81-109	GKAKKKTSQRKKVTKPKKRRKQGGRIKRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1U7	Uncharacterized protein	0.674	16-23	KIRRIPRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q7	SRP9-21 domain-containing protein	0.997	120-134	KHKKRSKKSRKGRKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQN9	Ada histone acetyltransferase complex component	0.758	10-27	RRGRNSKRSSRYXARSRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQN9	Ada histone acetyltransferase complex component	0.751	720-729	PRKKQEKRWP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR75	Elongator complex protein 1	0.992	1205-1225	SSRRTAKNRRREERKRARGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRE4	Serine threonine protein	0.73	953-958	RRKPKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH8	Serine threonine kinase	0.959	63-96	QIPTKKAVKRRQLTRSEQERRREIRRARDKKYMK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRX8	Rna binding protein	0.988	92-117	LRRAKSSARELRKRRSNPPKEKAKPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSJ5	Ribosome biogenesis protein SLX9	0.958	4-83	KKRTSLRSKARKRNVADKVQGHSRIAKKEREIKSKDALLLKLKIQKGAKSPAVQPKSKCLDPRQPGISKSAVRRRKRKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF8	Uncharacterized protein	0.98	144-197	XAKPKKKKTLKLNLSSSTIKIGNSKKVEKKTVKPEAPKVEKPKEAKPEKGSPKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTR4	Putative bzip transcription factor	0.881	373-392	DKKRRNTAASARFRIKKKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTZ8	Uncharacterized protein	0.9	32-47	XVNRKRXPRRMSKRLX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTZ8	Uncharacterized protein	0.737	10-18	ARKRGSARR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY44	Spt3p	0.708	260-267	GPATKRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR2	Smg4_UPF3 domain-containing protein	0.996	203-278	RQKTTQKNPRKQAKGKKTKNINVRSXGPKSERSQKEMTKKERQXIKRLKRKAFKEAKLNSDKKAGYGNKKNIPVKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR2	Smg4_UPF3 domain-containing protein	0.651	283-289	TKGKEKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1N2	Uncharacterized protein	0.762	153-163	KKVNKTRKKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X9	DNA damage-inducible protein 1	0.788	364-375	KKPAKAPKVSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3I3	Uncharacterized protein	0.999	175-221	EKAKKEKEAAQANAEKRKEKWXKKKAEKERKRKEEEIRNRIEKRKEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQI5	Dna repair protein rad14	0.984	246-286	WLRREAMRKARKEKKFNSKLSQMRRKLRAEELTRKFREAKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS82	Trna acetyltransferase	0.741	4-15	RKWTGGKARSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSY4	Uncharacterized protein	0.997	283-325	NAKHKRWYQRKASHWKAKAKRKYKEIRLFKEKRLXIKKWRQKQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTM8	Ycr016w-like protein	0.999	78-101	KSVKKSKKAPKRKKLPKNKRPAPP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUL4	Ccr4-not transcription complex subunit 7 8	0.908	50-73	TKSKKELSPVSKRGTTKRKDGKKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV37	U3 small nucleolar RNA-associated protein 22	0.904	62-76	KAPLKASKKXSRKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV48	Flap endonuclease 1	0.998	283-305	GKKRTASDSKDKKKKRKTGRSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVU9	Dna repair protein	0.915	343-362	RGRVLKIGERPMKSRKKSKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXG4	Uncharacterized protein	0.899	140-155	KKFRMLGPKLKKKNNK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXH6	Uncharacterized protein	0.742	11-33	KARRNYMRKHGLKTLERDKDKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL0	60s ribosomal protein l35	0.92	77-107	PKDLRAKQTRAIRRRLTKSEKNLKTTKAKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3H5	Uncharacterized protein	1	43-90	KKEEKKEKKEKKDKKDKKHKHKDKKHKHKSKKRKSEDDEEHKSKKSKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T7	Mitochondrial inner membrane half-type atp-binding cassette transporter	0.846	650-662	LKEEKQQEKKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T7	Mitochondrial inner membrane half-type atp-binding cassette transporter	0.634	569-572	ERKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W1	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.959	291-311	RAKRERKRQXKSKAKDGQIQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQH0	Uncharacterized protein	0.856	146-155	SKRRKGRRLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQP2	Hmo1p	0.994	210-240	RKNVILAPXSXSKKRSGEPEGGKKHKKKRHE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQP2	Hmo1p	0.945	112-125	QKKKKKRDPNAPKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG6	Arl3p	0.979	135-151	RNKLNRKPNYRKHRRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW6	60s ribosomal protein l7	0.925	13-41	KKEKQQEKDLKKIAAERKARXAANKEKRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUI5	U3 small nucleolar rna-associated protein 7	0.957	8-28	NKKKNEFSRKKRHRTGRLGSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUI5	U3 small nucleolar rna-associated protein 7	0.955	458-500	KGKNSALRRMKRKQRNNLITERSRRVEKALEKEKDLRKRKAEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT4	Zinc-finger inhibitor of ho transcription	0.685	252-262	KKSKKLNTHRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW72	Rna binding domain-containing protein	0.999	145-168	RKPKKKNNRRKEKKEKKKKQTHRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW72	Rna binding domain-containing protein	0.825	20-37	KSRVNKPAXRNSRRRNGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWQ9	60s ribosomal protein l18	0.994	141-186	RGPKKAREAYRHFGMGPHQHKAPKIMSKGRKFERARGRRRSRGFKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXX8	Putative proteasome-interacting protein cic1	0.952	351-361	SKRAKHKKRKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXX8	Putative proteasome-interacting protein cic1	0.802	5-17	XGXKRVKKVKSVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY45	Elongation factor 1-gamma 1	0.989	213-249	HKKEKKKGGEKKQQQQSKKQKQKQAAPPAQPKKPKHP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR7	Transcription initiation factor IIE subunit beta	0.98	256-274	NKKDAPIQRRKQKKPRRGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZR7	Transcription initiation factor IIE subunit beta	0.975	17-62	KRASAALPAQRRIVKPPSDSRNESKKSGPKRNSGDRSSQRRKRQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0W5	Skn7p	0.952	221-265	ARKRQRRSSRRGQQHKVRKADQPMPLPLAPLSPKRRRQRLLARPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J9	Part of small ribosomal subunit processosome (Contains u3 snorna)	0.966	50-60	KKKKKRSKRTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Z7	Putative bud neck localizing protein phosphatase subunit bni4p	0.968	491-506	KKPLGKRRSKQGKRKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Z7	Putative bud neck localizing protein phosphatase subunit bni4p	0.726	227-233	HRKQKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Z9	Alb1p	0.965	63-86	SKKRAKKIARNMKYAKARKEQSKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Z9	Alb1p	0.823	11-26	KALSRARRGKHLSSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Q5	Ap-1-like transcription factor	0.968	6-48	APSKKGSRPGRKPLTTEPKNKRTAQNRAAQRAFRERKERKMRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQG4	HMG box domain-containing protein	0.994	46-66	KGKKRSKKRKSQKDLEKPKRP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQP0	Rsm24p	0.898	334-345	KRNKKKQHRNKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX4	Tma16p	0.96	10-52	VSKLIKQKKTTLHPNSRRAKRLARATLRQEKITRQKIKHKLKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX4	Tma16p	0.608	104-106	RRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSZ1	60S ribosomal protein L36	0.971	66-85	KRARKFAKKRLGSQKRAKNK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSZ1	60S ribosomal protein L36	0.732	23-34	PRPSQRKGRATK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV67	Transcription initiation factor tfiid subunit 1	0.846	711-723	KLQKQQEKKKKKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV67	Transcription initiation factor tfiid subunit 1	0.813	53-67	KKKIEKLKEKERREK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV67	Transcription initiation factor tfiid subunit 1	0.804	171-181	KKRKDQKAKRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV67	Transcription initiation factor tfiid subunit 1	0.779	283-288	RRKKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVW1	Transcription initiation factor tfiid subunit 7	0.992	101-114	RRLHRRRRKKKSKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX54	Subunit of a complex with ctf8p that shares some subunits with replication factor c	0.953	64-83	GKKVKLKPRKKEGSQKNARK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY35	Uncharacterized protein	0.997	161-193	EKKDAKEEKKGRTGRGKKEMVRKPRERKERKNE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K072	One of six subunits of rna polymerase iii transcription initiation factor complex	0.935	7-17	RKRGRPRKQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0S1	Ddt domain protein	0.9	617-635	REGHPDKPTKRGRGRGGRP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0S1	Ddt domain protein	0.752	835-842	KARKPXRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0S1	Ddt domain protein	0.616	677-679	EKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K147	Putative zinc finger protein	0.964	71-92	SKKEKRRRAKEALLEKKNKLLA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K198	Patatin-like phospholipase domain-containing protein	0.654	508-512	XRKRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1G7	Essential deah-box atp-dependent rna helicase specific to the u3 snornp	0.905	160-184	VKKXSKKGSILGEQRLRRXKQXRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1G7	Essential deah-box atp-dependent rna helicase specific to the u3 snornp	0.706	6-15	GKNKRREQLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1G7	Essential deah-box atp-dependent rna helicase specific to the u3 snornp	0.628	30-32	KKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K355	Cytokinesis protein sepa	0.994	6-23	KPRNWRKKRRXEEKKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR26	ATP-dependent DNA helicase	0.998	98-114	RKNKAKRKSRKRKKTRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT06	Tryptophanyl-tRNA synthetase	0.997	414-443	PREKKSKGKKESKKNEKKVAKEQKKDEKKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV61	Wd domain protein	0.693	173-178	RKRRLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV79	Uncharacterized protein	0.875	197-209	KKRQRKSKFKXHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVN0	DNA topoisomerase I	0.671	324-327	KRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVS3	Klla0c00649g-like protein	0.88	108-121	KHRRNSRRRRSNSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYA6	Uncharacterized protein	0.963	185-213	KWRKEKVEEERSEKKREEKEKEKEKEKEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K088	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.998	113-162	RQKRSTRRLKTLKRKKTLKEKKLIHKAAKKPKGTTKSEHKEKIQTSXKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K088	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.978	10-64	KKTKVLTPEEKRRRKEKLEESMMRKKELKRQQAIERAKRRALNAGXXNEKKPPKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y3	Tpr-containing co-chaperone	0.973	197-236	KAVRSLLAKVQDKKQKIKKAKEEKEKMLLEKKEKEDNVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1I8	Uncharacterized protein	0.994	21-63	STHNLKRRRILKAKCKSKTKQKNKSKSKSKITLKLKLSPKHKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3D5	Pentatricopeptide repeat-containing protein	0.899	44-57	ARKKKQRKSLSKAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3D5	Pentatricopeptide repeat-containing protein	0.829	267-289	EFRRLIKHQGRKLKRDNFLKDKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQZ0	Ppz1p	0.798	319-324	RKRKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT21	Uncharacterized protein	0.996	205-245	KGSQKTANGKESKRAGKRKRSASPVSKETSKSSKSRKKKAG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA4	Putative calcium channel	0.945	65-85	KHKSGKHRFRKKLWRNPPPKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA4	Putative calcium channel	0.696	245-250	RLRRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTD7	Putative transcriptional regulatory protein ybr239c	0.983	6-21	KGLPKKRGRKRKNTKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU03	DNA polymerase delta subunit 3	0.981	348-378	RASXXPKRKAAKAKDHVISEKGLSRKRKKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUA8	Myosin-2	0.862	612-625	KKPKRNRRMGAMRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV28	Uncharacterized protein	0.604	127-128	KR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV44	Uncharacterized protein	1	393-430	LKGRQRKXXVKRKTKEXRQEKEKKRRRKRKSKTIQRDR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV44	Uncharacterized protein	0.987	319-334	RSKXGKRGXKRXRKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV44	Uncharacterized protein	0.785	73-81	RKRXPRRXG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVN1	Uncharacterized protein	0.935	58-75	KKDTRASKKRSRTTKVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVU3	Transcription initiation factor TFIID subunit, putative	0.974	204-231	KTKKKTPRKNQKKNNKTQTKKLTKAQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXG5	Calcium calmodulin-dependent protein	0.632	125-128	KARR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYP7	Uncharacterized protein	0.998	418-456	ERAERRQXRLMARKMRIPFEKVEGXKGAKRKKSRREXRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYP7	Uncharacterized protein	0.849	222-231	APPKRRRRSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYP7	Uncharacterized protein	0.832	318-340	PAELKKGEKYYLDRKKNRIRKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYP7	Uncharacterized protein	0.818	300-316	KVKKAKIEAKKEKELEL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYP7	Uncharacterized protein	0.809	14-24	KLGKRRKXNPX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K010	Transcriptional activator	0.885	117-140	RRNKKRSEKRQALKILQEERKTKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K099	Aaa family	0.674	66-71	KKKSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y6	Protein gcn20	0.988	135-157	DKRKLKKAEAKIARKLAKKKDRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K190	Ulp1 protease family protein	0.978	4-21	KERKKLKRLKKSQRKGHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D7	Ykl027w-like protein	0.659	167-172	RRRLRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1R6	Elp3p	0.657	5-9	KGKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2T9	60s ribosomal protein l32	0.827	9-27	IVKKNTKKFKRHQSDRFKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U9	Uncharacterized protein	0.899	48-84	AEQEKRRRQVEQKRQQKAEQRKSEEQASPRRTRHRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2V2	Uncharacterized protein	0.918	3-21	KKKTGRAKSGEAKKNRSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K464	Uncharacterized protein	0.87	18-34	RKKKSYFKRKMNKLRHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSM7	Snf2 family helicase	0.927	198-208	RXKRKPRKKFN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSM7	Snf2 family helicase	0.613	75-77	RKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSR5	Uncharacterized protein	1	204-260	PKSKGKTRKSKRRKKAVKKKASSTKKVLEKKKKLGTIRKAPSDSSYRRVSTKKLHPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF9	ERF-3	0.817	370-384	GTNRKSKRAPAFAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTN5	Kinetochore protein nnf1	0.992	5-38	KGKVGXKGRSGRPELKXRGKKVAKSVHSKSRREK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTV7	Zn finger family dna binding protein	0.962	115-124	SGKKKRRRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTV7	Zn finger family dna binding protein	0.91	155-174	RKKHGRKRLPSEFKELRRRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU87	Rab gtpase	0.712	183-190	KRRRDRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG7	Gram domain protein	0.963	492-514	RKKVQXAGKEKSKRKSTSXKKRV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXT9	Pre-mrna splicing factor	0.856	100-110	PAPRRRKRWAP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYR4	Non-specific serine/threonine protein kinase	0.783	273-282	KKNKHRSKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ53	Putative compass histone methyltransferase component	0.749	91-99	DKKKFKPAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ67	H/ACA ribonucleoprotein complex subunit CBF5	0.996	418-473	KDGKIEKSEKKEKKEKKSKEDKSSDEHKHHHHKHEKDHKHHHKHDKGEKKSKKRKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ67	H/ACA ribonucleoprotein complex subunit CBF5	0.753	356-363	LKKKKLIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ67	H/ACA ribonucleoprotein complex subunit CBF5	0.605	485-485	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZH0	Uncharacterized protein	0.861	124-137	RKPSVRARRXHRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL9	C2h2 zinc finger protein	0.985	40-54	SRKKKEKERERRKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K124	60S ribosomal export protein NMD3	0.968	409-430	KRSNKRXRRNWKLKRMAREKEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K158	Spt5_N domain-containing protein	0.735	121-126	RRKRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K236	60S ribosomal subunit assembly/export protein LOC1	0.985	115-148	ARSERRRASRLKKRLSKNVGAESGSAKSKKPKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K236	60S ribosomal subunit assembly/export protein LOC1	0.98	34-44	IKKKGKKKGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P6	Vacuole biogenesis	0.987	126-153	MRRLEKERRKLNKRPNAFKGEAAKRKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P6	Vacuole biogenesis	0.893	18-33	RPKKGRVHLRKMKKLG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2T4	Atp-dependent rna helicase dbp9 (Dead-box protein 9)	0.997	536-564	SNGRKRRRGGRNGKDWKKRKVDPLKKFRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3V8	C6 transcription factor	0.97	680-703	HLNHEKHRKRRSQSARPSTKKAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQQ3	Glutamate decarboxylase	0.804	8-21	KRSRQRKKEHPGSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRN6	General transcription and DNA repair factor IIH subunit TFB4	0.97	187-209	KRKPRVLPLLKKAKRKRNSSTPD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRN6	General transcription and DNA repair factor IIH subunit TFB4	0.621	212-215	PVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS45	Uncharacterized protein	0.981	20-34	IKMLRKAVRKKRKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS45	Uncharacterized protein	0.661	99-103	GPKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSH7	Atp binding cassette transporter abc1p	0.702	816-822	KLRKEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSL7	Eukaryotic translation initiation factor 5B	1	3-64	KRKRRRDWKRRRRRERKXKRPXKRLRNXKKEKEKAKIAQLKKEGKYLTKKQXRERAIAAKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSL7	Eukaryotic translation initiation factor 5B	0.987	203-231	ASKEVEKPAKKSKGKKSXSPEPKAAPEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSL7	Eukaryotic translation initiation factor 5B	0.983	92-128	GKKNDEKEKEREKERKXRELKQANEKKKAEEAAASKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTU2	Essential component of the rix1 complex (With rix1p and ipi3p)	0.953	6-29	RHKKQKQKDFAKRKLKVGKLAPRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU55	U4 tri-snrnp-associated protein 1	0.936	239-251	KPKRMKRLKKKTR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU55	U4 tri-snrnp-associated protein 1	0.738	215-220	RKKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU77	Transcription coactivator	0.982	170-255	KKPEAAEKKISKXKSRSPASNSKNSTKPNGKSSSRANAKRKAVSSSAGSRKKVKSSPTVALASSRTRARSSTPKSRSSSKPKPKAT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU77	Transcription coactivator	0.777	52-62	RSRSRRRNGKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVU8	Uncharacterized protein	0.879	83-91	KINKRKKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWT3	Uncharacterized protein	0.701	67-74	KQRKKQRE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX37	ATPase synthesis protein 25	0.789	175-182	RRLKKKGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX59	Vhs domain protein	0.985	393-423	VPVKSAAPRRPAKPLAFRVKRGKREKPAAEP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZW8	Histone acetyltransferase ESA1	0.998	95-113	PQEKEDKKHKKKKQKKKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0I5	Rsc complex member	0.809	81-108	GRPPIVDKPHEQRIKSIMRGLKKIKVKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0I5	Rsc complex member	0.766	710-724	KRRRINPRXKTIKLG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0I6	Lactose permease	0.843	538-554	AENKRAXKEKKELKELK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0W1	Hexameric dna polymerase alpha-associated dna helicase a involved in lagging strand dna synthesis	0.835	10-21	KSRKPKNKRLSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0W1	Hexameric dna polymerase alpha-associated dna helicase a involved in lagging strand dna synthesis	0.83	56-67	QKXKRKLKHSSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1B1	Protein involved in the hog (High osmolarity glycerol) pathway	0.812	278-297	KEKEGNKKRDETKVKEKMRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q4	Alpha--mannosyltransferase	0.974	566-607	LRREASKRKYRQRTKQREIKNRIAQERKRRLLSSKLDEKKTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S6	Dna-3-methyladenine glycosidase	0.96	663-674	GKQGKKGRRKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S6	Dna-3-methyladenine glycosidase	0.945	535-556	KKRLKERTRSTKDRKRREDHDK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S6	Dna-3-methyladenine glycosidase	0.939	129-143	RRRRKSXGRRRSSYK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S6	Dna-3-methyladenine glycosidase	0.79	41-52	NESRKGARRRSN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T5	Dna polymerase v	0.861	292-304	KKTKKHKKNHSRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT7	Alanyl-trna synthetase (Alanine--trna ligase)	0.853	47-60	KAKKGXKSKXXKXS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX0	Pre-mrna splicing factor cef-1	0.989	382-411	KPAPKKIRRHNAEHYRKKKEKQLKKELAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX0	Pre-mrna splicing factor cef-1	0.974	274-289	SQRKKERKRAKGGKQA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX0	Pre-mrna splicing factor cef-1	0.908	179-189	GKKAKRKARER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTB4	Putative compass histone methyltransferase subunit spp1p	0.919	246-265	KXGSKRNRNGKNGKASKRXA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU97	Protein puf6	0.656	87-92	RKKNRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUM7	Transcriptional accessory protein involved in tbp (Tata-binding protein) regulation helicase mot1	0.623	510-513	KRRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVK1	Leucyl-tRNA synthetase	0.778	949-954	KKKKKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVK1	Leucyl-tRNA synthetase	0.763	171-182	AKKSKVKEKAGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVK1	Leucyl-tRNA synthetase	0.683	149-154	RKKKEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM0	Bud formation and morphogenesis	0.965	394-417	KPSKRKLDSPASIKASKRKKVKRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY88	Ribosome biogenesis protein NSA2 homolog	0.998	22-77	ERKRKKEARESHRIAKDAHRLKGWRGKKFAKKRYSEKVAMKKRIKAHEESKLKGTP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY88	Ribosome biogenesis protein NSA2 homolog	0.849	138-150	RSGKSKRKSWKRM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYB9	Putative translation initiation factor subunit	0.999	1301-1329	QKEKEERKXKEGKKEKXGRKXKQKEKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYB9	Putative translation initiation factor subunit	0.995	167-182	EDKKEEKRKRRRRKWK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYB9	Putative translation initiation factor subunit	0.982	1006-1019	KKSRKSKKKNGKKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYG5	Dna dependent atpase	0.837	21-27	GKRKRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYG5	Dna dependent atpase	0.615	812-814	ARK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZY7	Vacuolar protein sorting-associated protein 27	0.927	237-253	KKTSNKKSHKKHKSXKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J4	Sac3 ganp domain protein	0.986	62-86	KQKQKRLAKLERKRMRRAMRKAALK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1K0	Part of small ribosomal subunit processosome (Contains u3 snorna)	0.765	66-76	SRKSKKNGGKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U2	Putative phosphatidylinositol kinase	0.961	2460-2478	QRKRARRNAKKEHSRLKLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U2	Putative phosphatidylinositol kinase	0.601	1942-1943	RR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRH0	Dna topoisomerase ii	0.874	187-204	TSKLRTMKPQAQRKRQRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN5	Magnesium transporter alr1	0.836	195-210	RVPKKKPSSGXRHRSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU14	Kinesin-like protein	0.998	379-464	KKEKNEKSEKSEMKRVKRMKRVKRMXRVKXMKXXKKNXKXEKSEKNEKSEKNVKSEINERNEKNLKSEVKKXAKXEXNRXNXKNEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUN7	Intersectin 1 (Sh3 domain protein)	0.977	3-32	KXKKFXGNRHKLLKQKKHLKXAIEKXKAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWP2	Uncharacterized protein	0.986	225-241	PTRRRRKPRARKGXAGA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWP2	Uncharacterized protein	0.612	290-291	RR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXM2	Dna repair protein rad57	0.745	324-329	RRRKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN5	Chromatin elongation factor SPT6	0.73	633-640	KRPRRKSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0D1	Uncharacterized protein	0.843	208-221	RLRKIAKRFRGGKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0P4	Signal recognition particle subunit SRP72	0.997	620-639	AKKGXGGKXRKXXKKNKGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0P4	Signal recognition particle subunit SRP72	0.99	543-567	KSAINSNRKAAKHRRHRQKPRRLPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A4	Iron sulfur assembly	0.994	125-147	KSTRDGRRRLKRHHRRRKLRPLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K421	Rme1p	0.752	426-432	KPRKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT12	Uncharacterized protein	0.954	36-61	RLRRERRINKKRNSISQSSIKRKKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUD0	Uncharacterized protein	0.942	52-70	VSRERKKRERKLXEEQRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVB1	Elongation factor 3	0.999	1009-1031	XKKKKLSSAERRRKRKERMKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXG2	Nucleolar protein nop2	0.998	22-57	KEKRALKKRKRLDSSKASESPKKPKAAKKDKKPRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY27	Transcription initiation factor tfiid subunit 11	1	23-45	KKDPNAPKKPKKPRKPRKPRKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY27	Transcription initiation factor tfiid subunit 11	0.896	125-138	APKHKEHKKKIKLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYH8	Sso2p	0.645	247-250	KKGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZP1	Largest of six subunits of the rna polymerase iii transcription initiation factor complex	0.993	81-132	KVKFFKKPNLTLKLRKSKKVDKEKRLRKSRIGILKSRYLFEHGEKRLKRKSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZP1	Largest of six subunits of the rna polymerase iii transcription initiation factor complex	0.973	145-176	KPLMRNKKRKKLSVRNKHVSSATHPGMKKKRT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZS7	Effector of rab gtpase forms a complex with sec4p and t-snare sec9p	0.603	15-15	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZZ2	Putative membrane protein	0.999	329-356	MKGAKSKKKLKRSRKNKKGEKRSRIRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K107	Homeodomain-containing transcriptional repressor	0.915	65-97	LARRKRRRTSPAELAILKAEFKKGTTPNRARRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K107	Homeodomain-containing transcriptional repressor	0.718	32-37	RKRKRP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1P4	54s ribosomal protein mitochondrial	0.847	106-114	KKXKKEKKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K297	Faf1 (Forty s assembly factor)	0.967	230-241	GDRRKRGRRDRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K297	Faf1 (Forty s assembly factor)	0.78	40-54	RKQRLEEKRKLXGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K392	Putative fungal zinc cluster transcription factor	0.665	29-32	KRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K472	UV excision repair protein RAD23	0.713	73-83	KLRKQKSKPEP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQJ0	Uncharacterized protein	0.832	148-157	PRRRRKSSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSB0	Mrna export factor elf1	0.715	30-40	SRKPRGNFRKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU70	Elongation of fatty acids protein	0.951	296-326	KKPKKATKSTPKKXDVDEKPAARKVSKSRKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV00	Cell division cycle protein 123	0.725	124-133	KKTAKKREXR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT1	L-saccharopine oxidase	0.614	434-435	KR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWF6	Non-specific serine/threonine protein kinase	0.801	366-375	KKSSKKRKPG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX40	Translation factor GUF1, mitochondrial	0.944	526-549	ADISRKKKLLARQKEGKKLLKSRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX80	Bud site selection	0.944	5-13	KRGRKKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K070	U3 small nucleolar rna-associated u3 snorna-associated	0.986	417-443	KDSKRLKRIKSKAYRRIMKKERLKNKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K070	U3 small nucleolar rna-associated u3 snorna-associated	0.983	833-868	NXRGKGKKGRWGKREPKTTIVEGVVSRNKRKDKNRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K070	U3 small nucleolar rna-associated u3 snorna-associated	0.963	714-734	KAAAKIEKKRLKEMERRKRKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K070	U3 small nucleolar rna-associated u3 snorna-associated	0.631	6-10	KSKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Q2	Nucleolar forms a complex with noc4p	0.993	46-81	KRLKARLKEAGLTGQTNKKRKGKKHSRKTPNESRRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Q2	Nucleolar forms a complex with noc4p	0.972	103-151	RGKRADAKSKNLTVGKPGISKQRGEERRKADWKERLARKNKVGGIIDKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1B8	60s ribosomal protein l6-b	0.778	18-31	KKTRKAVRPQKLRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Q9	Uncharacterized protein	0.724	110-116	KKRXHKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y8	Constituent of pre-ribosomal ribosomal biogenesis	0.992	357-380	RKSLKRKEATKRRTKREWRERKKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y8	Constituent of pre-ribosomal ribosomal biogenesis	0.99	293-332	RKAKKKKGPANKDIGAHLKKLEKTRKELGKMDVDKRKRVE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y8	Constituent of pre-ribosomal ribosomal biogenesis	0.985	138-198	EKKKKAALNHEKNKKLAIEKSERKKKLTEEQKALKQKHLAELRSKLSAKITKLREQRKAPG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y8	Constituent of pre-ribosomal ribosomal biogenesis	0.985	400-446	KENKRRGKKDQIRQLPSHKKLSRSNIKRARAGFEGRIKTGRGKSRGH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y8	Constituent of pre-ribosomal ribosomal biogenesis	0.973	38-54	KKKRKTKEERQRDKRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Y8	Constituent of pre-ribosomal ribosomal biogenesis	0.864	214-224	ERRRKRELKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K308	Uncharacterized protein	0.871	304-321	KKKKLSPIRHKIKYPRKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K365	Muscle m-line assembly protein unc-89	0.689	431-436	PRKRKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W0	RNA cytidine acetyltransferase	0.996	73-94	GFTSHRKKREKKIKKDIKRGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W0	RNA cytidine acetyltransferase	0.978	1015-1038	KAAKVKGTVSIKSGKKKRARKSAE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W0	RNA cytidine acetyltransferase	0.946	1050-1060	GENRKKRRHHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRL7	Yjr056c-like protein	0.683	252-261	PPNRHLKKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS52	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.792	601-613	QKKRRQEQKKAVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS52	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.729	582-589	REKREKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS86	Snf2 family helicase	0.765	372-379	PTRRPKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS86	Snf2 family helicase	0.646	1339-1342	KRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA0	Putative transcription factor	0.96	616-629	HTKRKGXKYKKKKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSB1	Mrna export factor elf1	0.998	568-592	KIKKKKKRKMTRNEKKAQAERRRLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD6	Myosin-4 skeletal fetal	0.977	583-664	KGREAKKQEEIRVKNAEERKRLKEEAELKRXQEEESRKIELEESKKRIEHKKLIIXQQKEEQKRIKEERKNQKKLERLKSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD6	Myosin-4 skeletal fetal	0.945	55-72	KLAKRNLGAKKRVKKLKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYE8	Uncharacterized protein	0.951	29-48	ELRRNVRESLAKKKKVKKXN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYE8	Uncharacterized protein	0.879	192-208	RERGMRSRRRSGXKIKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ81	Tae2-like protein	0.999	962-979	KKNKGGKGSKPKKGRRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ81	Tae2-like protein	0.97	754-768	LRGKKNKLKKIKRKY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ81	Tae2-like protein	0.962	203-213	TSGKKKKKKGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K003	Uncharacterized protein	0.686	284-291	RGRKDRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K075	Nucleolar protein involved in pre-rrna processing	0.999	468-505	RNKEKERKKKRKEKIKELKKKEREERKEKHLKKGNRYM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K075	Nucleolar protein involved in pre-rrna processing	0.997	523-550	GRHHFKMKDIMKAEKLKHKKKKNRKQRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K075	Nucleolar protein involved in pre-rrna processing	0.895	603-624	QKRAKENNLKKNGDTKRKKHPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0T1	Transcription initiation factor IIF subunit beta	0.735	176-185	KKNKSKFKRF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1D0	Atp-dependent rna helicase rok1	0.994	506-562	GMPKLSKKKKHELKRNPVKRGRISTVPNIDXRKRKKRRDMIDGSKRRELLNKPKNRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3I7	Fun19p	0.993	216-230	PPKKKRRRRRPTTRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ9	Non-specific serine/threonine protein kinase	0.972	608-643	KRRSRRASRRMSKLKRLSTTSKRRSVITKHNSSRRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ9	Non-specific serine/threonine protein kinase	0.821	738-749	EKRRKEAEXKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ9	Non-specific serine/threonine protein kinase	0.717	648-655	EKRGGKRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ9	Non-specific serine/threonine protein kinase	0.67	1090-1103	VPKKEAQRAALRPI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ9	Non-specific serine/threonine protein kinase	0.639	1105-1116	GNRPEIKNTRKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ9	Non-specific serine/threonine protein kinase	0.623	1120-1125	RRFSRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF4	Transcription factor	0.988	385-415	KAKVISKKGRPXSNKRQKRIRSKTPVLRKAR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV59	Fad transporter	0.804	698-731	PKRSGSRLGLKIKDTLHRGKSLLSRKGTTRKNKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY18	Uncharacterized protein	0.996	7-32	MNKPNRSEKNKKDRKIKAKGKKAXKQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYA9	Rna-binding la domain protein	1	193-272	XXGKRRGGRGRRASKXAEDRKREKSPGKKGCWLQEREMKRRRRGRRRRRKRVRRRRKRVRKRTXKRTRKRTRKRTRKKKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM8	Uncharacterized protein	0.643	129-132	PKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZG0	Telomere elongation protein	0.813	243-261	KREASKGQAXRKKILSKGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0S9	Transcription factor hac1	0.985	24-60	PPRKRARTKEEKEQRRIERVLRNRRAAHASREKKRRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0S9	Transcription factor hac1	0.648	132-135	KRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1E2	Nuclear envelope morphology	0.873	218-239	PGGARXPIRTPVARNRRKSHKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1F3	Ribosomal RNA-processing protein 8	0.828	11-25	RKHKKQKHKADQXKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1F3	Ribosomal RNA-processing protein 8	0.687	190-199	KKALKVFKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1S6	Putative rrna methyltransferase	0.9	42-54	KEKRDQKRKRRAN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U8	Putative yta7-like atpase	0.984	512-534	AKREARRSARRRKLRARSDLRLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3F6	Vacuolar atp synthase subunit d	0.999	178-235	ARKAKIKEAKRKRKEAKKQAAKKAAEEKAAKLRAAEKKXAEQKAAEKKIAEQKAAEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W5	Poly(A+) rna-binding protein	0.962	11-58	SRGRERSPRREDARDRSRSPGXRGGYYGRPRRGGYRFREXGRPRGPPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3W5	Poly(A+) rna-binding protein	0.6	153-153	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K461	Guanyl-nucleotide exchange hops complex subunit vam6	0.729	4-12	KKKKDPKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR57	Zuo1p	0.999	95-203	RYIEKKNHSARRKRKTDDNKRLDALVKRAHSEDPRIKKFKQLEKEEKARKKWEREAGARQAAAEAKEKAEKEAAEKAKXEAXQKQKREKNKKSKEAKKSAKKKSKRTIR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN1	Sh3 domain-containing protein	0.94	231-252	RRKQALREKQKSRAAKXRSGEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ1	Translation initiation factor subunit of the mrna cap-binding protein complex	0.996	586-624	SRNGSRGGSXRRRSGRGEKSRQGSRRRKDSHRSRRGEPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ1	Translation initiation factor subunit of the mrna cap-binding protein complex	0.793	673-689	KAEHKWVPRSLRKKEKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSQ1	Translation initiation factor subunit of the mrna cap-binding protein complex	0.762	262-276	LAKIRAKKALEAQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT62	Uncharacterized protein	0.99	58-80	RTKKKKETYKKGSPRKRGRRYPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT6	Origin recognition complex subunit 1	1	305-348	KFRSSPRKKKTRAXGRPRKRKRSXKXVNTPKKRLKPRLPRVARK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT6	Origin recognition complex subunit 1	0.994	222-251	KLFKQGIDPRSLKAEEKKLKRKKKRQQQKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT6	Origin recognition complex subunit 1	0.694	33-44	KRXLRNSRRSHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXD1	40S ribosomal protein S24	0.99	99-133	KIEKPSRQQRKQKKNRNKKVFGTQRRYAAKKAKRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY04	Ubiquitin carboxyl-terminal hydrolase	0.904	199-216	RKSFFNHRHKKTKDKRKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM4	Plasma membrane atp-binding cassette transporter	0.968	356-390	XRHXRLRXRXRRLRDXNRRLXRXXXGHXXQXKAGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0P3	Trna pseudouridine synthase	0.792	28-34	KRKPKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Z1	40S ribosomal protein S25	0.975	12-33	KAAAAAAGSKKSKKKWNKGKVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K281	40s ribosomal protein s23	0.876	3-22	KGKPRGLNSARKLRTKRRNN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P3	Essential protein involved in rrna and snorna maturation	0.982	181-222	RLHRHKHHHHKSKKTRLDGKVSQKKHHKHSHSVEKEKKNXSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2P3	Essential protein involved in rrna and snorna maturation	0.81	152-171	ARKRKSSAKETSCKRRKISK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3X7	G1 s regulator	0.927	221-239	KLKRKREMQKAERIKKAKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQN0	Uncharacterized protein	0.785	62-76	RPRRNENRGRKNGRQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQT9	U3 small nucleolar ribonucleoprotein	0.999	257-288	DKSRLRRAKKRKIRNRMKENAEKKRRVLVKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG0	Transcription factor	0.698	112-119	LKKHSKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG0	Transcription factor	0.604	87-87	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT25	Uncharacterized protein	0.871	4-23	PRRMLSVRKRQLTCKKKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTR0	Uncharacterized protein	0.861	335-344	AKKKRELKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVQ1	Transcription factor tac1	0.631	853-856	KKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWD8	Bzip transcription factor	0.936	60-98	KKWVLPPRPKPGRKPSADVPTTKRKAQNRAAQRAFRERR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWD8	Bzip transcription factor	0.709	211-218	RKRRRVSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ77	Putative ubiquitin-like protein-specific protease	0.707	416-424	LKKLKEKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZM3	Putative dna binding component of sbf	0.998	87-127	RKQTSKSRTRKHKNISSSYPATKKRKNEDKPRKRGRKSKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1H1	Trna isopentenyltransferase	0.877	199-213	KSKKHRRAINKGKXK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQQ8	Mfs monocarboxylate	0.658	74-78	AKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRN8	Dna recombination and repair crossover junction	0.984	262-275	QPXKKKRKKSXKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT71	Uncharacterized protein	0.999	30-82	AKKAKKEAKKKAKEAKKKAKMAKFLAKKKKREQLAKNQAKNQATKQKKSKEKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JU17	One of five related septins ( shs1p)	0.746	535-549	KKAMQLKLKEKRLKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUL0	Nucleolar gtp-binding protein 2	0.776	296-306	KXGYKRKRAER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUZ4	Dna-(Apurinic or apyrimidinic site) lyase 1	0.996	91-132	APGRKEQLXKFEKKKKKEATTRKRKATGKNGDIASMLKRKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX10	Phospholipid:diacylglycerol acyltransferase	0.601	24-24	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K092	Uncharacterized protein	0.815	516-529	SRRKPSASRRPREA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K092	Uncharacterized protein	0.682	423-440	AKHKDGESGRSRHQKSER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X3	Swib domain-containing protein	0.97	21-43	KRKTXQTLPDKKPKKRKMIKASN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X3	Swib domain-containing protein	0.684	169-177	KSGAKKDRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3D8	Putative RNA polymerase II transcription factor	0.946	226-239	RHKEKGRSKKRRAS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR8	Chromatin modification-related protein	0.787	215-225	KKPKIVKPKKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR8	Chromatin modification-related protein	0.632	331-335	KKTRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS03	Putative u3 snornp protein utp8	0.932	737-750	RKKREQAERRRRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUW2	Sporulation protein rmd1	0.915	72-97	SAKASGAKDKRKKALAHDLGPRMKPQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV84	Aft1_OSA domain-containing protein	0.972	305-330	PRRKREXSKMAKEPANKKKKLMIRHE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVT8	40S ribosomal protein S1	0.95	5-19	KNKRLSKGKKGLKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVW0	Tfiid subunit (67 kDa) involved in rna polymerase ii transcription initiation	0.969	4-35	KTKMKMKTRMRMRTKMKXKRQEKQXRLXKAEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXQ8	Sit4p phosphatase-associated protein	0.967	37-68	KKXEDERLEQEKRKXAQKKAVKDKQKAGSKRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY89	U3 small nucleolar ribonucleoprotein	0.634	304-309	ESKRDR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY89	U3 small nucleolar ribonucleoprotein	0.603	205-206	KR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYL2	Putative set3 histone deacetylase complex component	0.969	810-870	LRXXKPSKSXSKKQXKVVPEKEPXNSLKKEXNTEXKKEPRHPKEEAKXPEAXKAXSXKHEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYL2	Putative set3 histone deacetylase complex component	0.954	987-1037	MEKKRAEEAKTEQLRKRKLEEKEQEESARKRRELEKIELAEKKKLEIXKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYL2	Putative set3 histone deacetylase complex component	0.692	969-976	RLERKRIR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYL2	Putative set3 histone deacetylase complex component	0.64	466-475	KKXKSQGTRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM3	Abc transporter	0.993	343-412	APRAARRENRHLRPNGGRKIHHHDRLVPAERARVRIHRHRRHQHPRXRPIRPPGPSLHHPAGTRLVPRHH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYN7	Dna-binding protein snt1	0.997	233-275	IKKDKENKKDEKKKKKEEQQRKAREQALKEEEERKQKARRARH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1J3	Protein phosphorylates the alpha-subunit of translation initiation factor eif2	0.894	182-191	RHHRGKKKKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1R8	Copii coat assembly protein sec16	0.996	165-206	EKSKKEAAEKRKKEQERKQKEEKERKEQEXKKKKKSNASXKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1X8	Translocation protein SEC62	0.696	257-266	KQGHKHKHRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K256	Asparaginyl-trna synthetase (Fragment)	0.986	61-104	KKAKKISQSLKRKQEKKKKLEEQEAKRAAEESAKLQAAKKIVIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J0	Uncharacterized protein	0.902	7-17	KRKRGRPSKHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J0	Uncharacterized protein	0.773	57-64	KSPKRKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K340	Ste ste20 paka protein kinase	0.676	149-158	KAHYRHRNKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S4	Myo-inositol transporter	0.811	457-465	KLAKKRKRQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX5	Uncharacterized protein	0.968	166-187	KKKNKHMATPKQKSKPSRKAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX5	Uncharacterized protein	0.947	113-126	RAKKSKAKKQRRLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT08	Uncharacterized protein	0.917	150-164	LLRPRRIKSRRRGSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTM6	Transducin family protein wd-40 repeat family protein	0.974	427-510	GRGMXDRSRDRERNRERDRDRDRDRRSDRDRDRERDRDRERDRDRRSDIGRRRDGDNYRDRRSNRGPDYDRDRGVKRGRGQXSG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTM6	Transducin family protein wd-40 repeat family protein	0.674	515-522	DRSAKRPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW0	Protein msn5	0.953	1127-1143	KRRERRKRLDASRRSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUD7	Myosin i	0.989	6-35	RKRNRNRNKTAPPPKKGGGKIKRAQYEHSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVE5	Uncharacterized protein (Fragment)	0.676	13-27	PKRQSPKTSPKTSPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYT3	Uncharacterized protein	0.935	499-512	HXSKKKKRFXKFKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYT3	Uncharacterized protein	0.836	329-356	KRKPVPKQRPKSVAQIKAEELLKKAKSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ89	Choline kinase	0.874	6-48	KHRKFARGRRSAPSSPALIPMPLSPALKARRRSLSRPIYRRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K119	Protein SDA1	0.925	123-184	REKFGSGKGKIMRPHSSTNKQKARKKNFMMMVHNRGVQGKKKMSLRQKQRVLRAHIKRQKRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S7	Pop1p	0.929	102-172	RRRTASHNVKRVPKRMRPRALKEMGLSNRTLARETKGVSTSGKPLHKSHPRGRELYRLRRKQKLLKYAAKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S7	Pop1p	0.674	650-656	NRKPKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQY5	Cullin binding protein	0.622	325-329	KKXKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT5	Uncharacterized protein	0.867	28-42	KSKGQKNGKKKVKQR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS02	Uncharacterized protein	0.9	56-71	TKKRRRFDERRGRPAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JST1	Fungal-specific transcription factor	0.846	66-71	KRKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT96	Lin1 family protein	0.747	193-212	AREAERKAKLRLAEQERERK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUE5	Formin binding protein	0.879	368-395	KRIIAKNKKLNERADRKARDSFKKMLKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUE5	Formin binding protein	0.803	513-526	EKERRNRKRTLTER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUP3	Seryl-tRNA synthetase	0.643	64-69	GKKFKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVX3	Snf2-family atp dependent chromatin remodeling factor snf21	0.993	343-362	RPKPGRKRGRKRKAESEKSA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVX3	Snf2-family atp dependent chromatin remodeling factor snf21	0.883	408-417	KRRGRRRRYK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVX3	Snf2-family atp dependent chromatin remodeling factor snf21	0.617	384-386	PKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXA5	Ribonucleoside-diphosphate reductase	0.715	117-122	GRRRKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXI0	Golgi-associated retrograde protein	0.823	36-50	RISRRSISXHPKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXN1	Lyr motif-containing protein 2	0.783	11-20	RRIRHKPRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZC6	Uncharacterized protein	0.96	271-281	KKKTKKGRKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K061	Constituent of 66s pre-ribosomal required for large ribosomal subunit biogenesis	0.984	535-550	GRHKRRAKKGKHGGKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K061	Constituent of 66s pre-ribosomal required for large ribosomal subunit biogenesis	0.778	149-157	GKKAKEKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K069	Uncharacterized protein	0.82	64-71	KKSRKRKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2U6	ATP-dependent 6-phosphofructokinase	0.701	219-224	KKPKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K326	Tyrosine--tRNA ligase	0.986	300-334	SKNNKQKKQKKQKNRGSRYPGKKDEEKETEKVSKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K326	Tyrosine--tRNA ligase	0.675	184-189	PKKVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M8	Na(+) h(+) antiporter	0.996	519-542	LRRRRLKQRRLRQVRRRKKKELER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M8	Na(+) h(+) antiporter	0.979	644-667	SKEKLQQIRERKEXRRRKRLSKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M8	Na(+) h(+) antiporter	0.96	1125-1152	KAEGQARRRRREGSMTRRMRASKKADKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M8	Na(+) h(+) antiporter	0.739	1025-1039	RKDAREAARARLRRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M8	Na(+) h(+) antiporter	0.692	916-921	KRKGRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3N3	Dom34-interacting protein 2	0.663	68-76	KKATXKRTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3R3	Protein required for s phase progression and telomere forms an alternative replication	0.842	741-764	YERIHKIRILKRXGEESKLRKNRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3R3	Protein required for s phase progression and telomere forms an alternative replication	0.79	375-389	PRKRQQFLKRQRKKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3R3	Protein required for s phase progression and telomere forms an alternative replication	0.63	45-47	KKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQU1	Fungal transcriptional regulatory protein	0.975	31-47	FKEEHRKKAPKXRKGKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW0	Ymr244c-a-like protein	0.775	76-86	KRPFDKKKAKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT10	Gtp binding elongation factor 1 alpha-like protein	0.787	111-137	XKNARSSIGINRLKRNRSPSADGKPKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT10	Gtp binding elongation factor 1 alpha-like protein	0.611	76-78	RRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT10	Gtp binding elongation factor 1 alpha-like protein	0.602	80-80	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT63	Exonuclease 1	0.814	228-246	KGRKDKDKKNKDXEDKNSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA1	Cell wall biogenesis protein	0.914	606-628	NKNGKYAKRNGGGKGGRPKIXWF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA1	Cell wall biogenesis protein	0.781	479-492	REKEEKKRIKDYKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA1	Cell wall biogenesis protein	0.604	498-498	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTF1	40S ribosomal protein S7	0.606	112-113	KR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTR9	Atp-dependent rna helicase dbp7 (Dead-box protein 7)	0.737	208-218	KKKSEKARIRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX6	D-lactate dehydrogenase	0.632	91-94	KRPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV41	Mitochondrial import inner membrane translocase subunit TIM44	0.938	193-207	QRRKRREREKLKEPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVW3	Nonsense-mediated decay protein 4	0.983	391-409	KSXKSKGYKKKRGFKKKSS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX97	Pre-mRNA-splicing factor CWC26	0.925	19-30	KRIKXSKKRKHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX97	Pre-mRNA-splicing factor CWC26	0.735	150-160	RAKKDKIEKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX97	Pre-mRNA-splicing factor CWC26	0.618	58-60	KKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXE7	Uncharacterized protein	0.953	823-839	RKQERREKKKKXSFGRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXE7	Uncharacterized protein	0.901	535-556	SRKMRKWREKEAKLSARAEKKQ
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXE7	Uncharacterized protein	0.673	591-597	RKHXKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY79	CCHC-type domain-containing protein	0.936	267-285	QRNKVAGGDNLKKKRKKNL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY79	CCHC-type domain-containing protein	0.625	260-263	KRER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYA3	Uncharacterized protein	0.991	696-709	ENKKKKKRKNKEKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ74	Uncharacterized protein	0.951	129-152	GRRGGGRKNGPRRGNNGSGRRDRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZU9	Alanine--tRNA ligase	0.669	860-865	KKRQKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1F4	Uncharacterized protein	0.751	208-215	GARPRRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K242	Bud site selection protein	0.645	310-316	RRSRPSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2K1	C6 transcription factor (OTam)	0.928	150-167	GETPRGRRRKSPPQPRTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G2	Uncharacterized protein	0.996	69-107	RFENRSKNDQRHKKHKHGHKHSSKRKEHRESKKEEAKKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G2	Uncharacterized protein	0.965	43-63	KRVKGQAIXKRKTRKRXRDPE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G2	Uncharacterized protein	0.772	9-14	KKKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Y2	Putative pheromone-regulated membrane protein prm10	0.982	348-376	RNKRXAKYGKHAGNKKXRMMKKLXPSRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR40	Yil151c-like protein	0.909	375-388	KERKERKDKHKKTS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS72	Exosome complex protein	0.994	175-201	RQKSKKSGSRKASRRHRSKERSRHVKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX9	Chaperone protein	0.776	589-596	XRKEKKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX9	Chaperone protein	0.624	233-236	EKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTX9	Chaperone protein	0.603	224-224	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUJ8	60s ribosomal protein l13	0.937	170-197	LARSKKRYLGIREKRAAERAAAEAEKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX02	Rna binding protein	0.999	533-547	GPPKKKKKKKKKRRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXT8	Maintenance of killer 11 protein	0.998	400-417	KKRKRKARKQRKREKEKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYL7	Uncharacterized protein	0.744	4-21	RLSKVXKNXXKSIXKKSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZB3	Uncharacterized protein	0.985	69-107	KIRKEDAALEEKRKQEKERRRKIAERFREQKEEKLQKEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZB3	Uncharacterized protein	0.978	146-222	RPKKTKFKELTAEERANEKQKKLKEKLALVRELNKASQEKGPVKVKLLVKRKFDVPVSRISSRRNKWLRRKSIRRRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZH9	C2hc5 finger protein	0.858	266-274	RXKGRKKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZH9	C2hc5 finger protein	0.705	143-156	KNTKAGELRRKNAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZH9	C2hc5 finger protein	0.678	298-306	ERKRQIEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2I6	Gtpase-activating protein for sec4p and several other rab regulates exocytosis via its acti	0.723	48-53	RRKRKW
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2R6	Uncharacterized protein	0.859	252-271	KLKFAREKLHEKREALKKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2R9	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase	0.869	216-238	QRKKQMKKLAEGDKHKKEVEKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2Z5	Mitochondrial ribosomal protein of the small subunit	0.926	272-290	NEERRKQRRAAKXALRRAV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K475	Protein that recognizes and binds damaged dna in an atp-dependent manner (With rad16p)	0.904	108-116	EKARRKRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW4	Histidine--tRNA ligase	0.941	29-46	KQVKSDHARKGKKKPHHF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQW4	Histidine--tRNA ligase	0.829	343-355	AEKKAKAKHHKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS75	Rsr1p	0.857	236-242	KKRKRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS83	Choline phosphate cytidylyltransferase	0.695	341-347	KRKGWKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSS5	Ribosome biogenesis protein	0.994	257-290	DKXHSVRKKQKLERKQEQRENIEKKKKKHXRKVR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSS5	Ribosome biogenesis protein	0.655	122-127	RKKHGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSV1	60s ribosomal protein l24	0.998	57-133	KQHKKGISEVVQKKKSRKVVKHQRAIVGASLELIKERRALKPEQRKVKKAAAIKADKDKKKADKEXRKAXKARRIAA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT81	Uncharacterized protein	0.839	614-637	PKKRKPATEQHKSXSXGRHRRSLL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT81	Uncharacterized protein	0.614	642-645	KNKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXM7	Uncharacterized protein	0.999	52-216	KRKKEKEEKERKRKEKQKEKKRLQQQXREQEKKRREAEKLEKEKKEREEQIRKAEEGRKRKEAERKKKREEEMVRKKKEKEKKEXERKKXEEKKKRVEEAKKKKLEEQRXLEEKKRQEEEQRKLXEKKKQQELERKRDEEAKKXEAENERVRRERERXXXEKXKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYM0	Alpha--mannosyltransferase	0.643	230-235	KKGVRI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZV6	Protein required for mismatch repair in mitosis and forms a complex with msh2p to repair bo	0.755	127-132	RRKRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZV6	Protein required for mismatch repair in mitosis and forms a complex with msh2p to repair bo	0.671	211-218	RKKXIAHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZV6	Protein required for mismatch repair in mitosis and forms a complex with msh2p to repair bo	0.642	446-450	RGKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K024	Transcription initiation factor IIF subunit alpha	0.847	128-140	ARKRKQVIKRKTR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K024	Transcription initiation factor IIF subunit alpha	0.663	85-98	KEDEKKNAQKIQRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0J4	Phosphoinositide-specific phospholipase c	0.827	88-98	KGRRGKQRKPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0T2	Putative peroxisomal membrane protein pex30	0.721	280-298	KTNKKLKEVTRKATGGGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1L0	Uncharacterized protein	0.997	17-42	KRKXKKARKSKKSKELKDXXDEKKRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1L0	Uncharacterized protein	0.851	198-216	TKRKGDPKDNIKKDAKKQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1W1	40S ribosomal protein S26	0.961	85-108	RVRSREGRKVRRPPVRRRYNAEKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1W1	40S ribosomal protein S26	0.867	3-18	KKRASNGRNKKGRGHV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2F9	Subunit of the tho complex	0.99	475-526	EKRKQKQADERKKQAEELRIRREKSRKLDQERRKREVEKAKVEAEKARKTTI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M9	Atp-dependent rna	0.999	3-54	KKNHAKKSELPKKGKKGKKNDKSDEKESKXKSEREIKQEARQKAREKRQKGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL1	Bdf1p	0.998	459-484	QLKKEWMKKHHSAKRLKRRRRRRAGG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL1	Bdf1p	0.866	557-581	GKGTKQRRRKSAQSEEDKIRSLKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL9	Hemolysin-like protein	0.807	482-495	RKKEKKIGLRINRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQL9	Hemolysin-like protein	0.731	719-731	KRRKSSXWKFAGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQM0	Ydl025c-like protein	0.903	273-284	LEEKKKLKKEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTG8	Uncharacterized protein	0.686	21-30	RRTQRSKRGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUN4	Pre-mRNA-processing protein 45	0.872	144-155	IARRERRKRAER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUN4	Pre-mRNA-processing protein 45	0.655	86-99	KRKAELKHEIERKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG4	Srp40p	0.958	232-262	XKKRKRDEKSDSKETXKPAKKXQKGIPAAKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG4	Srp40p	0.938	60-75	SKNKKEDKKEKKKEDK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG4	Srp40p	0.627	19-23	KGFKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVI8	Protein involved in positive regulation of both-beta-glucan synthesis and the pkc1p-mapk pathway	0.85	441-453	GRRRARRSRSGAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXA3	Uncharacterized protein	0.997	6-52	KATKKFNKKHLKKTLEKRNKAKEYKRRIGNKKALREEKAKNRANGRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXA3	Uncharacterized protein	0.795	77-89	XKTKKGSKLXKKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXA3	Uncharacterized protein	0.65	184-188	RTRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZE3	Mitochondrial inner membrane protein	0.997	441-466	RNEKAEEKEKEEKKKKKKKEPVDVKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZT4	Transcriptional coactivator p15	0.991	130-149	RPKKRSRDERSKKSRKRSKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K299	DDB1- and CUL4-associated factor 13	0.907	403-436	IRRIRRHRHLPAVIKRARDIKRTEIESIKRKEEN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2L8	Cytosolic j-domain-containing protein	0.814	170-185	QKKFKKXEEEKKKQER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S3	Rna helicase	0.978	168-181	KERRAEKKRRRKEI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S3	Rna helicase	0.861	93-112	KRAIKRATSKKLSAKLKGKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3E7	Actin-related protein 8	0.796	27-36	EKRREGRKRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3E7	Actin-related protein 8	0.656	102-105	KKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3K0	Uncharacterized protein	0.864	206-219	KKALIKHKKKYKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3M1	Uncharacterized protein	0.844	136-152	RGQKVRVQXRRTRKKXR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQV5	Uncharacterized protein	0.98	9-32	KKKKKYERMKQAKAKAKSSRKTSH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQV5	Uncharacterized protein	0.734	121-133	KKRQKXAERGRGG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQV5	Uncharacterized protein	0.72	45-52	EKKKPGHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRA3	Gata transcription factor	0.616	293-295	RKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSG4	Polyadenylate-binding protein	0.684	412-419	SKRTKTRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSV3	Uncharacterized protein	0.787	21-37	KNKRLKLRLPPKFMKKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT89	Activator of forkhead-like transcription factor	0.922	157-187	QRRARAXKAAKRLRYGDRQAAHKXLGGKGMK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTA0	Nuclear migration	0.813	237-254	QKRKAEKTVKIPPLKKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD4	General amino acid permease	0.645	79-82	LRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVL1	Sulfite reductase beta subunit	0.796	169-175	RRRRRRP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW34	Essential nucleolar protein that is a component of the ssu (Small subunit) processome	0.999	55-108	KRPERKRKRGPKGPNPLSMKKKKRKMADVVAKKDNSKSEGAKKTRKRRHRRRGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXM0	Duf221 family protein	0.866	223-262	KLQKMLKKRAKLAGKIEGGVSKVLCKAVKLRNKAEKKHKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXW5	Bud site selection protein	0.996	164-196	KHRKNRRGQRARRKIWEKKFGKNAKHLVKEREE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXW5	Bud site selection protein	0.95	211-253	RVEKRAEKQKKHEEWMEKQKEKKKEIEALKNKPLHPSWTAKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYE7	Serine threonine-protein kinase nrc-2	0.999	6-71	EKKGKEXREXEKKEKEKKEXEKKEKEKKEXEKKVDKKEKKKVXREKKEEERKDKKDKKXKQKKEKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K041	Single-stranded dna cleaves single-stranded dna during nucleotide excision repair	0.72	19-24	RRRRKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0V7	60s ribosomal protein l7	0.964	17-51	RKRKNALRLREVKKLQAGERAAKRLARKNSKNQKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S1	Mitogen-activated protein kinase kinase kinase	0.859	1382-1393	EHRKRKPLRSKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S1	Mitogen-activated protein kinase kinase kinase	0.745	1037-1045	RSKLKKRSP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S1	Mitogen-activated protein kinase kinase kinase	0.653	1427-1442	KRKAVMRQSSARRGGN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S1	Mitogen-activated protein kinase kinase kinase	0.607	1445-1446	RR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K364	Uncharacterized protein	0.892	219-230	GKKKKSKNRAFM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K364	Uncharacterized protein	0.769	101-119	AKPIDKXPVHKTKAKSKIA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K364	Uncharacterized protein	0.73	234-242	XDARKKGNR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3B9	Putative nuclear rna processing factor	0.906	66-90	NEKRKRFKQXAKEPAAARPPGFNKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3B9	Putative nuclear rna processing factor	0.904	1051-1066	KPKVKFPPHMQHKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA4	COX assembly mitochondrial protein	0.998	69-90	RRRRKIIRKKAERKKFEEKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSA7	DEHA2G18788p-like protein	0.94	73-90	KSRKKTASGKVKKIKKAD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI2	Px domain protein	0.852	299-308	KAKKLRPRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTK0	Chromatin remodelling complex atpase chain isw1	0.971	660-670	DPKPRSKRRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTV8	Putative transmembrane protein	0.965	365-386	RKAEINKIEHHHHGKHRKKRKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUR6	Casein kinase ii subunit alpha	0.959	65-78	KALKPIKKKKIKKE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVF9	Hec ndc80p family protein	0.826	437-444	SKXKKRIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWZ1	Zn(2)-C6 fungal-type domain-containing protein	0.619	32-37	IKHSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXJ4	Cysteine protease (Otu family)	0.997	102-152	KREEXAKEEAAKKRKQDQQKVPHKHRNRQRERLERRKXRDEKSRRNKLERR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXJ4	Cysteine protease (Otu family)	0.936	28-43	GMRKQASKKTRKRVRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXP3	Small nuclear ribonucleoprotein	0.993	93-132	KDKKDEKEKEKKDKSEKSEKSDDKQKKNKKEKNSKKDNKD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K008	Tho1p	0.966	179-220	RKKEEAERKTREYLQKKNGEQNHGHRRHRRRFRPYARERTRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A1	Ribosome biogenesis protein NOP53	1	3-30	KSKRRKKKKKKKMRKWKKKTRKKMRHQR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A1	Ribosome biogenesis protein NOP53	0.984	152-168	IEAKRHIAKRKPKKKIT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A1	Ribosome biogenesis protein NOP53	0.978	44-74	KIKTKTKRNREKREKERQRLLSEMKKLKEAI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A1	Ribosome biogenesis protein NOP53	0.932	78-106	EKLPKIIEEENKREKEIXXKIKSGKKFKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K324	Yjr054w-like protein	0.9	109-121	ERKKRKSMMHKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3Z4	Uncharacterized protein	0.926	10-79	EKSKNVKSRNDRKHXNEQKEGKRDGHRTFGGHDADRKFGKRHSRAELDRRADSHKEKGGLSSRNHSKXNN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRI1	Diadenosine tetraphosphate synthetase	0.998	161-192	KGDRIARGXKXEPAAKTDKKKKNRKKKVKEIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUP1	Eukaryotic translation initiation factor 2A	0.984	454-476	PRRTIPGAVPLEKKSKKKRHHKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVJ9	Uncharacterized protein	0.99	282-301	FRRRRREAVKRSRRKXKMSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW07	Chromatin-remodeling ATPase INO80	0.743	460-469	XRRRAHSRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWQ3	Nuclear fusion protein bik1	0.846	281-330	LKKKIXEKDQILKEKEDKLKEKDDKLKEKDNKLQEKDDKLKEKDDKLKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXZ2	Enhancer of mRNA-decapping protein 3	0.998	67-104	PKKRKKGKKKDTEKKEKYNQQKKNSKENGKKVKSKSHK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYF7	Uncharacterized protein	0.789	32-48	KRYKALKIRKHGXDKTK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYU5	Membrane bound o-acyl	0.959	217-230	KRPGKXRKRKIPHS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ49	Brf1p	0.778	301-309	RTIEKKRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K029	E3 ubiquitin-protein ligase	0.987	99-119	RKRKKLLAKKKRDRILAKIKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K065	Rna-binding rna annealing mrna export	0.98	17-70	AKKASHTVSRKRRAPSGRVGKSNRTRSNAAAKKAAAAAIAAAALKKANKSKGRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K065	Rna-binding rna annealing mrna export	0.882	241-253	KGRKGGRSRRQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2J4	Alpha-actinin	0.882	147-164	RAGGRRQKAKWQKXRRQI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3C4	Putative patatin-like phospholipase	0.629	64-66	KKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K470	G-box binding factor	0.822	165-177	KPDGKKLHRKXKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JR25	Uncharacterized protein	0.999	180-247	KVKKRKRGRPRKHPITQKEIELKKLRSSGIKRKRGRPRLPPLETRQKSKYTRHKKKNKTGGSTENGKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRR0	Amp-activated serine threonine protein kinase found in a complex containing snf4p and members of the	0.755	327-337	RKKRHRSFFKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT9	Rho1 gtpase	0.699	191-196	KKEKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSJ4	Tom20p	0.966	38-55	FRKSINHKKRKAQKKAKM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV69	Uncharacterized protein	0.603	80-80	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG8	Rrp17p	0.999	266-301	KRKRRKKKQRKYLSKRERKIKKVKEKKRSMHRKNRL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVG8	Rrp17p	0.97	32-78	KEKRKEFLTGFHKRKLQRRKHAEEQKKEQNRLSRIEERAKIREARKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVP5	Myb-related transcription factor	0.793	246-256	KKSKKSXKSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXB0	Vacuolar h+-atpase assembly protein	0.634	132-137	RSERKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXS2	DNA helicase	0.98	728-750	PYKKRKKTKKHLGMGRGPMKPFK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXS2	DNA helicase	0.875	645-658	KGKPLKMAKRRKHE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZQ1	Hexose metabolism-related protein	0.981	388-400	ETKTSKKKRRRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZQ1	Hexose metabolism-related protein	0.665	165-172	RRRNLRRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C2	Ribosomal protein L15	0.935	63-78	RVRIRRGNRKRPVRKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C2	Ribosomal protein L15	0.655	169-176	KKYRGIKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C2	Ribosomal protein L15	0.604	50-50	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C2	Ribosomal protein L15	0.603	54-54	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2H8	Nop58p	0.999	464-516	GKEGKKEKXEEKEKKEKKEKKEEKEKKHHHHHHKKDGEKKHKEHHHKHKKDKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2H8	Nop58p	0.735	439-446	KAEKKRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A9	Uncharacterized protein	0.912	376-383	PRRKRRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A9	Uncharacterized protein	0.894	332-358	VHKKETSRRDRGITIKRKXAXKESIRA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3A9	Uncharacterized protein	0.788	290-321	RAKKHQKSXKRMELHPVEPYPKLKPIPKHKTP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K469	Uncharacterized protein	0.999	115-152	KVAPRKKIRRRKKGHAFKXRNKKKKXYKSQRERKYKMR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRA0	Ynl254c-like protein	0.87	14-40	RKREHRPGVKKLRSLSSLLRPXRQRRI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRA0	Ynl254c-like protein	0.868	63-70	KRRKRKAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSX3	Cap-associated protein CAF20	0.714	19-24	KPRRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUD2	Transcriptional activator HAP2	0.972	153-194	LKRRIARAKLEESLKIQKRRKPYLHESRHKHAMRRPRGQGGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUH0	Ubiquitin-specific protease	0.704	588-593	KKRKHX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVP3	Uncharacterized protein	0.657	151-154	KKRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW08	Hlj1p	0.687	192-197	KRKKSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX04	60s ribosomal protein l25	0.704	10-26	KRAALKGTSSKKALKVR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXS9	DNA helicase	0.893	644-655	KKVNKSPRKKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYJ3	U3 small nucleolar rna-associated	0.869	277-291	KSKRRRRNQAVKSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0A2	Uncharacterized protein	0.733	97-105	RRRERRGRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0M8	Transcription factor	0.904	146-188	GRKDGASTKKHGRKKLSNQELYQRRKAQNRAAQRAFRERKEGK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K282	Transcription factor iws1	0.855	125-133	KKPTKRRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K282	Transcription factor iws1	0.641	386-391	KSSKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRC2	Rsn1-like protein	0.896	34-47	KKAMKKLKKAEKKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRC2	Rsn1-like protein	0.724	62-72	RKKWPRLRPSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT6	Uncharacterized protein	0.929	102-136	KEKKELERKIAERKKIEQHKLEQEKTGHKNKKQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRT6	Uncharacterized protein	0.869	210-234	KPKTVKXEPKAXEKDKXXXKPKXSP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI9	Hrt1p	0.625	27-29	KKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN0	DNA replication ATP-dependent helicase/nuclease	0.873	346-361	RRKKRPVARWXGRXRV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT68	Uncharacterized protein	0.834	43-53	ARKSARKQKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTY5	Basic leucine zipper transcription factor of the atf creb activates transcription of	0.723	84-93	RQKKKNLQKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV12	Secreted protein	0.963	305-327	QRREKLRRKYERDLKLAKKGKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV12	Secreted protein	0.933	83-101	AASKKQKKRESVKHHKIRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM6	Vacuolar protein sorting-associated protein 35	0.923	289-307	RKKYKMAKAEKPPIKKQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWU4	Uncharacterized protein	0.678	121-129	RRGGERRXR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXF6	Phosphatidylinositol 4-kinase	0.869	1489-1502	KPYIRKSKAEKKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXR9	Dna-binding protein	0.851	76-88	XGKNKKGKHRATK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYX1	Transmembrane amino acid transporter	0.949	300-315	ERRRQRXRPREHRKKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZB1	Regulator of ty1 transposition protein 107	0.932	187-201	ERKHKKHEHKHKHKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZS1	Lysyl-trna synthetase	0.999	42-74	LKKRKKMRAVQAKKAAKKAARAKKEAQAPKKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZW2	Positive regulator of mannosylphosphate transferase	0.836	175-188	KGRPTKTKAKQKKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1I0	Uncharacterized protein	0.83	6-14	SRKERKKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K307	Chromo domain protein 1	0.999	85-113	GRKRRSRRSGKKKTRSGARNRKRSKSSRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K307	Chromo domain protein 1	0.885	1257-1269	PRRVRKERKPVKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K410	Vacuolar protein sorting-associated protein vps13	0.652	467-474	KRRQNRQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT95	Sporulation-regulated protein	0.604	292-293	KR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUB9	GPN-loop GTPase	0.941	310-325	RERILKNRKKREQKRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUV9	Putative u3 snornp protein utp20p	0.998	539-588	DRKTKRAQLELMNPKVAAKRRLKKHMRFRKKRRMNKDENGLYKAKRKRRV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVD9	Rna-dependent atpase rna helicase (Deih box)	0.625	5-8	RKPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM8	Protein mak16	0.961	170-180	SNKKRRRRRPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVM8	Protein mak16	0.699	26-34	RERARERKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWJ8	Uncharacterized protein	0.928	83-120	KKKHTNMISRAVKSRRRRGVSVNGRLSKRIEETIKRRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX46	Transcriptional regulator of the forkhead hnf3 family	0.952	20-37	EIRKQKLKEERKRRHRQR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX95	Protein avl9	0.652	193-201	KRLRQKQGE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX95	Protein avl9	0.616	66-68	PKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYY7	Uncharacterized protein	0.905	10-50	RGLRSRSGTRKRKEVSPGLRNARTNKLNEDPNKKRQXIGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1Z8	Uncharacterized protein	0.993	677-734	SSKKNDRKHKKHGTKHMSLMTRTTRKESKKEQKKESKKEQKQEQKKEPRKELEKDKLP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2S2	Nucleolar dead box rna helicase	0.74	10-20	RRDRRRFHKKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W8	Zinc transport protein zntB	0.814	37-47	KSKFKRRSRRY
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X8	3-methyladenine dna glycosylase	0.718	278-287	TKKVSRNKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTI5	Cation chloride cotransporter	0.961	337-354	KEKKDRKKHEKKEKEPQK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVV1	Uncharacterized protein	0.984	66-90	KELLEKLSRRKAKQKAREKVKRATR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX47	Transcriptional regulator of the forkhead hnf3 family	0.957	177-190	PKKEKRRSKKRIYK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYI4	Putative srpk1-like protein kinase	0.762	473-481	KRKSRKSRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0H2	Ribosome biogenesis protein bms1	0.776	185-194	RASKKRLKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0H2	Ribosome biogenesis protein bms1	0.754	336-344	TRTRRHRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0H2	Ribosome biogenesis protein bms1	0.601	40-40	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2K5	Uncharacterized protein	0.977	76-111	NKRDAKKNTLERKMSRFRRRPEDEAXRKGTRRRGKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3P7	Spliced mrna and cell cycle regulated protein	0.686	13-22	KKKAHMRIKS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3R9	Ubiquitin	0.72	123-128	PKKKLK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3V3	Altered inheritance of mitochondria protein 21	0.984	230-258	XKKEPSKPQSRQLGARRRARAPRGRRLPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3V3	Altered inheritance of mitochondria protein 21	0.981	116-136	EKKXXPPKPXKKRPMVPKKPS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQX2	Putative response regulator protein	0.887	168-197	NRXYRHHHHSLHSKRASLHFKSRSRKEKKL
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRK5	Uncharacterized protein	1	6-86	KRRRERRKEKREEKERAEERRREKRRRXRRKETRENKKRXEESREESREEEREERREERREEERRRKRRKKRRREKRRREK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS01	Histone H2B	0.976	5-29	EKKPASKAPAKKTTIEPRKRSKPRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JS46	Transcriptional activator hap3	0.979	30-47	RGEPRKKKKKYSKXSSKN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT16	60s ribosomal protein	0.743	92-102	SWAKKIARKER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTS0	Atp-dependent rna helicase dbp7 (Dead-box protein 7)	0.967	142-158	NDKKHRKRKARSXNVPK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTS0	Atp-dependent rna helicase dbp7 (Dead-box protein 7)	0.706	239-258	KSHSKGPREDAKSKMFRXAR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTW4	Ubx domain protein	0.889	455-482	KRDRERRIARENKQKAEXLKKQWIRWRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV08	Uncharacterized protein	0.999	58-106	AKKVKKXATKKKDLEKXEXSAKADSAGGAGAKLPXQRKRRKRKTKKEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JV08	Uncharacterized protein	0.998	147-180	PVKRRKRGRPRKNAPKAPSAGGRKAKQASALKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWC7	Microtubule-associated protein	0.982	169-203	RPEKEKRNXKEKKENKGGFFRKLFGRKEDKRSKSV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX74	Uncharacterized protein	0.984	10-31	RELXKKKKVREKSRAKRAELER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2A2	Ribosome biogenesis protein NOP53	0.855	9-24	KSRMQPSKKGKRAWRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2M3	Glycerophosphocholine acyltransferase 1	0.71	109-114	XRKKKF
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W2	Yhr131c-like protein	0.852	352-365	PKYRTVPRRRRHRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRU0	Gtp-binding rho subfamily	0.769	3-12	KKSKKKGIEK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI3	Arf guanyl-nucleotide exchange factor	0.632	128-135	RVSRSKSR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSI3	Arf guanyl-nucleotide exchange factor	0.611	116-118	KRS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN2	Uncharacterized protein	0.997	6-24	XKKRMGMXKKKKKKKMKMK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN2	Uncharacterized protein	0.984	82-105	PKKSKKKTKTNKHAGEKQKRDKHS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW74	Cytoskeleton protein	1	928-947	KSKNKKSKKRRKKKHKAKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX16	Uncharacterized protein	0.879	49-60	ERRKIXRKXRKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y7	Telobox-containing general regulatory factor	0.64	778-781	RRKI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0Y7	Telobox-containing general regulatory factor	0.602	14-14	K
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1X0	Condensin complex subunit 2	0.787	442-449	FRKGKKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1X0	Condensin complex subunit 2	0.74	150-159	RKRAARNKKP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K269	Heat shock protein hsp20	0.918	39-66	KRGNRKSLKPDDKKAVAKAPKQGAPAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2D4	Duf1682 domain protein	0.966	265-301	RERXRISKLSPNQQEKLLKKQEKRKQRRAMNKQKVRM
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2E4	Mediator of replication checkpoint protein 1	0.861	340-347	RKGKKKKA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2E4	Mediator of replication checkpoint protein 1	0.715	272-285	KHMRVKIPRKLVGR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2E4	Mediator of replication checkpoint protein 1	0.63	220-223	KKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2T5	Glutaminyl-tRNA synthetase	0.962	201-218	KPKKSGKKKQANAKKDXK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X1	Yfl042c-like protein	0.796	761-775	KKVXDARIVKRKKHS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X4	Ribosome biogenesis regulatory protein	0.981	96-125	KSLPKEKEKTKWEKFAEKKGISKKEKRSRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X4	Ribosome biogenesis regulatory protein	0.665	177-183	ERKKLVK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T4	SWR1-complex protein 5	0.973	220-246	DKPKSAPKRKLNSQRQHPNLRRKRRRP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3T4	SWR1-complex protein 5	0.694	170-179	KEPPRKIKIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSH8	Histone H1	0.999	63-157	KVNKTVIKPKKAVKKAPVKKEAKKEVKKETKKTKPAHKKIVKKAVAKKPXTHKKTSKRAPKKAVGTKKASTKKAKTTKKVSKKSSKKTKKAPRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTJ4	Putative amino acyl-trna synthetase complex component	0.999	108-163	VKEKKKKGKKGAEKEAGKGKKESQGEKKNFKPDEATIARQRAAKQAKKAKKAKAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUX9	Protein kinase and ribonuclease	0.995	519-535	KIKRRKRGARGGKKNKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JVZ6	DNA-directed DNA polymerase	0.914	214-230	ARKKAKKAMKAEKDPFK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYN9	Histone deacetylase	0.732	673-678	KKPRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0R6	Putative snt2p-like dna binding protein	0.99	3-21	KKAKKGKAKPQTRKRGRRD
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0R6	Putative snt2p-like dna binding protein	0.605	82-84	RSK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K260	Altered inheritance of mitochondria protein 23, mitochondrial	0.994	244-278	KKQISKQEKKELKLKKKHERQEKLRQRTEKKRKEE
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K260	Altered inheritance of mitochondria protein 23, mitochondrial	0.754	121-129	KQEKGKKKT
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K279	Protein-synthesizing GTPase	0.824	27-43	KDKPKRHKQIYTGKRKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2X6	Polyamine n-acetyl transferase	0.718	102-111	KGKKLNKEKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K381	Nuclear envelope protein cut8	0.876	76-97	LRRNSRDKISKGYGXRVKKRRN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K418	40S ribosomal protein S8	0.981	8-50	RHKRSATGAKRAQYRKKRKFELGRQPANTKIGAKRIHAVRVRG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K418	40S ribosomal protein S8	0.818	123-146	KKGKAADDSKKSKSLQKKLAARAK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K452	Uncharacterized protein	0.975	126-142	KPNKRRLNKRIKNKKKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JQG1	Putative helix-loop-helix dna binding protein	0.88	67-104	RPRKRRRSSQISSREELEQKRRELRAQHSIIEKKRRIK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JRP6	Hap4_Hap_bind domain-containing protein	0.999	98-129	PPRPKPGRKPSLLKNKKKKERKHTSKKKSSKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSC6	Aspartate--tRNA ligase	0.988	48-85	GKPMTKKAYKKFLKEQAKAAKKAAKAARLAKEKAEREA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN7	Atp-dependent helicase	0.983	46-67	SXGKRKXKRTHKSVRXNKARKX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSN7	Atp-dependent helicase	0.982	283-314	RARKRKSTRGSRRSSVKRKYSYRNPKKPISXR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JSS0	Putative mitochondrial ribosomal protein s13	0.789	105-121	RNNAKTARKLNRLDRKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JT31	Ubiquitin fusion degradation protein 1	0.997	236-256	HTLRHSKKRKDKRKSHLPKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUT3	Uncharacterized protein	0.788	351-367	KRRKGEMIRKQRLKGIP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX32	Uncharacterized protein	0.796	205-271	QRRRHXTNKSTTRAPSQLKRSNAIKRKVGWLSAHIKQFLRKLKARLYSGWRVIRHKNSVKFRSGKPR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY25	Hst4p	0.954	12-41	KKVNVKLEKQSRIGDSGRVKKEAGRRKIKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JY25	Hst4p	0.757	435-441	PKKRXRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZ61	H/ACA ribonucleoprotein complex subunit	0.998	69-150	KPKDYGPKPKRKRGPKGAGFGQRGGGRGGRGGRGGFRGGRGGRGGFSRGGGRGXFRGGRGGFSRGGGRGGFRGGRGGFHGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K001	Protein of the mitochondrial outer surface	0.871	50-63	GRRSGRAGKTKKRI
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K200	Globin, putative	0.993	308-354	KPRRKPVPXKKELPATPENAISPPEASPKKGRRRGLHSKKGRWRLRH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUB7	Rad17p	0.898	476-492	KKRRDESDKRTKGKGRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUB7	Rad17p	0.792	79-93	PKDRHRRNNRQKSKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUU3	Ldb17p	0.724	267-279	AKKLAPPPPPRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JUV6	Ymr295c-like protein	0.988	166-187	KRQPKKQEKKKKRGFLGFGKKH
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWU6	Putative chromatin remodeling snf swi complex subunit	0.988	615-637	KLKKEREREARRKKRGQTRVGRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JXZ4	DNA-directed RNA polymerase III subunit RPC9	0.913	38-47	TKSGKKKKRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZA2	Putative nucleolar ribosome biogenesis factor kri1p	0.996	549-580	GKHKHRHKHKHGNKKRRAEDAQKSDGKKRKTN
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZA2	Putative nucleolar ribosome biogenesis factor kri1p	0.994	272-308	RREKMNSRKKDRKKEQDKRRKEKQDVQKQLKQKKQKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZA2	Putative nucleolar ribosome biogenesis factor kri1p	0.869	506-521	KMKFGKKKRLSEWRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZA2	Putative nucleolar ribosome biogenesis factor kri1p	0.832	407-419	KRKQKRVEKHAKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JZL1	Uncharacterized protein	0.896	123-139	KGLRKLKLPPTKPKKHR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K0C3	Uncharacterized protein	0.902	6-22	NKKKTRKPNKSSSPSRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K109	40s ribosomal protein s18	0.661	118-127	KKMRAHRGLR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1E5	N-acetylated-alpha-linked acidic dipeptidase	0.877	165-198	KGIKXGNEKRIEKNLEKAKSRETNRESNKRAXKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K2W9	Uncharacterized protein	0.907	88-128	KKSERHRKHRKESIGEAILARILPRQHRNVRRALRRYQRRR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K305	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.834	286-308	AKVHKPRSKNRDRGFNPFGKRLS
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K305	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.603	311-311	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3F8	Uncharacterized protein	0.903	217-273	RRPKKEXKDYGYGRDERRPKKEEKGYGYGGDERKTRPEXKDYGYXRDERKPRKRTER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G0	Formin (Bud-site selection polarity protein)	0.848	1001-1010	KRRHIPRRKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G0	Formin (Bud-site selection polarity protein)	0.772	1315-1323	AKKIAKRRK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3G0	Formin (Bud-site selection polarity protein)	0.737	1717-1728	KEWAKKHSARKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3J6	Uncharacterized protein	0.998	138-227	KLKKKQKRKRALEIPQIKPLEPSKKKPKVKKSNIAPPAVPRRRKYSTRKSTVKKTEAVMKRWKESQEKKKAHETGSQRSLRSKDIERKVR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K3S5	Serine threonine protein kinase	0.687	206-212	RPRKRSP
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JTN3	Uncharacterized protein	0.99	509-567	NAKHKHWYEKKASHLKEKAIRKHXERXLAKEKRQQDKKWKKLMEKVNKHNIEMRKRRER
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JW32	Putative oxysterol-binding protein	0.849	131-143	KKKMDKRERKERX
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JWC8	Microtubule-associated protein	0.663	32-36	KHKKK
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX53	Uncharacterized protein	0.979	287-295	RRRKKKKKV
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JX53	Uncharacterized protein	0.659	208-212	RERKR
UP000004997	Brettanomyces bruxellensis AWRI1499	I2JYC8	Ribose methyltransferase	0.87	31-47	LQKKAFKEKGYRRRSKG
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K187	Scf complex f-box protein met30	0.601	346-346	R
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1H5	Nucleolar protein	0.999	393-477	KRQHREGRRGGKSQNGNHHGFSYGREREVREGKSRKLEEKKNRELEKKSKKXSKKAGKVTKPKDKKKHEKSVKSNKRFEMKLKNA
UP000004997	Brettanomyces bruxellensis AWRI1499	I2K1H5	Nucleolar protein	0.909	12-27	MRKSRQVKKPRVKKNR