ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIE0	Uncharacterized protein	0.984	213-249	KVKNKKPVYAAIKLFEKFLPKPSKEKKKEVKKDEKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M626	Uncharacterized protein	0.794	579-616	GRASATPIKSPRRSSLMKTPPSGRPSQKGVNRSGKRSP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M626	Uncharacterized protein	0.604	186-186	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM96	Pre-mRNA-splicing factor CWC22	0.968	702-831	RRSRRRRYSSDSRSPPPRRRRYSSDSRSPSPPPRRRQYSDEPRSPSPPPRRRRYSDDSRSPSPPPRRRYSGDSRSPSPPPRRRYADDSRSPSPPPHRRRYSDDSRSPSPPPRRRRYSDNSRSPSPPPRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM96	Pre-mRNA-splicing factor CWC22	0.932	41-65	YKRKRSPSPNPRDRPASPPTRRRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ60	Ribosome biogenesis protein NSA2	0.984	5-58	RKRHGRRLDYEEKKRKRTAREAHKASADAQKIFGHKAKLHHARRHAEKVQMKKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8M8	Expressed protein	0.898	61-72	RKHKGKKKHIPE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8M8	Expressed protein	0.862	212-230	RGHLNKRRELKRPQKEWKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA06	Expressed protein	0.802	346-355	KRRRKYTKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAD3	Monosaccharide transporter, putative	0.859	469-485	KESSRIRKEMKEARKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB26	Uncharacterized protein	0.812	418-426	RRRRGRPPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB26	Uncharacterized protein	0.736	449-463	KGKGKAPTAKNPRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB26	Uncharacterized protein	0.612	679-680	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBD6	Uncharacterized protein	0.706	13-19	KLKAKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV4	Protein kinase, putative	0.81	1448-1456	AKGRRRRPG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV4	Protein kinase, putative	0.67	1016-1023	REFKNKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV4	Protein kinase, putative	0.662	398-404	NKAKGKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEZ3	Rtf1 protein, putative	0.989	133-176	RARKRRKHTSVSEKASRALNVLKNKRKAKDERMQRRAARRRHSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEZ3	Rtf1 protein, putative	0.638	349-352	LKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG97	UBX domain-containing protein	0.829	288-304	KEKKIPKWLQKGLLKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGV8	Telomerase reverse transcriptase	0.998	211-232	ELSRKRKRGAEKNRKGKRKRPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJK8	Uncharacterized protein	0.88	216-225	EEKRRRKRAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJK8	Uncharacterized protein	0.82	120-133	RGKKKGASMPGRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLI8	RNA binding protein, putative	0.99	167-182	APKAKKSRARKPKRRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLI8	RNA binding protein, putative	0.969	122-139	ARIEKRKEARKARDAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLI8	RNA binding protein, putative	0.887	218-232	KAAKPRQPRKPRVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM38	Uncharacterized protein	0.973	20-53	RKTHSKKDKKAYKKGGARETDRAKKVEKLEEIRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM38	Uncharacterized protein	0.935	913-933	RAEEKAMEREKAKEKRRAGRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM38	Uncharacterized protein	0.881	861-897	LKALYKKERKGAMRELRKDNRFLAGEKAREQGEKDKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM38	Uncharacterized protein	0.774	370-375	RKKRKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM38	Uncharacterized protein	0.635	900-904	ARMRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNC4	Helicase, putative	0.816	54-62	PPRRKRPRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNL5	Specific transcriptional repressor, putative	0.923	180-200	PPPKKKSHARKQPEGHIKRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNL5	Specific transcriptional repressor, putative	0.774	330-339	GSRRRRRETG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP60	Uncharacterized protein	0.839	885-897	FKKFKRKNVPRRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP60	Uncharacterized protein	0.713	1109-1113	KRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP60	Uncharacterized protein	0.658	70-74	RPKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPN5	Uncharacterized protein	0.964	403-425	KEEREHKLRKEALKKQKLKGGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPN5	Uncharacterized protein	0.945	322-333	QAKRRPKKRSRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPN5	Uncharacterized protein	0.759	42-57	ERRKRLEEASKEARRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPN5	Uncharacterized protein	0.675	288-302	AREKRPISNPPSEKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIX1	Uncharacterized protein	0.996	100-128	RKFKKKRDKTSSKSKKSKSEKTKRIKEKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIX1	Uncharacterized protein	0.952	64-76	KDKDRKRRKPKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6V5	Protein kinase domain-containing protein	0.861	1365-1390	RRRERGRRSSLEEERGRPQEGKGKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6V5	Protein kinase domain-containing protein	0.843	593-618	RREEKVAEYAKEERRKAREAERERER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6V5	Protein kinase domain-containing protein	0.769	1278-1293	PKKPLRDVFQKKGKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6V5	Protein kinase domain-containing protein	0.611	1230-1232	QKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7R6	Chaperone, putative	0.674	242-248	KTKKTKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K882	Uncharacterized protein	0.899	814-826	RKLKKEKRKEERA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K882	Uncharacterized protein	0.855	270-287	PAPKEVKGKKDKVKSPAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K882	Uncharacterized protein	0.673	753-758	KKERKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8C4	Expressed protein	0.991	131-155	EGKRGKGRRQRQRKIAAQKKKETER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8C4	Expressed protein	0.984	101-121	RKRDKKKEKARAEALTKKRKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCF7	DH domain-containing protein	0.802	1422-1455	KSPVKTPGSVRNKAAPVRGRIGEMTKRRDVGKKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCF7	DH domain-containing protein	0.755	890-901	RPRKKVVPKNAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCF7	DH domain-containing protein	0.677	723-733	RSGNGAGRKGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDA9	Uncharacterized protein	0.676	419-430	RRRHSLRSTKRN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDA9	Uncharacterized protein	0.667	488-502	GGSRLGGGSRPGGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC8	Forkhead transcription factor 3 (Freac-3), putative	0.977	657-679	RPGRKAKARKAKLEKEAASKEAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC8	Forkhead transcription factor 3 (Freac-3), putative	0.875	335-354	RGRGKRRASQSPERGHRRRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDD6	40s ribosomal protein s23, putative	0.791	11-33	AARKLRTSRRENRWADKNYKKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDD6	40s ribosomal protein s23, putative	0.683	138-144	EKKEKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDJ7	40S ribosomal protein S8	0.97	8-30	RHKRAASGARRAHYRKKRKFELG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE30	DNA supercoiling, putative	0.988	804-848	RKAVKAVAKLKNKKHREGKGRTTSAAHAPKAVPRSPSKLTKKRTG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE44	Uncharacterized protein	0.959	320-356	KRKRSKAGNKKPFLSRHERHVPRQPGSSGRYAASKAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE44	Uncharacterized protein	0.69	390-405	HRAVVKREEAPKRFAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE44	Uncharacterized protein	0.619	362-364	SKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEF6	RING-type E3 ubiquitin transferase	0.864	244-258	RLKRGQRPPKPRGPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF83	Ubiquitin carboxyl-terminal hydrolase	0.749	75-84	KRSRKEIRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFT3	Uncharacterized protein	0.949	416-452	EKRKRTIAKKLERNGQAHLVGKAQKEKKPTKTPKAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFT3	Uncharacterized protein	0.755	787-803	KKRAFGGAPGGEGKRRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG52	Kinesin motor domain-containing protein	0.675	987-995	KKKRTLGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG52	Kinesin motor domain-containing protein	0.631	63-73	RKVSGKIGQKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGW0	S4 RNA-binding domain-containing protein	0.925	167-179	GRPGRVKRKRAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHZ0	Expressed protein	0.834	494-502	RAKKKGKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHZ0	Expressed protein	0.767	208-218	KRPGAPRKSRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJY9	Uncharacterized protein	0.81	184-195	KKWKKIAKNRLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLK9	Septin ring protein, putative	0.771	189-196	RRKTRKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLP5	Expressed protein	0.891	214-226	RKGKEEKRKRLRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN02	Establishment of cell polarity protein, putative	0.999	157-191	RRRKRGEMRDRRRNERKEERRKEREGKAEKKEKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN02	Establishment of cell polarity protein, putative	0.999	268-375	KRAEIEEKERWAKAEERAKGGKVADQEKVLKNAVKRKEKTKTKSSKEWAERKRELEKSNAISLKKRNDNIAKRAEERRNKRTGGSKDKGKGKGSKKGRPGFEGKKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN02	Establishment of cell polarity protein, putative	0.928	48-69	KNKKRKTGEEIKENKKKVKQAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPI0	Expressed protein	0.65	342-345	KRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LJ21	Uncharacterized protein	0.999	152-171	SKAKKGKGKGKGKGKGKGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7H1	Uncharacterized protein	0.613	309-312	KEKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7H5	Acidic laccase, putative	0.672	622-628	RKKSKVP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7W8	Ribosomal protein L13, putative	0.951	28-43	PGKKKSRRVARSKKAL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7W8	Ribosomal protein L13, putative	0.778	190-205	QRKKRLAEKEAAEKTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCE0	Minor histocompatibility antigen h13, putative	0.995	423-434	GKPRKKKGGKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB9	Expressed protein	0.985	282-305	KAEKKKRKQAKAAARARAAAARER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB9	Expressed protein	0.982	605-617	GKRRKGKKGKGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB9	Expressed protein	0.709	479-496	HQEAAKKAALERAERRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB9	Expressed protein	0.6	477-477	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX1	Nucleoside-diphosphatase, putative	0.691	72-78	GKGKGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX1	Nucleoside-diphosphatase, putative	0.653	650-654	GRRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGP1	Uncharacterized protein	0.89	96-106	AKVKKARKKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGR2	Uncharacterized protein	0.882	417-450	KLAERISGPRPAGRPRSPSPARSARSSVAPYRGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIW9	RING-type domain-containing protein	0.991	559-591	RDARRKARARKELEEKKRKAAAFRGQTRRKYAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM92	Foie-gras_1 domain-containing protein	0.77	335-343	KRVRRKRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMD6	Zn(2)-C6 fungal-type domain-containing protein	0.784	235-243	RSGQKRRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMU3	Threonyl-tRNA synthetase	0.986	60-75	EGKKKEKKEKKDKKGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN01	Uncharacterized protein	0.989	457-476	GSKDGRKGKGGKGGKGKRGW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN01	Uncharacterized protein	0.831	412-425	GKKKGMEGRKKGDA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN01	Uncharacterized protein	0.639	364-368	KREKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNV5	Structural constituent of ribosome, putative	0.65	45-52	KRTKYRKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP65	Cell division cycle 2, putative	0.699	63-71	KRRLVRPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM66	rRNA-processing protein CGR1	0.995	53-127	EKRMEKEKAQQAAKQLEKELKEEKENERQRKVNIIKERRARKEEKQREEELRAKMSAKKLQRMKKREGRSKKING
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM66	rRNA-processing protein CGR1	0.698	28-41	PGKAHKSAKTALRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM98	Pre-mRNA-splicing factor CWC25	0.999	163-203	RKQLRAAKKAKETKGREGESKEERKARKRAEKEERRKSKHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM98	Pre-mRNA-splicing factor CWC25	0.82	244-259	RSRTRSESPKREKKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO60	Putative lipase ATG15	0.877	93-107	TRKKLIRRPKVRPPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO60	Putative lipase ATG15	0.638	482-486	RGPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E6	Ribosomal protein, putative	0.993	1051-1067	VGIRKRKERAKKKRAGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E6	Ribosomal protein, putative	0.967	1256-1286	KKENKMRERKKMRKQLGEEFRAKRAGGDIKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E6	Ribosomal protein, putative	0.829	1303-1322	GKKGKKGNFNLTNKKKGSRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7S9	Uncharacterized protein	0.671	99-104	PKKGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA10	Peptidyl-prolyl cis-trans isomerase, putative	0.999	246-277	RERRRRRKDRKRSKHAKHSSKSKSKSRRRSSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA10	Peptidyl-prolyl cis-trans isomerase, putative	0.919	199-230	SRSRSLSRSRSPSRSRSRDRSVSIKRRSRSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA10	Peptidyl-prolyl cis-trans isomerase, putative	0.675	182-190	PPPKSRARS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA37	Nucleus protein, putative	0.602	82-82	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAP5	WD_REPEATS_REGION domain-containing protein	0.94	787-805	KGEKEKEKREKKREATRAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAP5	WD_REPEATS_REGION domain-containing protein	0.919	965-977	PKPKKTKAKKEKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB01	RNA polymerase II subunit A C-terminal domain phosphatase	0.766	581-593	RKERSKSPNKHRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBN3	Zinc-finger protein, putative	0.959	214-239	AKPSKGGKGKTKATPGTGKGKGKTKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBR4	Peptidase, putative	0.886	68-82	RKASARKRSVERRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBW9	Ribosomal protein L19	0.96	59-113	SRARAREHAAAKRAGRHTGFGKRKGTAEARMPTKVQWLRRMRVLRRLLKKYREAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBW9	Ribosomal protein L19	0.899	142-180	IHREKAEKLRTKHLAEQQEARRVKNKAMRERRANRLAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBW9	Ribosomal protein L19	0.61	135-136	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX6	Inositolphosphorylceramide synthase, putative	0.978	420-439	GKKKGKGKQTAKKPKMKEPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDY7	DIS3-like exonuclease 2	0.957	97-140	KKGKGKGKNQDKEKESEKKGASSEVEKPQKNNSQKGRRSASGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDY7	DIS3-like exonuclease 2	0.851	898-907	KDKEEKKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDY7	DIS3-like exonuclease 2	0.657	993-1001	EREGEKARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHL3	Uncharacterized protein	0.977	413-426	GKKGKGKGKGKKPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE1	Zn(2)-C6 fungal-type domain-containing protein	0.755	27-34	KSPRKKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLY5	USP domain-containing protein	0.947	178-188	PEKKGRRKKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLY5	USP domain-containing protein	0.879	739-748	GKPKRKKSKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMC1	Actin-related protein 8	0.62	184-186	KRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPB6	Two-component sensor molecule, putative	0.77	430-442	RPKGKDRSPPRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPB6	Two-component sensor molecule, putative	0.613	101-104	KRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI14	NDC10_II domain-containing protein	0.762	133-139	RGKKRKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7N8	Uncharacterized protein	0.948	639-661	EKEGKDEKEQEKEKRGEKRKAKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7N8	Uncharacterized protein	0.784	478-495	KGFEKAQAKKRNQGGKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7N8	Uncharacterized protein	0.697	416-430	RGHPARGRGAPNAPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7V4	Signal transducer, putative	0.84	1153-1168	PTKPSKSSRKEHRKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K937	Uncharacterized protein	0.864	69-91	GKRERPKATHPTKHKPRAVSSGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N7	Calcium ion transporter, putative	0.625	425-428	RKFR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAN1	Expressed protein	0.946	281-309	DRNGPSGPARDRSRSPRRDRRESWSRRRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBL0	Expressed protein	0.642	683-686	RRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBL0	Expressed protein	0.603	188-188	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBL3	Uncharacterized protein	0.862	285-298	VKIGGVRARKPRRL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCQ2	Uncharacterized protein	0.996	420-480	SKSVENEKVKALKDAKKPSKKESKSKKKIKEPTPPVEESSAEVKGTPSKSKKKEKEKEKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCQ2	Uncharacterized protein	0.949	504-527	PQKKDQKKKIKPASESKPPAKPAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCQ2	Uncharacterized protein	0.931	827-855	MKSASKDKNAESRREKERIRAEERAKKQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCQ2	Uncharacterized protein	0.695	407-416	VKKQAGKKQS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD78	Transcription initiation factor IIE subunit beta	0.952	261-272	AASKKKKKRTRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK2	DNA polymerase epsilon p12 subunit (Dna polymerase epsilon subunit 4), putative	0.828	51-61	AKKPARKRIIK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDP7	RRM domain-containing protein	0.843	166-182	KRRAPASKPRNTRPAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDP7	RRM domain-containing protein	0.839	18-35	KAKPRRSRQGGAGARRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE48	Transcription factor, putative	0.912	673-690	RKGKGKKSRGTSLKEQRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE48	Transcription factor, putative	0.614	228-231	GEKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB1	Expressed protein	0.995	580-606	RRKEAARRKKERMRKMGKDKDKDKRLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB1	Expressed protein	0.742	315-322	RRIRRPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB1	Expressed protein	0.634	115-119	KRARR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB1	Expressed protein	0.608	735-736	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI16	Bromo domain-containing protein	0.884	1391-1404	RMRAKKAARQRKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI16	Bromo domain-containing protein	0.836	339-350	GRRIARGKAKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI16	Bromo domain-containing protein	0.733	466-476	KRRSSRRRTTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJC5	Uncharacterized protein	0.999	1186-1272	KRKEATRLREEERERRKEEKKRNEEEKRREKERKLQDEKRLLQEDKRKREEERKKKREEEKRRREEEKQRKKEEREKKAKTKKGKGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJC5	Uncharacterized protein	0.822	4-32	KKKAGRLTKSQSATREEATRKTGRPRKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJC5	Uncharacterized protein	0.689	1337-1347	KRRATRAKPSN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJC5	Uncharacterized protein	0.641	1350-1359	PGRNTEKRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJY7	Uncharacterized protein	0.936	62-76	GPSDKKPTKKGRRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK04	Potassium transport protein	0.783	196-214	KKPEDHHHKHWKKGHQKLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL35	ATP-binding cassette (ABC) transporter, putative	0.989	172-185	GRKKNKKKKGKHSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLD2	BZip transcription factor, putative	0.911	474-492	SKRKSDGAARGNAKKGKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM99	Regulation of translational elongation-related protein, putative	0.801	234-245	RVRRLRKKSGIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMC0	Nucleolus protein, putative	0.992	665-695	SKRKALKKKGIKVSVKGAENGRKGKGKAGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMC0	Nucleolus protein, putative	0.971	4-80	RAKNKQGPPAPLPGSIPERTESRRQKTKKRAPSAVTNEVASRGKALKGPGASVAGGRKKGVIVGRTGKMIKGPKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH2	Ribosomal protein S11, putative	0.636	22-25	GGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP11	Single-stranded DNA binding protein, putative	0.998	14-55	KVDKKDKKSKKDEKPVPAPAPAKAAKKDVKEKKEKKSKKAKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP11	Single-stranded DNA binding protein, putative	0.99	383-427	GGRGGGGFGGRGGGRGGGRGRGGFDRGGRGGGRGRGGPPRGGART
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LID9	Uncharacterized protein	0.723	98-104	KPRRRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIQ4	Uncharacterized protein	0.996	71-136	KVAKAKAHIEKGDGKTEKKNDGSLRKRQEKQKALEAAKAKLVEKQREKRRRKQGKEVVDEKPTKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIQ4	Uncharacterized protein	0.95	27-44	QKIKGRKGKAGGTGKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIY2	Uncharacterized protein	0.849	332-342	KGKKSKKEKAI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIY2	Uncharacterized protein	0.699	73-83	RREKALKKAHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5X2	PAPA-1 domain-containing protein	0.662	126-130	HKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN14	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.754	637-644	KGRASRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K943	SET domain-containing protein	0.984	627-642	KKSKGQKKRARAKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K943	SET domain-containing protein	0.863	76-92	KVQKSPKKRSRVGLKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9F0	Uncharacterized protein	0.696	357-361	RRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9J5	Uncharacterized protein	0.649	173-176	KRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAB4	BHLH domain-containing protein	0.969	474-492	SKKRKRTAAPKAKPKTAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAD1	Uncharacterized protein	0.987	442-494	REAREARERVEREGKRDEEDKRKKETERQREKEREEREREKWKAAREQDQRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAD1	Uncharacterized protein	0.659	923-926	RKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE91	RWD domain-containing protein	0.826	173-194	EDRIRALPPKEREDYRKRRERP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEI4	Expressed protein	0.681	64-69	RGRKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET8	zf-primase domain-containing protein	0.981	312-344	KGRSSERPKITKKKKVKENSNKDDWKKHREPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET8	zf-primase domain-containing protein	0.976	566-583	RIGRSRAEKKKRRQEKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEX1	Pre-mRNA splicing factor, putative	0.998	756-783	RKLGKISSSKHGKDGKDKKDKKKKRKAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFS5	Diadenosine tetraphosphate synthetase	0.982	165-190	KEARGVKEEEKKEEEDDKKKKKKKIV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ83	Expressed protein	0.784	272-278	TKRRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJQ2	Non-specific serine/threonine protein kinase	0.733	467-479	EKKMKKVVVRRLK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJQ2	Non-specific serine/threonine protein kinase	0.682	48-59	GRERERDRERPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK00	Endo-1,3(4)-beta-glucanase, putative	0.911	56-68	RNKEKRLVRKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKQ3	Expressed protein	0.879	176-213	KKARRGPRRQANRTTGLVKGEASHRSGRQTEYRKKAGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKT3	Uncharacterized protein	0.996	76-91	SKKNKKKKKKGGEKKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KML1	Uncharacterized protein	0.966	154-170	KKAKSKGEKGKKGRGVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP41	HMG1, putative	0.995	436-461	KKESKKKKGKEEKEKPVPKAKSHLHP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP41	HMG1, putative	0.792	561-578	RKEGKSRKGNIKDPNAPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP41	HMG1, putative	0.746	392-404	RKRMSKDKGKTAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP54	tRNA dihydrouridine synthase, putative	0.999	554-595	KVRARKEREARKRKGREMAKEKAKERKKEEKAKEEREKSKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIE3	ATP-dependent DNA helicase	0.889	83-93	RRRPRRERRAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q7	Uncharacterized protein	0.866	143-158	RKKLRAKAERKDARGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8Y4	Expressed protein	0.866	134-155	KKKPSRRPLTPPILPKPLPKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB04	Uncharacterized protein	0.931	33-45	HPPRPLGKRRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB04	Uncharacterized protein	0.735	59-64	KKPKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBZ9	Expressed protein	0.806	823-838	PSPKAGKSKSGRISRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK6	Histone acetylation-related protein, putative	0.976	140-176	KGLKKSEIKKLQKDKIRAEKREAKERERLEIAERKRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK6	Histone acetylation-related protein, putative	0.956	240-254	PVKKDKVEKKKEKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEA1	RNA-dependent RNA polymerase	0.691	999-1003	KRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEU0	Ubiquitin conjugating enzyme, putative	0.617	195-198	KVKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFQ9	MAGE domain-containing protein	0.963	346-367	RRRGRGAPRERASRPQKRQKLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFQ9	MAGE domain-containing protein	0.621	127-130	GKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGG6	Uncharacterized protein	0.893	323-339	RKDRKLEAARKRQKRLK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD2	Uncharacterized protein	0.99	185-212	TQGKAKGEKNKKDVKRRAAKKDTGKHRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD2	Uncharacterized protein	0.729	87-101	MNGRGRGGGTRGRGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD2	Uncharacterized protein	0.633	57-63	KPKVPIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKN4	Uncharacterized protein	0.807	541-551	GRGRWRGRGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL01	SNF1 family protein kinase, putative	0.923	479-496	AKPGIVRVKKPKAKQKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN67	Regulation of transcription from Pol II promoter-related protein, putative	0.994	74-114	TGGEGAKEKRRSGFGWLGGKKKDKEKEKAKEEREKIGNRPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNU6	Expressed protein	0.877	65-90	PRRQGPRRRVDARPVTPRRSRLAPRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ39	Membrane protein, putative	0.928	741-754	GGKAAERRRRKRDS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ39	Membrane protein, putative	0.706	1001-1006	KKKGRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN62	Exocyst complex component EXO84	0.715	34-47	QKRMSKVGEKIKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K832	DH domain-containing protein	0.626	476-480	KSPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K832	DH domain-containing protein	0.601	1160-1160	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K854	Rho GTPase, putative	0.763	187-193	REKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8C2	Golgi apparatus membrane protein TVP38	0.857	369-381	PKRGKLRRAFRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8K8	MICOS complex subunit MIC60	0.683	72-79	PPPGRPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAM3	Acyl-CoA dehydrogenase, putative	0.906	443-464	TEKIRRKSEKLLKEGGKERAKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB38	Uncharacterized protein	0.987	366-405	KRAKYGQRRTNKGEEKGEMGRKQKIDWKRKDKREREERRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK7	Checkpoint supporessor 1, putative	0.985	336-351	KERKGEGKKGGKRKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE68	Zn(2)-C6 fungal-type domain-containing protein	0.805	27-34	ERKHKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEC7	WW domain-containing protein	0.985	179-209	RKKDKMIGTKEEREKAKAEKRRLKEEQKKRI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEC7	WW domain-containing protein	0.671	144-152	KRKEVKSVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEI8	Plasma membrane ATPase	0.697	1001-1020	KSGDTKKQEGNAKKGDNEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGV0	Expressed protein	0.915	259-284	KRAHRVSQLEKSKVEFEKKQRKKREK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KID7	1-phosphatidylinositol-3-phosphate 5-kinase	0.748	1788-1798	RVAGKGKSPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KID7	1-phosphatidylinositol-3-phosphate 5-kinase	0.739	1837-1852	KERQKRISVVRGKRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK37	Uncharacterized protein	0.998	309-335	PKKKSRVVKHEKGKGDEKARAKKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK37	Uncharacterized protein	0.77	280-285	KKKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KME9	Hormone-sensitive lipase, putative	0.653	54-62	RRGLKARDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMT6	WD_REPEATS_REGION domain-containing protein	0.997	553-581	RSIREKKERRKMKGKGGSTKRYLRKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNB9	ATP-dependent RNA helicase prh1, putative	0.95	57-95	PKSPKKRKIGQANGDLGKGKKDGAEARRREAERLLVKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNB9	ATP-dependent RNA helicase prh1, putative	0.791	297-308	GKEKIPGKKKVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNB9	ATP-dependent RNA helicase prh1, putative	0.784	39-45	AEKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNJ2	VASt domain-containing protein	0.951	244-256	KSSKKSKRRSRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNX7	Ribosome biogenesis protein NOP53	0.995	306-394	KKASKRKTTAQRNRQARQRAIEEAARQEKEKRKLANSVSSLAAFKKEVERKQKEQAEKERIAKLAKKEKERRGKQEGEKVGKYRVQKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNX7	Ribosome biogenesis protein NOP53	0.793	438-452	PKKKALKIKEFEKHA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNX7	Ribosome biogenesis protein NOP53	0.792	43-52	PSRKGKKAWR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNX7	Ribosome biogenesis protein NOP53	0.781	130-152	AAPQKKKPLLSSAEKERLKRIAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNX7	Ribosome biogenesis protein NOP53	0.711	22-29	KSKGKGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPM0	ARID domain-containing protein	0.869	482-489	GKKRKRKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPM0	ARID domain-containing protein	0.787	445-457	PRARKASSKKEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIT9	Uncharacterized protein	0.664	44-48	RKPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5U5	Uncharacterized protein	0.81	35-78	GRGPVKGLPRKQHIQKSRDPFNKPSPGLVKRLAAEARNDAKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5U5	Uncharacterized protein	0.632	304-306	KRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5U5	Uncharacterized protein	0.621	95-99	KAKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO18	Helicase SWR1	0.613	275-277	RRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6U9	Ribonuclease H, putative	0.729	37-45	RRKQKKVNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6V9	Expressed protein	0.957	104-122	ERHKKMKRRAANDRKKENP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7W3	Uncharacterized protein	0.999	482-498	GGKKKRKRREAHKRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8P7	Expressed protein	0.999	236-301	RQKRPAEGEGEDAPKKKGRPPKPPGERKKPGPQKGWKLNRDPNAPPVKKLPRDPNAPKRKYVRKAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N1	Chromatin modification-related protein	0.996	440-457	RRKKQPRGKKGTRGKARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N1	Chromatin modification-related protein	0.924	211-222	GEKKKPVKRRKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N1	Chromatin modification-related protein	0.636	335-339	SRRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA72	Palmitoyltransferase	0.753	365-373	KRKVRKKWK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB18	Uncharacterized protein	0.834	120-130	KKRGRPKVARP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCC7	DNA-(apurinic or apyrimidinic site) lyase	0.982	331-350	KPKISKGGKRAGAKRKKVAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCC7	DNA-(apurinic or apyrimidinic site) lyase	0.944	403-461	PSAAKRRAIGARTGGSKNHPDSEVKKEKGSTECRKSKKQVEAVGEKLAKIKPQKGRKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCC7	DNA-(apurinic or apyrimidinic site) lyase	0.776	265-277	KQMEKDKKSKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCM6	Expressed protein	0.891	275-288	TREKRQRRKEREAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD16	Expressed protein	0.998	449-479	KKLSKIGWKKVKEERKKKKLKMAVVKKKEKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF54	Serine/threonine protein kinase FSK, putative	0.655	493-496	RKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM4	rRNA primary transcript binding protein, putative	0.902	156-187	SPPRRRRDDGFRGGRGDRDGGRRGGGGGGGGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM4	rRNA primary transcript binding protein, putative	0.847	103-119	GRGAGGFEERPPRRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM4	rRNA primary transcript binding protein, putative	0.727	71-88	GRERDYRPRDRERERERG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM4	rRNA primary transcript binding protein, putative	0.629	46-49	RHRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH51	Cytoplasm protein, putative	0.911	397-410	KKKGGGRRWKKSLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH51	Cytoplasm protein, putative	0.652	192-197	KRERKW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIG7	Nuclear envelope-endoplasmic reticulum network protein, putative	0.829	611-624	EKKERRLEVKKRRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY6	Uncharacterized protein	0.954	491-502	KGKKRKRRLSSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY6	Uncharacterized protein	0.72	606-621	RKRTKQESRRSRESRN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL25	Uncharacterized protein	0.992	390-402	KKKKAKGKNKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL25	Uncharacterized protein	0.987	421-442	IEERERERKRARKDKGGPSKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL25	Uncharacterized protein	0.836	319-341	GAKSTVRRTSSKTGLGKGKKTRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL25	Uncharacterized protein	0.663	359-363	RPRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL98	Uncharacterized protein	0.911	921-940	IKSKKGREKNGGRAKEENGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL98	Uncharacterized protein	0.779	1476-1486	KIARRKGKAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL98	Uncharacterized protein	0.634	1047-1050	GKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL98	Uncharacterized protein	0.617	943-946	GGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLS6	Uncharacterized protein	0.999	299-319	RKKRKNAKKKEREKEKKKEKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLS6	Uncharacterized protein	0.861	4-19	KRRGSAKNKKTQRKSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM41	Nucleolus protein, putative	0.996	182-210	EKKEEKKRKKKGDKGGTGSRANSKNARSE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM41	Nucleolus protein, putative	0.714	256-263	KRLKKRLS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM41	Nucleolus protein, putative	0.711	221-227	EPKSKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMH4	Non-specific serine/threonine protein kinase	0.994	563-580	PPKKKSTRRRVRGKKKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPQ6	Conserved expressed protein	0.802	328-336	RWKGKRRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPQ6	Conserved expressed protein	0.703	579-586	KGKSRGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN28	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.987	69-94	RDRPDNKRRKPNKQDKKDKKGQNKGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN46	Eukaryotic translation initiation factor 3 subunit C	0.758	188-210	APKKMAPAKAKAVNGIRQTLKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN46	Eukaryotic translation initiation factor 3 subunit C	0.729	851-866	RRGGRGTYRGRGGRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO38	Transcription factor IWS1	0.996	164-178	ERRRKKKKRAERRRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO38	Transcription factor IWS1	0.959	209-220	GKKPKAIRRKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K708	Uncharacterized protein	0.999	776-851	KQLQKIARMRVRKEKEEKRKARREERERKRFERVVRDIAEGDEREKRRQEKEKERELQQARAREREERRQRKAALE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K708	Uncharacterized protein	0.987	1129-1158	RRLEAEAAQKEKDRAERKRRERREKEARTS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K708	Uncharacterized protein	0.986	39-77	PARSSSRRSARRGLSPSQKIPSSSPSRRRRTRSGRRRGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K708	Uncharacterized protein	0.971	951-970	RRPRLARKGRPNRKRTPGGT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K708	Uncharacterized protein	0.948	1246-1275	GRRREHVRAGRQKQGRRTGQRSKATRRPVL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K708	Uncharacterized protein	0.91	1315-1325	NKKRKRRANPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K708	Uncharacterized protein	0.613	1115-1117	RRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E0	Nucleus protein, putative	0.754	97-102	KKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA11	PH domain-containing protein	0.987	975-1030	KRQVEEEERRKREEERRKEEEERRKREEEEERERKRMEEAEERKRTVRDGLERGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAU9	DNA topoisomerase	0.981	629-660	AARGGRGGRGTRGARGARGGRGTGGRGRGGGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC56	Uncharacterized protein	0.951	331-344	PRPRPRRGKRPRTA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP6	FCP1 homology domain-containing protein	0.992	597-655	RKEAKQVRRKQTRAERKVKKNEKERELEELRRERKGEQASGEAPRKRASHLQRRHPLKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP6	FCP1 homology domain-containing protein	0.968	519-537	ARRKREERAREKAARKVRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCR9	TBP-associated factor 4	0.93	276-313	GKKRKAEGAEGKEKDGEKGKASESPLGQDRPSKKARPI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCR9	TBP-associated factor 4	0.609	225-226	KK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDZ7	Uncharacterized protein	0.893	160-173	GKKDVKEKKEKRKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDZ7	Uncharacterized protein	0.821	307-318	RKKTNRAKARKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB5	Uncharacterized protein	0.679	40-47	RKKKQGGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB5	Uncharacterized protein	0.644	324-328	RKGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KES2	Uncharacterized protein	0.964	95-109	RKDARSRGKRGKKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG31	Uncharacterized protein	0.995	128-156	RSKYAMKAKEKKEKKEEKSAPTKKRKGKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG31	Uncharacterized protein	0.987	234-342	PAEAPKKPSRPPAPPTSRRKPAPPPPASRSARPSSVAQPSAPSVPPPPPPPPPPGRPAAPPSAPPSAPSAPPPPPPPPPPVRSDGTGVAPPPPPPPPPARPPGGAPPPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH06	Aspartate transaminase	0.741	206-211	KGKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH06	Aspartate transaminase	0.726	249-254	RRKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH06	Aspartate transaminase	0.601	842-842	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH08	Ribosomal large subunit assembly and maintenance-related protein, putative	0.901	247-271	KRIAGEKYRVRKEGEKDREERRKRV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI03	Expressed protein	0.69	957-962	KKKARH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI91	Uncharacterized protein	0.928	27-41	KFGRVTKPGKRKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ22	Uncharacterized protein	0.999	408-446	EKRKDKGRRREEQASQRRGRRSRRRDRRKYGHRRRHSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ22	Uncharacterized protein	0.937	377-394	KGRSTRRPRPRRGLRDHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJH7	DNA helicase	0.977	1030-1051	ARGKKRLGMGRPAPWGSKKPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJH7	DNA helicase	0.606	644-645	RK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJV7	Uncharacterized protein	0.611	388-390	KRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJY4	Obg-like ATPase 1	0.886	55-74	LKKMAPKKKVVEEKKIRLGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE4	Tetracycline efflux protein, putative	0.983	684-702	EAKAWVESKKAKRAKKRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL06	CP-type G domain-containing protein	0.975	562-577	RKKVKSLAKKAKKRRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL06	CP-type G domain-containing protein	0.946	614-632	KSKKDKRKEKKETQAKQRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL97	PHD-type domain-containing protein	0.998	610-676	ERTRKEEMRKAKEEAEALAREKAREDRLKEREERAQAREEAALRKAEEEQKAKEKEERRREKRKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL97	PHD-type domain-containing protein	0.997	192-257	PAPPKKSSLKAKRALKRARNNINNTSKSNSKFKAKPAPKPKPKTKPSTSTPRPKGPPVKREPTPPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL97	PHD-type domain-containing protein	0.631	418-421	KNRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPC8	Histone acetyltransferase GCN5	0.977	310-331	RGQGKKKQGKGPAKGAKPRVPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPC8	Histone acetyltransferase GCN5	0.722	289-294	PRKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPQ2	Uncharacterized protein	0.887	124-141	DKEKKSKKEREELRAWKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPS0	USP domain-containing protein	0.974	139-156	RGKETKEKEIKAKRRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPS0	USP domain-containing protein	0.854	439-449	RKKKAREARRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5X8	Uncharacterized protein	0.969	23-39	HGEQPRSKRRRKHKVLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR72	Transcription elongation factor SPT6	0.999	65-86	RRRRRKEEKRRRKKERRMRRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR72	Transcription elongation factor SPT6	0.94	171-188	RRERKRAEKLKRREQARS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR72	Transcription elongation factor SPT6	0.751	108-117	GRPLKRLRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAC3	Adenine nucleotide transporter, putative	0.956	69-94	RHVEGKARRRQKREQVIKLKKLLGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAV8	Uncharacterized protein	0.976	100-127	GRGRPKSKNPKAKPQGLGTERKARKKVA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBB8	Uncharacterized protein	0.919	92-108	AKRPIKKARSQSKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBC5	Uncharacterized protein	0.806	201-214	PLRRPMREAAKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI2	Uncharacterized protein	0.996	386-432	TLARKAERKERKAGREERRKRRGDSDSEDEKDRVKRRERRKDKEKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI2	Uncharacterized protein	0.943	257-293	NRERRRRRHGRDSCSPSPPKRRHSSIKLSPAPKPPRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI2	Uncharacterized protein	0.746	182-190	RGEKRHRKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI2	Uncharacterized protein	0.699	147-175	RGREREHRGDERTVKRQDEERREGKVRSS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI2	Uncharacterized protein	0.621	355-357	KKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI2	Uncharacterized protein	0.605	379-380	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCB5	Myo-inositol transporter 1, putative	0.72	580-586	KGGKRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY3	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.981	284-314	ERRQRVRDDMRKEKEKRREKRLAAEANRARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY3	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.86	626-648	RNKKRQHRRPSAGDNHTPRKRAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG70	Uncharacterized protein	0.997	468-496	KPKDEDAGLPQKEVKKIKKEKKKKSKSKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH16	Nkap_C domain-containing protein	0.999	236-276	RRRRRRRREKEREKDRGKDRERERRHDSDDEERERRKRRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH16	Nkap_C domain-containing protein	0.996	202-223	ERKKSKSKSSRKSKSKRSKRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH95	Expressed protein	0.869	108-118	SRLRRRRRGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY9	C2H2-type domain-containing protein	0.988	871-895	PPARPLKKRKGPATSRKRKQAPVPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY9	C2H2-type domain-containing protein	0.861	369-383	PTSRPPKQKAKRSRI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY9	C2H2-type domain-containing protein	0.739	905-918	ARTSEPRAPRKIKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKC7	GTP-binding protein, putative	0.996	4-47	IRKKTSNRQNTRDRAKITKKAAEQKRKDRKASKKDQTWKSKKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKC7	GTP-binding protein, putative	0.987	595-642	SSSKPKKRRISEASVAPAKKAKRVSFARNVPDGEERNIRGGKKGKGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKC7	GTP-binding protein, putative	0.724	248-255	SAEKKKSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLN5	BZIP domain-containing protein	0.945	259-291	GKGGRKNMPRDELLARRRARNRVAAQESRKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN98	CAP64 gene product-related	0.838	319-327	KKDKKRKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ02	mRNA export factor elf1, putative	0.99	1059-1083	EKKKKKKKMTRNELKAQEERRRLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN34	rRNA-processing protein EFG1	0.899	5-38	KKQRKGAHPYRKPRPNPSDPSSSDKPARPKPTHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN34	rRNA-processing protein EFG1	0.842	101-129	RKNGAKYHKVKFFERQKLVRLIKRFKRKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K751	Uncharacterized protein	0.677	119-123	KRKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7J3	Uncharacterized protein	0.911	9-46	KKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7T4	Uncharacterized protein	0.892	108-118	PPKKKRKTVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7T4	Uncharacterized protein	0.726	267-275	KKSRRKAQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K980	Expressed protein	0.999	418-452	RKAKRLQEVRLKRAEAKIKKKESKEKAKKAAKKKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K980	Expressed protein	0.796	102-116	EKRVRRAQKSKEAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9C5	Uncharacterized protein	0.861	668-676	KRKRGPKKM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9C5	Uncharacterized protein	0.842	270-283	QKKGEKRRTAEKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9C5	Uncharacterized protein	0.806	245-262	KKKRNSAAKKSAVQGKNR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9I3	Protein-vacuolar targeting-related protein, putative	0.977	398-432	EKRRQRLMKGAWDARMKAKEEKRKERERMEEEKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9I3	Protein-vacuolar targeting-related protein, putative	0.89	461-499	ARKKRKAQLGDRKSAASQSRMKHIANLAAEEKISKKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA84	BHLH domain-containing protein	0.914	327-336	AKKKKSKRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAF8	Cauli_VI domain-containing protein	0.721	521-537	KTRKNKNGGVLKRLAKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB73	Signal transducer, putative	0.925	200-223	AKSRRHAEAKRQRQARREAKERER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBM0	Expressed protein	0.808	246-271	KNNKKNKNTKASNGSAKVNRAKGKAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCE1	Uncharacterized protein	0.783	260-270	KEASRKSKSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCE1	Uncharacterized protein	0.635	708-711	DKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP5	Vesicle-mediated transport-related protein, putative	0.835	449-477	KEKKKVTEEKPIEKKFIEKKNEARKDDGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP5	Vesicle-mediated transport-related protein, putative	0.77	495-510	ANRIKAEAESKARKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX0	Uncharacterized protein	0.965	709-734	PKRAKRSKSKEKGRTVSGKSANSAKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGF7	Expressed protein	0.965	283-316	RRGFRKWGKSGDGGGEDKDVEKQGKRGRSRRRRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGF7	Expressed protein	0.817	181-196	GRRLTRWRRMKRSLKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIA2	HECT domain-containing protein	0.834	285-296	LRRLKKKLHSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIA2	HECT domain-containing protein	0.709	672-678	KKGRKSD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKA4	SET domain-containing protein	0.998	703-755	RAKKNEEKKRKRAEEKLKREQKMREEERRKEEKRLKDRERKRRAKEMKKEEKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKA4	SET domain-containing protein	0.939	215-239	RRGKSKAKEESRRQGQRRSDRTKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKA4	SET domain-containing protein	0.878	616-627	EAKRKKKEEKMR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKA4	SET domain-containing protein	0.69	900-905	LKRKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNK0	Uncharacterized protein	0.726	3373-3384	KKEEKKPPAQPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNK0	Uncharacterized protein	0.626	3165-3169	KEAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI34	Uncharacterized protein	0.707	10-24	KPSLAKPKLQTKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI56	PINc domain-containing protein	0.956	263-311	ERERRRRREGSERGSTLSGKKKDSDARSKGSKSSEGSESFKDRERGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI56	PINc domain-containing protein	0.837	958-982	KERERRKEEEERREREVLERKRQER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7U0	Leucyl-tRNA synthetase	0.867	957-966	GKKKGKKAAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8G0	Uncharacterized protein	0.892	890-919	RIKSPKEEKKKSSSVIWNKMIGGSKKKSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8G0	Uncharacterized protein	0.615	313-315	KKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAX9	Ferro-O2-oxidoreductase, putative	0.944	613-632	RRKIEAKKRRSGLLRRLRGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP1	Expressed protein	0.614	564-565	KK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCX7	ABC transporter, putative	0.996	1201-1216	GGGNSRKEKKKKKNRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCX7	ABC transporter, putative	0.856	244-264	RAKQKKIKLTKALGSRRQPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCX7	ABC transporter, putative	0.739	1092-1098	KRRKRLS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFL7	Uncharacterized protein	0.7	85-92	RERRERKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGG0	Uncharacterized protein	0.696	48-53	AKRRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ58	Transcription factor, putative	0.76	486-494	KEKKAKKMK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJA3	MULE domain-containing protein	0.915	121-133	RRSKRKKPTKTHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK35	DNA helicase	0.932	905-926	PRKLTTKPKQSAKRRSAKSKGP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK35	DNA helicase	0.669	992-1008	RRKSTEASKEKTPRSTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKG4	Expressed protein	0.982	34-63	KGKSKRQVRPLPEGLSKRDRKALKKIRKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKG4	Expressed protein	0.703	217-226	RKSKKEVTKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMU2	Pol II transcription elongation factor, putative	1	1000-1049	RAAIVEKRKRRKEGIADSGEDGEGEGRKREKKPRKKKTKEGKKGRKVRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMU2	Pol II transcription elongation factor, putative	0.851	1076-1093	RKAKSTLAMLKAKRKARR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMZ7	Uncharacterized protein	0.892	121-136	RKRRSSSIKRKPSPGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNQ7	Uncharacterized protein	0.978	317-327	GGKKKKKKGKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNQ7	Uncharacterized protein	0.902	107-121	NAKERGRERRKEVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPM2	Isoleucyl-tRNA synthetase	0.794	277-289	KKPDPKKEPKFKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW9	U1 snRNP 70K protein (Short form), putative	0.838	95-106	KEKKKKTARDKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW9	U1 snRNP 70K protein (Short form), putative	0.819	117-127	VKMRKELRKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI52	Uncharacterized protein	0.973	233-267	KKQNKWLEKKRKLKYRQEEKSKMGKAMERSKGKLK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5Z2	Uncharacterized protein	0.781	198-209	AARRKKVTRSKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5Z2	Uncharacterized protein	0.602	85-86	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM40	Autophagy-related protein 9	0.851	23-35	GKGKERTRRKGGH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN80	Structure-specific endonuclease subunit SLX1	0.989	350-394	KAEKAEKAEKAEKAEKAEKAEKAEKAEKAEKAGRKVRQREMKTKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7M9	Zn(2)-C6 fungal-type domain-containing protein	0.864	352-360	KKSKKRKGS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q9	Expressed protein	0.982	770-821	RGKRPGSPAFKEGRLSKMQKKDKGMDKSRERDKEKERERERERTRDLDRERE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7S1	RNA processing-related protein, putative	0.995	750-784	KKPGKHTLKLRREAKESGKAYEKRKKAWRSAHRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7S1	RNA processing-related protein, putative	0.612	136-138	RKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAM0	Uncharacterized protein	0.885	393-414	KKSKRPSAPYAPRKPSRPHPHS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC13	Pseudouridylate synthase, putative	0.905	491-506	RKWREGKGKIRKEARE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC13	Pseudouridylate synthase, putative	0.762	55-63	RRSKKKAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCE2	Expressed protein	0.999	97-116	KAEKKRRKKEKEKERRAKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF94	Expressed protein	0.639	503-509	RWKALKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFJ5	tRNA binding protein, putative	0.998	213-236	KPEKDGKKKEKKEKKEKPAKAPKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFJ5	tRNA binding protein, putative	0.889	154-167	RKAPAPKVKKEKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG39	J domain-containing protein	0.759	459-469	RKKRALKDRVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGY5	40S ribosomal protein S25	0.982	14-35	AAMAGSKAGKKKKWSKGKVKDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKH6	Small nuclear ribonucleoprotein hPrp3, putative	0.854	202-215	KKEQKKMRRQRRQA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNS7	Expressed protein	0.99	49-61	KKSKKKPKKKLKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNS7	Expressed protein	0.853	251-266	GQKKNAKKSEAKKAQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPF4	Expressed protein	0.935	257-276	RRREWVRLRVRKPRRKEEDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIP9	Uncharacterized protein	0.779	274-288	KSKTQIRREARKRAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIP9	Uncharacterized protein	0.643	140-143	KKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9L0	60S ribosomal export protein NMD3	0.923	412-426	PNRRKKSRPRNWKLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBC4	FHA domain-containing protein	0.878	14-54	RSPRRDRDSSSYHRRRSPNRPNSGRSSRPRDGGWGNRDRVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBJ6	Expressed protein	0.766	434-441	RPKRKLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCB1	Uncharacterized protein	0.644	422-427	KPSKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD74	WD_REPEATS_REGION domain-containing protein	0.885	30-56	PKRPSSAKRPPKLAPIFLAKRARPERE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD74	WD_REPEATS_REGION domain-containing protein	0.727	161-166	KRKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDH0	Expressed protein	0.998	130-160	RRIVRVARKKRFGKGPPKKGQGRRSQMKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDM9	Cell wall surface anchor protein, putative	0.895	1054-1064	RKRKEKARRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB0	Protein farnesyltransferase subunit beta	0.76	343-351	REKSKKVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGN2	Endopeptidase, putative	0.975	13-42	KKGNSKDNKDKPKWEPPVPTRIGKKKRRGP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH67	Endopolyphosphatase	0.732	83-93	KPKKDGKSEGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKK9	OTU domain-containing protein	0.871	104-112	RGKRKRRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKK9	OTU domain-containing protein	0.782	578-599	REPKRSHDEPQKRRASLRLKNR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKQ5	Bromo domain-containing protein	0.982	113-138	PGKKSSIKKSAKPLASKKKTGPRRPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLP7	Uncharacterized protein	0.995	57-115	GKKKRRGRIRARDESGKRIAIGEKKGPDDGKVAPRWGRDPELARRSKLSAKHTEDRKQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLP7	Uncharacterized protein	0.887	165-178	ERKEVGRRKGGKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLP7	Uncharacterized protein	0.82	300-318	GSKNKRHAPARNGERPMKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLV7	Transcriptional regulatory protein, putative	0.966	59-93	KKTPAGARKHGVKEEPEEHGKADEPRKKRTKRSAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN65	60s ribosomal protein l27, putative	0.858	57-69	MGKKRIARRSKVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH5	Ribosome assembly protein 3	0.879	9-18	KTNRRKRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW7	rRNA processing-related protein, putative	0.996	672-686	KEAGKKRRRRKGKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW7	rRNA processing-related protein, putative	0.985	485-500	SKKDKKKKMKERKEKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW7	rRNA processing-related protein, putative	0.959	786-795	HKAKRKRTRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW7	rRNA processing-related protein, putative	0.924	584-601	MKEKKQRKKEKMELKAAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW7	rRNA processing-related protein, putative	0.848	250-261	SKKKRDNKKERI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW7	rRNA processing-related protein, putative	0.729	540-550	RSKSASKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPX6	Conserved expressed protein	0.948	667-696	KVRQKEQRRNRERRREQNAVAQKKFRWKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K868	Uncharacterized protein	0.742	945-957	GRKEGRKVGRELP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K936	Inositol-polyphosphate 5-phosphatase, putative	0.714	1226-1234	KAKPKMKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAE0	Nucleus protein, putative	0.661	235-238	KKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB14	Metalloendopeptidase, putative	0.97	444-463	WRDHRRKRQPKRVEKKQEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB28	Ribonuclease H2 subunit B	0.934	288-329	KKEAKGIKRKAPPASRGVESLKKVNTNKMAKLTSFFKPKEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE17	Uncharacterized protein	0.978	196-216	EKKKKNRPSKKSRMARWNRLK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEK1	Uncharacterized protein	0.896	143-161	RPSKLHPRPSKPGKARPAN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEK1	Uncharacterized protein	0.711	627-638	RGRSRGRPNVNR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KER2	Abhydrolase_3 domain-containing protein	0.881	183-197	KRLRAEKRARSKKQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEV0	Expressed protein	0.829	600-627	GRGGKGRQNKGNRGHSNAARTRGHDRKM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEV0	Expressed protein	0.801	360-368	KRKEKKKFE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF27	Uncharacterized protein	0.995	304-327	HKRRRSRSRSRGRSPPRKKSHRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF27	Uncharacterized protein	0.917	129-154	GRPKPMPVRAPSPPPPPSGPKPRGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF27	Uncharacterized protein	0.633	449-456	KLGRLAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKF5	ATP-dependent RNA helicase, putative	1	29-64	KKKNKPESQKRRDKKKNKKKRKIQKAKRAAAPKNKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKF5	ATP-dependent RNA helicase, putative	0.995	116-141	KEKKQQEKREKREKRQRKEERRARRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKT0	Non-specific serine/threonine protein kinase	0.82	471-513	EKKGGARSAIAKQVERERHQTERKANAGKTSVKLGKQKGHKWK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLE0	Expressed protein	0.691	371-375	KKKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLW4	Expressed protein	0.795	131-155	ARKRSRSPPPFGRIDKFGRSRSSSP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLW4	Expressed protein	0.793	365-387	KGMREKGGRFEQGGSGSGKKKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLX0	Uncharacterized protein	0.969	339-351	SKSKKGKAKGKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLX0	Uncharacterized protein	0.653	609-614	KVAKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM15	Nonselective cation channel, putative	0.845	684-695	KAVKKEKDKKKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM83	Integral to membrane protein, putative	0.688	217-223	KRRRARE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMS1	WD_REPEATS_REGION domain-containing protein	0.63	337-339	RKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPA8	MMtag domain-containing protein	0.995	121-163	EKEERKREKALRREQRALKRAEKEIKREEKERHRHRRSESRRH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPA8	MMtag domain-containing protein	0.887	263-282	PRRKYERSRTRSKSPRRDHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPA8	MMtag domain-containing protein	0.651	245-254	RYRDRREERP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LID6	Uncharacterized protein	0.953	249-270	KTRAKKIRSSSRRVHRKRHSSE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LID6	Uncharacterized protein	0.876	339-353	RERVVVGIRKRGRRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.999	658-692	NGKKQNKKLVKKKKTKKENKRAAEEEAKNRERKRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.997	59-97	RKSRDAKNNRSEEEDRSSRGKKPKKERRDDKSRKKDEER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.988	536-562	KPKGKPKKKEKIEKTAEKKENSTEKVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.976	598-632	AKNSSKKNKEKNNNRTEGEVPKRTNRKEKKKENRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.968	723-745	KKRLRRVPIDTTRIKRKPKKNKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.93	2057-2073	KRKKHRRFGHEDRRGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.877	2110-2141	ERDEVKHRDAKSKENGKKRDGDQGSGGGRAKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIV5	Uncharacterized protein	0.6	582-582	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ80	ATP-dependent RNA helicase DHH1	0.837	589-606	RGNGRGQGHRGRGRGRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR80	Translation machinery-associated protein 22	0.977	79-111	KLEKKAAKKAEAEAKKKEQTKIIIKRSERTKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7P2	Non-specific serine/threonine protein kinase	0.738	1536-1546	GTKGRPVRKHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K856	Amino acid transporter, putative	0.761	272-280	RRKSNRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9G4	Uncharacterized protein	0.966	1182-1195	RKRKRAEKKAERKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9G4	Uncharacterized protein	0.623	1224-1226	KKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA83	Cell cycle arrest in response to pheromone-related protein, putative	0.922	398-413	RERRRAHRAKKTEKGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA83	Cell cycle arrest in response to pheromone-related protein, putative	0.823	630-640	KGKLRRRRPSH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA83	Cell cycle arrest in response to pheromone-related protein, putative	0.726	677-686	VKKLKLKSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAL3	MFAP1 domain-containing protein	0.978	433-562	RDRDRDRDSGRRRDEGRERRYDDERRGEKDDRRRDRDRDYGRDRDREREKETARERNRDGDYGRDKDRERDRYDRERDYARDRDRRRDSPGRKRERDDRDRDYERDEKRRRDERDRDREREKERGVRRDR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS9	Uncharacterized protein	0.949	1091-1136	RPPLKKTKKAQPSTKRKRDERSGSEEEGRASQPSSKLAKVIREGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS9	Uncharacterized protein	0.881	956-989	KYKANSKSKTAAMAKSTKAEIKAQSKARKNRSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS9	Uncharacterized protein	0.797	27-42	SRGWQKRAQKWAKGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS9	Uncharacterized protein	0.751	677-693	GKDGKKAGMTKSWRGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS9	Uncharacterized protein	0.744	1026-1035	RGKKLTKGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS9	Uncharacterized protein	0.69	1066-1073	SKPLKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS9	Uncharacterized protein	0.601	1060-1061	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBE6	Expressed protein	0.815	53-60	SRKNKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP6	LRRNT_2 domain-containing protein	0.903	142-151	PKKIKPRKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP6	LRRNT_2 domain-containing protein	0.835	93-100	KKRRAKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCR8	Transcription activator snf2l1, putative	0.922	1059-1096	KKPIKGKKRPIDELKSGPGSRDTTPSAAGSKGSKKKKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCR8	Transcription activator snf2l1, putative	0.853	166-180	AGKGKKKAIDNRHRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCR8	Transcription activator snf2l1, putative	0.604	97-98	KK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFF5	Zn(2)-C6 fungal-type domain-containing protein	0.932	137-162	IKRGKEEKVDKEELTTKGRKRKRLAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGF8	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.985	529-552	KAQLKPSFAKKKGDKNEKKDKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH56	rRNA processing-related protein, putative	0.975	73-106	KHQASKGEKRKRQMSDRQAKRLKKNEDAKKKEER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH56	rRNA processing-related protein, putative	0.737	784-791	KKEKAKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHV0	CRIB domain-containing protein	0.713	243-248	RRKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIH0	Conjugation with cellular fusion-related protein, putative	0.998	633-654	RRRKEWEAEKKKRKKAREARKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIH0	Conjugation with cellular fusion-related protein, putative	0.632	232-237	RRVRGA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KII9	Glycerol kinase	0.894	333-347	GRGKDGKAKKYRKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KII9	Glycerol kinase	0.663	717-723	LKKIKGW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIP4	Expressed protein	0.979	3-27	KATRKKKEKKADFVKAKLKLGKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIP4	Expressed protein	0.659	450-461	RGKEVRWRERVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIP4	Expressed protein	0.632	475-479	RAKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJF4	Conserved oligomeric Golgi complex subunit 1	0.699	81-85	GRKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS7	PARP-type domain-containing protein	0.996	119-238	PATKKKGTKKAKAEANEDEGSPEAPKKQKAPAKESKAKNEPKHEDENEVEASPKKKRKAPVKQAKKKEPEEHEEPAAEEGPKKKRKAAVKEAEKAEPSDNVEEKPEEKPKRGRGRPKKTE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN10	Expressed protein	0.659	329-334	RSKRRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPF1	Uncharacterized protein	0.889	13-32	RKQLKAKELKKNKEARQKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ88	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.853	193-206	KRTDGKKPRLRKAQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAY2	Expressed protein	0.724	234-250	RERQARETKEQAKRERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC06	Uncharacterized protein	0.868	293-313	RKPSKTPPGLKSKSNKSKSKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC06	Uncharacterized protein	0.862	454-473	KPKSSSTKSKPKSKFSRKNP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC06	Uncharacterized protein	0.84	66-99	KPLRVKKKKINFTTGRVVANRRHRRSTISGPRSP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCJ9	DNA-(Apurinic or apyrimidinic site) lyase, putative	0.999	418-452	KGEIEKRWRKERDAINPPKEKKKPAAKGKAKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCJ9	DNA-(Apurinic or apyrimidinic site) lyase, putative	0.727	32-43	AVKPKRAVRSTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCR1	Uncharacterized protein	0.81	173-183	YARKARRTRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE46	Transcriptional activator, putative	0.992	196-225	LVSKSQASKGKKAPAKKGKAKTKVEELKGS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE46	Transcriptional activator, putative	0.798	454-462	KGKKRKAGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF38	Protein phosphatase PP2A regulatory subunit B	0.801	381-396	KAKKIGGSRGKVPGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHS1	KRR1 small subunit processome component	0.931	389-398	EERRKKRRKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHS1	KRR1 small subunit processome component	0.878	347-371	PKEKEAIDKRKKMEKQKEVAQERRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHS1	KRR1 small subunit processome component	0.624	317-319	KKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJJ9	Cytoplasm protein, putative	0.987	561-582	REKKAGRRKGLKEKLKEREKSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKF2	Expressed protein	0.992	153-196	TEKEKEKKKKKGEKWMETQKQRAEEVKEKKNAWEKFGKKAQKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKF2	Expressed protein	0.832	58-69	GKEKAKAKGKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKG7	Ribosomal protein	0.656	249-253	SKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKR0	Translation initiation factor, putative	0.986	144-160	KNPPKKKDKGGKKGKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL23	Ribosomal protein YmL32, putative	0.669	85-96	KKVSHSRKNMRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL69	Uncharacterized protein	0.79	156-182	KKRSPSKSGQKKQVANPAPIRASPKGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLI0	Uncharacterized protein	0.967	78-107	GSRKEQWRTARGMSVRPKGSTKAKRNTRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLI0	Uncharacterized protein	0.644	9-17	AKMASRARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMH5	Zn(2)-C6 fungal-type domain-containing protein	0.978	125-140	SKKKRKATGEGRRKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMP2	Uncharacterized protein	0.989	925-951	RVGRKADGEKYRGLMDKKRRKRVREKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMP2	Uncharacterized protein	0.736	97-108	RLKIRKPSRTPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH3	Cytoplasm protein, putative	0.996	79-95	KSKKKNKKKKSSKKTKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP98	WAPL domain-containing protein	0.655	31-39	RSNAHKEKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ07	DNA helicase	0.833	680-687	PERRKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIB6	Cir_N domain-containing protein	0.982	88-106	KHRQKKIKEEKRERKKRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIB6	Cir_N domain-containing protein	0.789	205-217	RRDRERRKDARAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS52	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	0.994	521-558	RQKKAKEEHKARKAAAKAKAEAQKNQKEGGRPAKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS52	tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit TRM82	0.847	241-257	RRVRSHLRRHKPGSRKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Z5	Uncharacterized protein	0.67	190-199	RKFMPKLRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K972	Condensin complex subunit 1	0.99	1372-1391	PRKKVTARKAPPRRGGRRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K972	Condensin complex subunit 1	0.981	1318-1341	RKAKAAKRRAAKRPPAATARTTRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K972	Condensin complex subunit 1	0.847	965-979	KRRKDEKAKEKAAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K972	Condensin complex subunit 1	0.839	533-540	KPKKKKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9R6	DUF4211 domain-containing protein	0.948	267-283	SPPKRRRSSGHKKRNSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9R6	DUF4211 domain-containing protein	0.851	140-150	AKRRKNSKGKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9R6	DUF4211 domain-containing protein	0.693	335-343	RIRKLRNKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9R6	DUF4211 domain-containing protein	0.672	184-191	KKKMPTPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA64	SLT domain-containing protein	0.762	68-79	AKKLIKKSVKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS6	Uncharacterized protein	0.99	594-617	KKGSLSKKRAKKAAQKARAKERER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCS1	60S ribosomal protein L8	0.865	237-254	GGVRGNKSINKLKKRAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCS1	60S ribosomal protein L8	0.827	4-22	KGKKPAAAPFGTKKAGKKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCX9	Cleft lip and palate associated transmembrane protein, putative	0.815	174-182	KKRIRKEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY6	Expressed protein	0.64	486-489	KKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDL0	MFS domain-containing protein	0.997	571-598	KKGRGWRDKRKEKKEAKNEEKKAKKEAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEF5	Uncharacterized protein	0.999	206-235	RRKRRKLEDAKEKEKRERRKKRQGRKERTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGS5	Uncharacterized protein	0.903	367-378	ERRKRSRKSKAI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGS5	Uncharacterized protein	0.788	851-861	RQEIAKRSKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGS5	Uncharacterized protein	0.7	802-807	RRKRKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHC6	DNA repair protein rad16, putative	0.998	360-391	QMQKRKEKRHAAREAAPRKKKERELAKKLGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHC6	DNA repair protein rad16, putative	0.99	279-321	GKGSMRGGRGGAQGSKAARPSVAKGKTAAKGKTKKFQGKGRKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHL2	YL1_C domain-containing protein	0.925	150-166	RRRKREAKRVHRSEARR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHL2	YL1_C domain-containing protein	0.82	610-617	ATKSKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHL2	YL1_C domain-containing protein	0.804	84-99	RRAKRDAQSKGKGKLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHL2	YL1_C domain-containing protein	0.804	246-264	KKEEEKRELRRVGRKVVKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJL0	Expressed protein	0.741	315-321	PKSRKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJL0	Expressed protein	0.619	7-9	KRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJR6	C3H1-type domain-containing protein	0.958	276-297	GGERGRGRGRGRGSVRGRGGRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJR6	C3H1-type domain-containing protein	0.945	230-255	RQAAIARGEVPAKQRKGKGRRNDPAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJR6	C3H1-type domain-containing protein	0.682	454-460	KKRQPRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJR6	C3H1-type domain-containing protein	0.602	221-222	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK39	Vacuolar membrane protein, putative	0.726	54-61	KRLEKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKY7	Transcriptional adapter 2	0.848	278-289	EKKGKVKKEKQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL47	Nucleolar protein 12	0.999	481-584	DKTKKAYVRPGVIPKGDPALGDKLKNLSKEERKTIKSSDADRQARRLAKKKAKMSLEKDKAKGAVKLTLTKSEREKTSASKKPKAKKGKKRAPSAVAKMKGSRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL47	Nucleolar protein 12	0.769	143-153	AKETKKTKKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM21	Transcriptional repressor, putative	0.965	125-139	KKAKEKKAKKAKTIK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMX9	Uncharacterized protein	0.983	77-102	PPRPAKRRPLPPKKGILKPPPPPSKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN49	Multidrug resistance protein 1, putative	0.969	105-131	HKKSKFNFLKSRKKKEEEERKNKEKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPH1	RRM_1 domain-containing protein	0.997	141-152	EKKKKKKKKRKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPH1	RRM_1 domain-containing protein	0.97	181-199	RKRAKEERRRKLMEAKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPH1	RRM_1 domain-containing protein	0.66	479-490	QKAAAANAKSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CL96	Pre-rRNA-processing protein ESF2	0.704	57-61	KKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CL96	Pre-rRNA-processing protein ESF2	0.698	215-220	KRKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN08	DNA ligase 4	0.633	405-407	RKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO56	Leucine carboxyl methyltransferase 1	0.981	33-59	HRPAPRPALGRCRPPHRRRRRLRPPVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP72	EKC/KEOPS complex subunit BUD32	0.923	266-285	KKWKPIQIKLKDVRRRGRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8T8	DNA-3-methyladenine glycosidase, putative	0.891	279-293	TPKKTKGKANKGEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8T8	DNA-3-methyladenine glycosidase, putative	0.741	50-59	KGHLKPSKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9D0	Nucleus protein, putative	0.995	555-602	SKMTKRRAARGSKSKSKPKTAPRKSSVSKPSPNINGNSQPKKSKKAPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9D0	Nucleus protein, putative	0.91	688-713	RGSGSKRGRGGVVKKAGGTGRKAMGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9D0	Nucleus protein, putative	0.646	392-396	RKPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAB6	WD_REPEATS_REGION domain-containing protein	0.748	10-18	KKRKRNNRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBD9	Oxysterol-binding protein, putative	0.63	607-609	KKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC88	Uncharacterized protein	0.988	94-131	REDAKKRKVAKEREKELRRVEPVRKSRRVAERAGKDKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN7	Restriction of telomere capping protein 4	0.98	880-895	KRRRLAKIRGKKKMKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN7	Restriction of telomere capping protein 4	0.67	223-228	RKKGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN7	Restriction of telomere capping protein 4	0.658	125-133	RKAGKTRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG88	Uncharacterized protein	0.968	610-628	GRGKGSTFKARPRRRRRSL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI20	Uncharacterized protein	0.803	125-136	KQERRDERRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KID8	Uncharacterized protein	0.73	1055-1068	REEGQIRLKRLKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KID8	Uncharacterized protein	0.632	406-411	KATKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KID8	Uncharacterized protein	0.601	1053-1053	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIR7	Expressed protein	0.843	114-124	RSNNKGRKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJF7	Zn(2)-C6 fungal-type domain-containing protein	0.699	259-265	PSKPRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KND1	G-patch_2 domain-containing protein	0.994	339-416	GKRRRDDDGGRESKRRGDGYRDRDRERDRDRERDRDRERDRDRERGRRDERERRSYRDRGDDRDKRDREGDRERRRDR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KND1	G-patch_2 domain-containing protein	0.797	290-302	SGSGKRPAKPSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNF0	Ubiquitin-protein ligase, putative	0.995	804-827	AAEKRRRLEMEEKKKRKSRSRKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNF0	Ubiquitin-protein ligase, putative	0.685	184-190	RSPPRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNF0	Ubiquitin-protein ligase, putative	0.601	161-161	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNR0	GTPase, putative	0.942	62-80	QGSKKGKGGMRRKKDDAER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNR0	GTPase, putative	0.791	230-239	PRKPKAPKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5W8	Uncharacterized protein	0.983	727-747	IKKPPKEAKKLGKKVGKKTNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5W8	Uncharacterized protein	0.908	658-675	KPLREAKRLGKKVAKKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M643	Uncharacterized protein	0.899	201-215	NEKKDGKKHEKQEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO92	DNA mismatch repair protein MSH3	0.932	215-229	AKELAGKGKSKGKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ64	Pre-mRNA-splicing factor CWC24	0.749	13-27	KGPSRRPAQSRQRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7V2	HABP4_PAI-RBP1 domain-containing protein	0.946	287-332	RPPRRDREGGERSGERSGERSGRGRGQRGGFGGQRGNNRGGARASR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7V2	HABP4_PAI-RBP1 domain-containing protein	0.643	100-106	KGPRGSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K845	Uncharacterized protein	0.997	246-256	GKRKRKRKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K845	Uncharacterized protein	0.988	195-229	AEKRSRKVKGPNPLSVKKKKTPGQDKEGESKKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA15	Expressed protein	0.992	4-19	ARNPNQQKKKKKKKKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA18	Cytoplasm protein, putative	0.88	191-206	KLKKNKSKSKSDRKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA62	Gata factor srep, putative	0.834	108-136	RRAAARRRHQNKKEEQGSDGQPSAKKRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA62	Gata factor srep, putative	0.764	348-357	KKTVIKRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA62	Gata factor srep, putative	0.757	829-841	REKRERERERERP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA80	Transcriptional regulatory protein, putative	0.75	37-51	PGKAGGKAGKGDKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBN6	MYND-type domain-containing protein	0.999	43-57	KNKKKKKKKKGKSKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGY2	Uncharacterized protein	0.986	273-287	EKAGKKKNKKKKSIA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH92	Zn(2)-C6 fungal-type domain-containing protein	0.75	53-61	APLRKKQRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD4	Expressed protein	0.798	412-430	KARRGSVARPKPSSAWKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD4	Expressed protein	0.603	725-725	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KII4	WD-repeat protein, putative	0.71	526-535	AKVRKPERAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJI3	ER to Golgi transport-related protein, putative	0.975	105-116	TRGKKKGGKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKH1	Uncharacterized protein	0.981	78-105	KRSKRVKRERWEAAQRRKNKRHAAEKDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM13	Vacuolar membrane protein, putative	0.694	209-214	SRKRKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMB7	PH domain-containing protein	0.774	1224-1230	PRRRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNM1	Uncharacterized protein	0.989	175-197	GKEKDKKGREKAPKKKEEKWGDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNM1	Uncharacterized protein	0.757	269-281	KKKKVAPAPVAKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV8	Conserved expressed protein	0.98	124-136	KTKKKKKEKPKDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV8	Conserved expressed protein	0.978	184-235	RKKKKEKDKVEQERLEQKRIEKLKELERIRAEIDAERRKKEEAEKERKRKQG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV8	Conserved expressed protein	0.702	378-385	AKRLKKGS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV8	Conserved expressed protein	0.642	418-422	KKWKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M624	Uncharacterized protein	0.992	217-250	APKAKRSHHKKKASDAPPGPGRNWKKGMKKAAPG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M624	Uncharacterized protein	0.981	502-522	GGKKKMGSAPAKKKGKTPKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP26	Nucleolar protein 58	0.995	518-568	ERRARKEAKKAAKAAKKAAEESGDGDKKSKKRRADEDEDSEKKKKKKKKDE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP26	Nucleolar protein 58	0.99	477-491	KDEKKDKKDKKKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP26	Nucleolar protein 58	0.912	87-93	KKKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E1	Nuclear localization sequence binding protein, putative	0.728	969-981	ARRMRERGRQSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8V5	SUN domain-containing protein	0.94	153-170	ERRAKERREREKKERDER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9H9	Uncharacterized protein	0.991	617-627	SSKKKKKKKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9H9	Uncharacterized protein	0.846	679-695	PPTKPLKMTKKEKKAAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9H9	Uncharacterized protein	0.62	1076-1078	KRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9T7	Uncharacterized protein	0.679	668-679	AGPSTPRRHHRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA99	J domain-containing protein	0.952	229-240	KDGKKKKPKSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA99	J domain-containing protein	0.601	84-84	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAL5	Uncharacterized protein	0.762	168-177	VNREKRRRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAL5	Uncharacterized protein	0.755	1006-1022	KRRVKSEAIRKPHANKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAL5	Uncharacterized protein	0.733	425-434	KKQKKHKFGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBK9	Zn(2)-C6 fungal-type domain-containing protein	0.864	470-499	GRGRSSARASSSKLPYRKQAKKHIQVRRRT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCE3	Histone-lysine n-methyltransferase, h3 lysine-9 specific, putative	0.996	909-945	AKKKWKGKEREKEREKEKAREKEKAKEENEQLRRRRM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCE3	Histone-lysine n-methyltransferase, h3 lysine-9 specific, putative	0.937	1318-1327	QKRKRRPKKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCE3	Histone-lysine n-methyltransferase, h3 lysine-9 specific, putative	0.933	1759-1770	VKKKKGNKGKKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH87	Phosphoric monoester hydrolase, putative	0.66	464-471	KQKSAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHA9	Uncharacterized protein	0.614	297-298	RK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI21	INCENP_ARK-bind domain-containing protein	0.996	881-971	RKAAMRDQADKRKELLAQKKAEEERQRADEERKAKIAELEEKRRLRAEHEKRKKEREARVAAIAKERVAKEEREMQAAKVKAEEEAARKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI21	INCENP_ARK-bind domain-containing protein	0.972	85-107	KSKSIKASSPSKSKAKRGRSRKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI93	Uncharacterized protein	0.775	168-185	SRSKARTPPRRESEHGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIF8	Ribosome production factor 2 homolog	0.928	288-307	AKMQGRKMKGLKVRDGKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIF8	Ribosome production factor 2 homolog	0.853	247-266	LKRPKIAKSDVEKGLGKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIM0	Uncharacterized protein	0.999	585-664	KKSKKQLAKDAKAQRKAEAQAAARARAEQMRQELARKQQQREEEQRKKIEIKRKEKEEKVKRKAEKKEKKNGFLRKPASS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD2	RING-type domain-containing protein	0.983	447-485	IRRRGRGRGRVPDRRREHTGSGGRTKRLRPYEFERVRDR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD2	RING-type domain-containing protein	0.746	75-88	KKREALEREKGKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD2	RING-type domain-containing protein	0.692	415-429	QRSRSWSRCPPRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD2	RING-type domain-containing protein	0.684	192-207	GPSRERLPTRREERPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD2	RING-type domain-containing protein	0.637	405-413	PPRRYPSPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD2	RING-type domain-containing protein	0.632	812-818	KKEIRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK36	Expressed protein	0.707	237-242	RPKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE6	Uncharacterized protein	0.995	290-305	GKKSRKPRKRKEKKEE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE6	Uncharacterized protein	0.945	198-207	PKKRRKRGAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE6	Uncharacterized protein	0.834	102-110	ARKPRKKAV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE6	Uncharacterized protein	0.771	158-164	KSKKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE6	Uncharacterized protein	0.663	125-130	KKDKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE6	Uncharacterized protein	0.621	366-369	AKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE6	Uncharacterized protein	0.621	1195-1197	RRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLX1	Expressed protein	0.887	744-766	AGKIRRKRENPAPTPRMATRSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLX1	Expressed protein	0.861	597-625	TRKGGRRTRDKTPPMSISPSRRSTRARKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLX1	Expressed protein	0.64	534-540	KKPVKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM95	Expressed protein	0.808	109-126	AKERERERERDRDREKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMG9	CPL domain-containing protein	0.985	6-58	AQKKRSAPDAGSAPKKTKVAQSDKSSKPAAPKQSKSRSAPREREEEAKKRKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN33	SCD domain-containing protein	0.986	61-89	PKKKKPAAPRKSRASAGTTKKDGPKTKTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN73	Ribosomal protein L35, putative	0.846	90-127	KKTRAIRRRLTTKEASAITEKQHKKNIHFPKRKIALKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNP6	Expressed protein	0.629	50-53	RARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP30	Expressed protein	0.935	134-143	RRREKKRKRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP58	Choline-phosphate cytidylyltransferase, putative	0.945	439-453	KREKRKAAHHHKVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPD9	Zn(2)-C6 fungal-type domain-containing protein	0.861	86-110	RRRGPDKNPGARMKNKVQRAKQSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV0	Uncharacterized protein	0.626	1077-1080	KKRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIN7	Uncharacterized protein	0.958	102-144	PQPKVKPRHKAKAQLNGKAQPPKAESPIKSTPRPKASQLKGKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIU6	Uncharacterized protein	0.814	179-191	RLRKRERRMEKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIU6	Uncharacterized protein	0.688	266-278	AKTRKLVWWKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS44	Mitochondrial division protein 1	0.987	201-216	RHAVKKRRKKRESRRF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7R4	Uncharacterized protein	0.947	396-409	EGRERGRRRGRGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7R4	Uncharacterized protein	0.894	112-137	SKRKRPTQSRRSNSKAPRQSRAGTRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8X8	Adenylyl cyclase-associated protein	0.979	325-345	GKKGPPLKPKPGAKPAKKPAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8Z2	Nucleus protein, putative	0.839	842-857	AKRKRLQSGGGPKKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8Z2	Nucleus protein, putative	0.631	1009-1013	GKKIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K992	Beta-1,3 glucan biosynthesis-related protein, putative	0.632	376-380	KGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K995	Non-specific serine/threonine protein kinase	0.658	506-510	LKKRL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K995	Non-specific serine/threonine protein kinase	0.657	497-501	KKKRF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K995	Non-specific serine/threonine protein kinase	0.643	877-884	RKQSLRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBS7	RNA helicase, putative	0.774	1614-1632	GRRPPPRPTVDRPRRPDGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCA1	Pre-mRNA-splicing factor SYF2	0.741	289-295	GKKKRTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCT0	Uncharacterized protein	0.996	686-711	SGKRGRANTKKGNGVRRRKSKKKGVL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDM3	Usp domain-containing protein	0.913	294-310	PERKVKKHLKKRQNDPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEJ3	Kynurenine 3-monooxygenase, putative	0.625	356-359	KRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEJ8	Methyltransf_11 domain-containing protein	0.773	243-262	KGETFKKSKQPKQPNPKQPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH09	Trimethylguanosine synthase	0.807	160-170	AKARKQSKKRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ57	Alkylbase DNA N-glycosylase, putative	0.991	717-739	RGNGRKKKEKGKKLILGGGGRRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ57	Alkylbase DNA N-glycosylase, putative	0.984	553-578	KARRQKRRDKVRKEDRAKQKWEKAER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ57	Alkylbase DNA N-glycosylase, putative	0.835	361-394	RKGREAWSSAIGGDKKEKEQQKERERKEQERMKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ57	Alkylbase DNA N-glycosylase, putative	0.77	46-55	GPPRRSRKGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ57	Alkylbase DNA N-glycosylase, putative	0.619	441-445	KKSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ64	Uncharacterized protein	0.769	82-92	HKDKRRRLTKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ64	Uncharacterized protein	0.711	66-72	GKSRRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK69	Expressed protein	0.874	85-115	PTGRGKALKEGGVPMSERVRARKEARERERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN92	Protein-lysine N-methyltransferase EFM6	0.699	204-210	KRRKADK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPG0	Uncharacterized protein	0.914	346-366	GKRKKGGGMRRTGYGKVRMGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPG0	Uncharacterized protein	0.836	427-435	KRDRKRKRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIM9	Uncharacterized protein	0.994	171-193	QARMREKGRERQRRKRERDKKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIU5	Uncharacterized protein	0.875	27-47	NKRKRPSHDPPRRPSPDQKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIU5	Uncharacterized protein	0.669	296-302	KELRRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LJ11	Dilute domain-containing protein	0.976	56-77	KKAPATPNNASATPKKPKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5C0	SAP domain-containing protein	0.987	898-951	KKQSSAGLAAAARARAKASGLRAVKSRGDLREKEKEMKRKKEEMRVLSGRRKEE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5C0	SAP domain-containing protein	0.898	576-605	RKLKDRREQRRSGLYAKHSPKRFGFLKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5S4	B30.2/SPRY domain-containing protein	0.988	1222-1237	KGKGKRKGKGKERARG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ78	ATP-dependent RNA helicase DBP3	0.997	49-68	EEVRKKDKKDKKEKKDKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ78	ATP-dependent RNA helicase DBP3	0.994	12-36	LSKEEKKARKEAKKLKKAEKAAKEA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ78	ATP-dependent RNA helicase DBP3	0.823	89-95	PKKKKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8L8	WD-repeat protein, putative	0.999	324-346	AKRARRKKRDREKKKKGKGDKQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8L8	WD-repeat protein, putative	0.897	971-987	RKRLEEGRGKRKRIEVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K921	Expressed protein	0.989	44-78	RLKGRAKGRKGKNKAEGTSDSPPPGPKKRVRKPFA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K921	Expressed protein	0.972	383-399	RSTRKKGKKKQTKKFVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K921	Expressed protein	0.942	233-249	RANIKKEKMKKRRVLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA25	Expressed protein	0.654	99-107	REKNRVKQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA69	Expressed protein	0.824	375-384	KAARRRREKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA69	Expressed protein	0.773	351-362	KKKIKGKLNKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB64	Protein SDA1	0.997	279-312	KMEHRMEVSRGKRKKEKQVKQLKREASKKRKKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB64	Protein SDA1	0.997	593-614	KRRDKKDKREKKRLARGKGKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB64	Protein SDA1	0.995	716-802	RKKAKATWEERMESIQKGREGREKFGSMKGKKKKAAPSSSTNKEKAKNKPIMMALHSNRVVSKKKASLRDKQIRLRAAIEKRKKQKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB64	Protein SDA1	0.671	197-203	RNKGKGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCB8	Expressed protein	0.727	30-35	PKKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCK6	RING-type domain-containing protein	0.888	170-189	KVHESPAKTPRDKRAKRAGS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCK6	RING-type domain-containing protein	0.838	863-874	PARAARRGGGRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCK6	RING-type domain-containing protein	0.723	321-327	KAKEKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCK6	RING-type domain-containing protein	0.663	68-74	PAKRVRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEJ5	Alpha-L-rhamnosidase	0.705	835-851	KKRFKVPYEKDKRWPPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG69	Uncharacterized protein	0.952	49-65	PQRQKKKKPQGRGGKGP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ66	Expressed protein	0.615	263-265	AKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJJ5	GATA-type domain-containing protein	0.892	392-404	QRKKKKAEEKARL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS1	Ribosomal large subunit biogenesis-related protein, putative	0.994	424-465	KKFRKVPRARMEKMKHEKERTEEEKSKADKKLLKKERQRKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS1	Ribosomal large subunit biogenesis-related protein, putative	0.967	202-249	KKGKKQAAKKGKEVAEKAEDVKETGKRKAQKVAEDAEPVSKKTRSKTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS1	Ribosomal large subunit biogenesis-related protein, putative	0.933	5-29	RSAPTPKSGAAVKKAKPASKGAKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS1	Ribosomal large subunit biogenesis-related protein, putative	0.852	83-93	KKKGKAAKGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS1	Ribosomal large subunit biogenesis-related protein, putative	0.784	321-331	LKKASKKKDDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLA8	DNA polymerase delta subunit 3	0.993	393-422	RPKAKEEARPLRKSATGRKVRRVKKTKREK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLA8	DNA polymerase delta subunit 3	0.718	267-285	FARGPKEKMVKEQTKKEVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLA8	DNA polymerase delta subunit 3	0.631	460-466	RGGSKPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLA8	DNA polymerase delta subunit 3	0.618	255-260	KPPIKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLJ4	Zn(2)-C6 fungal-type domain-containing protein	0.882	413-429	RRRGPGKATKERREKAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMF6	Valyl-tRNA synthetase	0.986	64-107	EKSKKGAKKEAKRLEKLAKAATKTSAAQSQAPKKEKAEKKEKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP34	Stress response protein NST1	0.998	737-925	KRAKEEKKAKEAQKKKDKKKAQKQKAEEERLAREAALEEEKRQAKLRKEEAERERMRRQDEERVRREAVKRAAQEEAQRQALERKRRQQEEKEREEEAAKKKREREEKAKKEREARENELKEKERKEREIKAAKEKAEKERIAKETLEKAERDRLAKEAKEKAEKIRQERLEASRMEKVRKEEAARKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP34	Stress response protein NST1	0.996	266-278	PKKKNKKKKKKGA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP34	Stress response protein NST1	0.875	15-26	SAAKKRAKKAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR08	ATP-dependent rRNA helicase SPB4	0.993	629-666	EARAKRKIKAEMREAWSEQKERKVRKEERKEKKDAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR08	ATP-dependent rRNA helicase SPB4	0.741	560-569	KKKKEAERQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR08	ATP-dependent rRNA helicase SPB4	0.728	694-699	RKKRRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR08	ATP-dependent rRNA helicase SPB4	0.618	415-418	AGRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS06	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.833	249-259	KEKWRRRKEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS06	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.782	151-162	KKGNKKNKNKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS06	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.737	521-528	KRRKTGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q1	ATP-dependent DNA helicase	0.997	914-943	GKSKGKGKGKAKAKDPSAPKIKHRARKRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q1	ATP-dependent DNA helicase	0.871	859-872	QRAHQPPASRKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q1	ATP-dependent DNA helicase	0.85	1343-1353	RRRPGRLRRRI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q1	ATP-dependent DNA helicase	0.787	1373-1395	PHARVIGREGRREDGRQGGEKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q1	ATP-dependent DNA helicase	0.715	978-996	TKRKAPVAKVALVTKRPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8R9	U3 small nucleolar RNA-associated protein 11, putative	0.879	300-316	RKKWQGKIWKWKMERRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8R9	U3 small nucleolar RNA-associated protein 11, putative	0.867	12-58	RRNHKERAQPLHRARLGHLEKHKDYVHRARDYKSKQERIRKLREKAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8R9	U3 small nucleolar RNA-associated protein 11, putative	0.854	160-169	RKKGKGKGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAQ0	Rab family GTP-binding protein, putative	0.785	224-239	KPPRPKSMGPPPRPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAQ0	Rab family GTP-binding protein, putative	0.758	555-571	SKAKEIANEKRSRRHSA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB16	Expressed protein	0.925	176-201	KRAAKFGLPEKKEAGKPASKPEKKAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB16	Expressed protein	0.887	210-224	KLAAEEEKKRKRAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCJ6	Uncharacterized protein	0.935	407-425	SGGRGRGRGGRGGRGGRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCJ6	Uncharacterized protein	0.807	470-486	ARGRGRGKAYSRGRSGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF11	Splicing factor u2af-associated protein 2, putative	0.944	76-87	EERRNKKRKKGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF11	Splicing factor u2af-associated protein 2, putative	0.934	211-239	KGKDKEKKEKTEGEKKKLTAEEKQKMSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHK2	PH (Pleckstrin homology) domain-containing protein, putative	0.751	160-169	QEKRRAWKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI45	Helicase C-terminal domain-containing protein	0.947	361-371	KKRRKNKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI45	Helicase C-terminal domain-containing protein	0.895	1101-1114	RKSLKRKIRKLKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI45	Helicase C-terminal domain-containing protein	0.729	422-427	KRKRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ54	Glutathione transferase, putative	0.7	283-291	GKKALKRLK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJN9	Metal resistance protein ycf1, putative	0.626	993-997	KPKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJP4	Shuttle craft like transcriptional regulator, putative	0.982	350-364	SKEKRSRKKPPKKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJP4	Shuttle craft like transcriptional regulator, putative	0.601	68-68	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLI1	HSF_DOMAIN domain-containing protein	0.819	195-202	KKKKARKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLL7	Transcriptional activator, putative	0.997	110-162	KSKAAAAANGNPPPTRSLKGKETFKHRTVRPGEDRKRKRQDKKQRRKSEPSEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM67	SUN domain-containing protein	0.88	255-263	PRRRRKSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN87	SLD3 domain-containing protein	0.879	199-208	KSRKRKRSSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN87	SLD3 domain-containing protein	0.62	329-331	SRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN87	SLD3 domain-containing protein	0.612	634-636	KPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNU2	Meiotic recombination-related protein, putative	0.854	25-36	KRPKGKERRGAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPG2	Gly-X carboxypeptidase, putative	0.847	366-379	SIKSRIKNPKKWKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP92	Peptidyl-prolyl isomerase CWC27	0.965	462-491	KARDLLGKPDKKKLKGNPNRRTVRNSGRNR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP92	Peptidyl-prolyl isomerase CWC27	0.868	185-209	KAQQKAKLEAKKDMEQRERRAKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP92	Peptidyl-prolyl isomerase CWC27	0.845	353-369	SKRGRAAMKAGNKRGRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR34	Very-long-chain 3-oxoacyl-CoA reductase	0.905	345-361	IRKRALKKAARDEKKAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E7	Zn(2)-C6 fungal-type domain-containing protein	0.977	171-208	PPKKRGRPRKHPLPVIPPDMKKDDRSSASKEGVKKRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E7	Zn(2)-C6 fungal-type domain-containing protein	0.675	269-280	KKEKESQVKKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7L9	Uncharacterized protein	0.998	59-168	RSARPLRPSLRSPLPSRVSWRSRVADKGARISRSRSPSPRRYRSRSIERYRPSKYKRYRSPSPTYQRRSPSPRVRSPSPARRSSIRRSPSPRPRSRSPPRKKPREEPKGS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8H6	Expressed protein	0.741	398-409	RTGRREERKARR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9V8	Fork head homolog XFD-2, putative	0.971	524-542	AAREGRVYVPKKGKKRRKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9V8	Fork head homolog XFD-2, putative	0.65	642-646	PKGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9V8	Fork head homolog XFD-2, putative	0.649	367-376	TRPPKASSAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA35	Uncharacterized protein	0.994	210-244	ERHRREREAREREREIEREKRERKEERRRHRLERE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA35	Uncharacterized protein	0.854	48-68	SPPRPPREESISPPRKRPKQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA35	Uncharacterized protein	0.673	26-38	RHEQRRYRKEQER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAA5	Cytokinesis protein sepa (Fh1/2 protein), putative	0.943	886-903	RGQRKSVRKKPPKVVRPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAN5	Ada3 protein (Ngg1 protein), putative	0.949	6-30	KKKDRKRKEREDEDREKEKEKDMDR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAN5	Ada3 protein (Ngg1 protein), putative	0.817	124-131	KKKKKIKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBF6	Translation repressor, putative	0.603	207-208	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBJ2	Uncharacterized protein	0.867	320-339	PKAKKRRIIKDGSATALKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX4	Ribonucleases P/MRP protein subunit, putative	0.981	100-166	RHLRRRAASHNPRRVPKRLRSRAAAEIDAGDSIAKKHRKIAKLRAKGNLRDRLSRTAIFRIRQRSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX4	Ribonucleases P/MRP protein subunit, putative	0.804	558-567	RWKRKPPAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI48	Expressed protein	0.988	298-315	RGKRRSQTKSKRRRRLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI48	Expressed protein	0.64	765-772	RKWGKEGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLT6	Endonuclease, putative	0.935	890-900	PRGKKRKGGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNM9	DNA helicase	0.654	849-852	KKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPA0	Type 1 phosphatases regulator	0.817	128-139	RARPLRKPRRHH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ66	Uncharacterized protein	0.719	802-810	KGKEKSRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIY8	Uncharacterized protein	0.797	188-197	RKPGQGKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5N8	tRNA-Lys	0.975	26-40	PQPIPPKKRKKAKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5N8	tRNA-Lys	0.88	102-124	QARIGPGNGRQKAVRKEERAKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5N8	tRNA-Lys	0.601	99-99	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8N8	Uncharacterized protein	0.91	165-174	LKGRPKKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8W6	Pyridoxal kinase	0.903	355-368	PKDPKRKARRMRLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Q2	DNA repair protein rad8, putative	0.867	178-195	KTAKRSSLRKLHPNKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Q2	DNA repair protein rad8, putative	0.782	246-261	AKKARTSLPKAKLRPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Q2	DNA repair protein rad8, putative	0.777	1256-1273	PKIHWIKREGKTNKKGNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9S8	Uncharacterized protein	0.922	586-665	KLKKPNKSETPKAKADKSPKFASSSKSNSRSRPSATPTSTPQKPKDSTPRKRSTPPARRMLARTVEAARTSPLKKKTSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV6	Ferric reductase transmembrane component 2, putative	0.954	764-780	KLRRARSRKFAKRKSAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD60	Uncharacterized protein	0.986	1160-1178	GKFGGKLEKKKKNKKRLGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDF7	Flavin-adenine dinucleotide transporter, putative	0.79	209-221	KRRRTEVKRRKYL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDY4	DNA replication licensing factor MCM2	0.76	13-22	RPKRPRSRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDZ2	Regulation of budding-related protein, putative	0.689	181-194	RRERREDKDRTERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFN4	Positive transcription elongation factor, putative	0.973	80-108	ETKKKRKRAEGDEGKDVKKEKEEGNGKRV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ71	Expressed protein	0.693	529-535	TRRRRWW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKX9	GTP-binding protein, putative	0.982	724-740	NGKKHFKRKEGKKRSGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLF5	rRNA processing-related protein, putative	0.991	472-517	KLKAKSESRIRARKDQPKVNKALAERVRRAEEREKALERKKKEKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLF5	rRNA processing-related protein, putative	0.916	750-770	GGRLQRRRPERSASKNAFRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLF5	rRNA processing-related protein, putative	0.734	33-40	GPGKHKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLG8	Serine/threonine protein phosphatase 5 phosphatase, putative	0.647	442-447	VKGRGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH8	Nucleoporin nsp1, putative	0.846	1485-1496	GGRRVKGLPRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH8	Nucleoporin nsp1, putative	0.639	133-137	KRIRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH8	Nucleoporin nsp1, putative	0.607	640-641	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPK4	Uncharacterized protein	0.999	225-284	KRRDEIKNERRRRREARRKTKKGNKDVKAKEWILKKKDLYRTRGKEGVPRDSKYTARKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPM1	BZIP domain-containing protein	0.979	128-182	AGRAAAGSASGSGRKGGRKSGGGEGDGKRELNKSERRKEQNRAAQKAFRERREAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ44	Peptide-binding protein, putative	0.979	123-135	KTKKKKKEKPKDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ44	Peptide-binding protein, putative	0.967	204-234	KLKELERIRAEIDAERKKKEEAEKERKRKQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ44	Peptide-binding protein, putative	0.889	555-591	AAARKLAERKAKSEASLREREAKVREEKERVEREMHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ44	Peptide-binding protein, putative	0.801	376-391	RAKRLKKGSAAEEKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ44	Peptide-binding protein, putative	0.715	416-423	RKKWKKDR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ44	Peptide-binding protein, putative	0.657	184-189	KKKEEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LHS9	Uncharacterized protein	0.775	246-260	KRKGEAEDREGKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LHS9	Uncharacterized protein	0.761	209-220	KNQRGKKGSAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5H9	Uncharacterized protein	0.741	173-178	GRRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5W5	Uncharacterized protein	0.641	769-774	WRRARA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5W5	Uncharacterized protein	0.637	780-789	RKSAGDRERK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO94	Pre-mRNA-splicing factor CEF1	0.981	174-215	GKKAKRKARERQLEEARRLAFLQKKRELKAAGINLRAKPKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO94	Pre-mRNA-splicing factor CEF1	0.804	269-276	RKKRQKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8E1	Protein-nucleus import-related protein, putative	0.998	26-122	RDRSRSRERHSSRRDEDRYRSRRRSYSRSHSRSRTRSPHRHRHRSPSRSRSRSRDRRDRDRSRSRDRGERRSYREDRHGGDHRGSGRPRSPRRGSGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K923	Expressed protein	0.995	320-342	ILRRRRRKRYRRKQSSRPGEPAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K923	Expressed protein	0.982	33-58	KELRKLKRKEQKERRIEQRRAHLKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9A7	Cytoskeletal regulatory protein binding protein, putative	0.861	257-283	RERRPAPSRPPPPDAFRPARPPGPRRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAZ9	Protein kinase, putative	0.961	170-184	SGPAAKKRKGGARKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAZ9	Protein kinase, putative	0.735	591-603	KKGWKSISPKKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAZ9	Protein kinase, putative	0.639	1118-1121	RKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBQ5	Expressed protein	0.994	63-100	GLRRRASRHHSEAGQKLVRRKKETTQKRDGEKKKKKRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEA9	Uncharacterized protein	0.985	811-835	KAEKKKGIKGFFKKMKPKGSRKNSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEA9	Uncharacterized protein	0.768	433-450	RHREEERHRKQAVKARHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEA9	Uncharacterized protein	0.661	185-191	RRLEKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIM6	Elongation factor 3	0.997	1020-1046	KAKKEKKLSAADKRKAKKDRMARRKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJN4	WD_REPEATS_REGION domain-containing protein	0.98	883-893	EKKKKKKKERP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK82	Zn(2)-C6 fungal-type domain-containing protein	0.815	42-59	KRKKRTGSSGKDGTKIKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKB0	Uncharacterized protein	0.879	21-30	KKAKKGKGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKN8	Pre-mRNA-processing factor 19	0.773	180-187	RKKRKPAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL00	Expressed protein	0.683	821-827	SKGKGKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL30	SSD domain-containing protein	0.932	51-70	RSAPRKQRVASKSKKLRWRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLA6	Expressed protein	0.874	278-293	KHWRKEDKRRAKAMRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLV8	Magnesium transporter	0.714	513-523	KKEQEKRKWAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ23	Spindle assembly checkpoint component MAD1	0.999	81-132	KEKKRRHPTIVGKEGEKLKKLEKQERAPKTKKRKRKSEITVKREPGVTPVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIS2	Zn(2)-C6 fungal-type domain-containing protein	0.998	94-153	KPKRKRGRPRGSKSRIRTTRPSRNTGRVKAESKAEPPRRKGVKDLQRSKDEAKKRERRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM90	Eukaryotic translation initiation factor 3 subunit M	0.883	424-436	RRGGKRREEKKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.967	407-427	RRKPGPAKGWRKIRGIDKKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.952	530-561	PPKKKNSKTKEPGVGKGRWTRPTKPEKELVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.943	464-474	KKGKKVKRRKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.898	1706-1723	FPVPGEKRSHKKGMGKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.853	289-296	KKKRKSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.817	684-726	KEGAAKAKRIVKELAAFWRKNEKDEVIARKKAEREALERAKAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.712	1694-1703	GKGKAKAAAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO16	Chromatin-remodeling ATPase INO80	0.694	1747-1753	KPPAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS60	Flap endonuclease 1	0.998	418-453	PKEPAAKDTGKGKGKATKGEKRKAEEKGSAKKKSKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS60	Flap endonuclease 1	0.988	317-332	SKLKSPKKKAPAKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS74	Mediator of RNA polymerase II transcription subunit 31	0.975	161-171	KGKRKKKKSRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7D0	Expressed protein	0.993	261-285	KRERYIKKRRRWARKDLKQKRRSRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7D0	Expressed protein	0.941	114-149	GSKGKRKRKSPTNDVTTRKVQKRHTETGKRLEKERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9W4	MFS domain-containing protein	0.733	523-530	RKRSKRAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB24	VHS domain-containing protein	0.974	220-284	RKRAREARIALEQREAEIERRERELRRKRDMAEIEERRRKDAAEEAENRRKLKEQGKKKNQQPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC18	Expressed protein	0.991	307-330	EKKRKKGKRFKDDSERKFYRRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE62	Uncharacterized protein	0.844	547-566	GREKKKGRNDIDKDGRKGER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE62	Uncharacterized protein	0.815	414-432	RERERENKNKEERRPGGRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG29	Uncharacterized protein	0.915	1007-1030	KGVEVRGKEKEKEKEPKTPIRPRH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG29	Uncharacterized protein	0.696	491-506	KSARSGSVKSARRAER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD0	BHLH domain-containing protein	0.61	103-105	KAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHJ0	Uncharacterized protein	0.683	170-178	KKERARVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIF1	Cation-transporting ATPase	0.939	1572-1582	KRWKGRRGKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIF1	Cation-transporting ATPase	0.701	271-282	RSSSRSRSRSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKP1	MAP kinase kinase, putative	0.996	105-129	AKKEKSRDGKERGDKEKRKKKHKDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLT3	Methionine aminopeptidase	0.945	369-376	KKKKKKKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLU8	Membrane protein, putative	0.669	505-509	SKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMK5	ATP-dependent DNA helicase II subunit 2	0.948	658-670	KKVPEKRKRRKAQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN64	Uncharacterized protein	0.999	453-484	KKAKPKPKAKAKPKETKEKKEKKAPAKKGKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN64	Uncharacterized protein	0.95	563-578	KQTKKSKKKTSSKKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN64	Uncharacterized protein	0.887	678-716	FGGHKRTGMSKKLKIVPLHSKIGPPAKALPPVPKKPQKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV5	Expressed protein	0.986	46-79	SGRKKKKRLNSRKPQSKLPEWARQTNEQRRERKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV5	Expressed protein	0.71	110-115	KKKERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7P1	26S proteasome regulatory subunit RPN2	0.775	804-830	EEKKKDKQKAAVLSTTARAKARERVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7S3	Fe2OG dioxygenase domain-containing protein	0.792	71-82	RRRKGVEKKDKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBB5	Uncharacterized protein	0.964	339-369	KKAREAEKKASQKVEQGAEQSRRKKRKIAKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBB5	Uncharacterized protein	0.765	282-292	EKSEERKRKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC58	SURF1-like protein	0.83	323-333	GRGKPKTRRPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD13	Uncharacterized protein	0.933	126-150	VGKDRERQKERVKQREKEKEKEREG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK5	Actin cytoskeleton-regulatory complex protein PAN1	0.962	661-743	ERKEAEEKSRKAEEAQKERDEARKRRLAEAGGAAAEPKSEEKPAEPAAPSLKSAMKKPAAPPPAPTPRSKAAPVPPPSRAHPA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK5	Actin cytoskeleton-regulatory complex protein PAN1	0.769	474-497	RQERRREEKAMEERAGVRRRDERN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK5	Actin cytoskeleton-regulatory complex protein PAN1	0.69	779-788	AAKAKAERRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFT1	B-related factor 1	0.987	592-622	KQEKRAALQRARGNDPSKNKPKRKRTAPHKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIQ4	RING-type domain-containing protein	0.783	510-516	ERRKKKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKI6	Expressed protein	0.991	106-156	IKEGKKEVKKSAVKERTEKTKAEGKGFFAKFFGNRDKSPKKEKKKTPKAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKI6	Expressed protein	0.67	261-266	FKPKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKI6	Expressed protein	0.628	250-256	HRRLSAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKU3	RAS1, putative	0.755	198-218	PRPKQIKQMKEKDKSGHNRRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMW1	Mitochondrial DNA polymerase catalytic subunit	0.752	422-429	KKNKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN80	Uncharacterized protein	0.998	134-173	RGKKRGSTSRKAKPPPKRAKTSAKANRQASSAKKKELKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN80	Uncharacterized protein	0.656	55-61	KKGKEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH7	Uncharacterized protein	0.984	92-105	EEKKDKKKRKKGMK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH7	Uncharacterized protein	0.781	371-385	GKRSGVTKRGGRRNG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNH7	Uncharacterized protein	0.623	230-234	RKVRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LHY6	Uncharacterized protein	0.967	329-342	RPPKKKIKRRKNLF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI30	Uncharacterized protein	0.799	310-320	SGRRKREEKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI30	Uncharacterized protein	0.69	293-301	ERREGRRTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI30	Uncharacterized protein	0.603	285-285	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M632	Expressed protein	0.956	712-725	AKNGKEKKKGKGPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M680	GATA-type domain-containing protein	0.956	22-45	PKARGHKAATGGKNRATKKRRALR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR02	ATP-dependent RNA helicase DBP8	0.985	407-429	PKKAKAREREAALGKKGKKPRQA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR02	ATP-dependent RNA helicase DBP8	0.665	606-611	IKRMKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS56	DNA damage-binding protein CMR1	0.988	46-62	KTKPKPKPAPKKRKAAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS56	DNA damage-binding protein CMR1	0.607	71-72	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K764	Sas10 domain-containing protein	0.998	417-434	SQKKKKEKKSKKEKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K764	Sas10 domain-containing protein	0.963	463-475	KPKKKSKKIKKIK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K764	Sas10 domain-containing protein	0.946	669-697	KNRGLTPRRSKTGRNPRVKKRQAYDKAQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K764	Sas10 domain-containing protein	0.801	624-634	KRRRKDEKRAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K764	Sas10 domain-containing protein	0.689	100-105	KKRKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K764	Sas10 domain-containing protein	0.683	593-598	KEKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8G9	Uncharacterized protein	0.915	131-144	KRHRPFERPKRKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9U1	Uncharacterized protein	0.902	284-308	KRLDRLEHRRDINRRSAQKHRAKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDG6	DRMBL domain-containing protein	0.871	776-797	SRAKMKKWFEKWLAEKAKRKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDY1	WW domain-containing protein	0.986	227-263	AAKRRREEEEGGSSKKKISKKDMDRFRKKAAERKARS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF34	G-patch domain-containing protein	0.982	381-412	PRRRRHREKGPKVHKEKNEEDQGWKRQKKVKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF34	G-patch domain-containing protein	0.696	717-724	KRNKRERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF34	G-patch domain-containing protein	0.638	48-51	KRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH30	SAGA-associated factor 11	0.951	200-228	KKKKTQNNSTRRNGSPNKSVAKGKKAKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHG8	Zn(2)-C6 fungal-type domain-containing protein	0.869	76-87	RKRKRDSTKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KID9	DUF4203 domain-containing protein	0.798	725-743	AKKKWEKQRAHEREEMRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK30	Uncharacterized protein	0.891	903-922	RKERQAAREKRVKEKREALR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK30	Uncharacterized protein	0.773	609-621	PKRSRRNISRRIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKR1	GATA-type domain-containing protein	0.998	175-208	RANKPKKERAKPGERREREKKRREGIEKERQRTH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKR1	GATA-type domain-containing protein	0.918	895-914	GKRGRAGGGEGARKEKQRRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKR1	GATA-type domain-containing protein	0.721	859-864	RRKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKT7	Na+/H+ exchanger AnNHA1, putative	0.828	748-777	RQRRKRMKPPAIVVSRQNSAGPPKRSIRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMK8	Uncharacterized protein	0.948	561-587	KLKTPKKDVQPLKTNAAGKAKRGRGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMK8	Uncharacterized protein	0.864	686-698	SRTARRARKKIHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMK8	Uncharacterized protein	0.786	861-874	KKTKVSSPARRRPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN38	RING-type domain-containing protein	0.969	1263-1314	PQLPKRRPPPPPPPRHPAAIARLPPPPPPPQSQAEPRARAPPPPPPLPPRPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN38	RING-type domain-containing protein	0.964	853-889	RVKEKKEKEKSKFSAPELSSSLPKEKRKDKRAIEKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN38	RING-type domain-containing protein	0.949	10-21	AARKPRKKPKAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN38	RING-type domain-containing protein	0.934	139-149	KGKEKGKKKRT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNU5	Sister chromatid cohesion protein	0.884	616-625	KFKKKKGKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNU5	Sister chromatid cohesion protein	0.731	369-376	SKKPRGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP88	Conjugation with cellular fusion-related protein, putative	0.629	109-112	RKPH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LHR4	Uncharacterized protein	0.976	517-540	KRKRSGIRKHGIKEGRRKERVLGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN00	Pre-mRNA-splicing factor CWC26	0.979	268-278	KKKKKGPRRPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN00	Pre-mRNA-splicing factor CWC26	0.903	198-234	RIREEEERRKEAERKEWTKGMVQRRDREERRRLEKKM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN00	Pre-mRNA-splicing factor CWC26	0.713	31-36	KKKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP88	Peptidyl-prolyl cis-trans isomerase-like 4	0.997	413-504	SRGSKRDRERSPKRERDRERERDRSPRRDRDRERDRSPRRDRDRERDDHDRRDRDRNGRDRERNGDRERYRERSRERENERYRERDDRDRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP88	Peptidyl-prolyl cis-trans isomerase-like 4	0.652	344-350	RGGRGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7I4	Metabolism-related protein, putative	0.986	109-124	TGKRGEAKRKRKSRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7I7	Uncharacterized protein	0.782	149-154	KKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K847	Uncharacterized protein	0.936	864-881	GESKSSRKKRAREARQAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8U7	GAR domain-containing protein	0.648	1661-1671	KRSSPIKEKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAG2	Expressed protein	0.912	66-80	RTTKGDDKRKRRKIA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAG2	Expressed protein	0.605	313-313	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBK2	Conjugation with cellular fusion-related protein, putative	0.979	447-459	GKRKRKRTRGKRI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBK2	Conjugation with cellular fusion-related protein, putative	0.715	216-230	KKRKALRSLLRRSDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBK2	Conjugation with cellular fusion-related protein, putative	0.699	236-243	HRGRARKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBK2	Conjugation with cellular fusion-related protein, putative	0.646	286-294	REKVHRNRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCD1	Specific RNA polymerase II transcription factor, putative	0.784	701-716	NKPPGEKRRGSGVPAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCG1	Expressed protein	0.96	212-227	EKEKSPKGGKKKNAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCG1	Expressed protein	0.641	412-415	KAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCK5	Uncharacterized protein	0.967	94-109	KAKEGKPKKSTKRKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCK5	Uncharacterized protein	0.76	242-253	RLKPEAAKKKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCU1	Uncharacterized protein	0.901	381-390	RKRGKGRKRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCU1	Uncharacterized protein	0.734	765-771	GKKGKKW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD04	MHYT domain-containing protein	0.989	214-248	RAKRRHKKIKDRGSKSQRERDEYREWKSSHKKGIQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG33	Uncharacterized protein	0.992	1001-1033	RRRWRAREAGKWWKLWAKEKRERREGGERKRRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG33	Uncharacterized protein	0.982	1562-1593	GKKRPRGEKDERAMLDREKKGKKESKAAKAER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGL3	Uncharacterized protein	0.647	91-94	KRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD4	Ribosomal protein L15	0.956	40-85	SRPSRPDKARRLGYKAKQGYLIYRVRVRRGNRKKQAPKGATYGKPV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJD4	Ribosomal protein L15	0.847	164-191	LTAEGKKNRGLGKGSKHNHQPQKATWKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKL9	Nucleolar protein 9	0.888	6-15	IRKRGKRKTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKL9	Nucleolar protein 9	0.719	769-776	KKKRRIQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMR9	Uncharacterized protein	0.9	103-120	KDKKEEKQKKRDGKEVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP57	ER organization and biogenesis-related protein, putative	0.989	247-267	RRKRQEAEKERRRRRRAGPSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP57	ER organization and biogenesis-related protein, putative	0.64	423-432	SRAAPSPKPA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LHY9	DNA polymerase	0.891	302-312	KKEKEKKRARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI84	Uncharacterized protein	0.901	980-996	GKKRELKGLWRKFMKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIY4	Zn(2)-C6 fungal-type domain-containing protein	0.924	235-252	RKPRKTGIKRGPYKRRPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ58	40S ribosomal protein S1	0.953	5-19	KNKRLSKGKKGIKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8R5	Uncharacterized protein	0.889	225-240	SRPPRNRKREPRAHSA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8S1	Expressed protein	0.966	397-413	PPKRKRGRPTKAEKAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8S1	Expressed protein	0.607	203-204	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K960	Helicase, putative	0.997	108-173	EKRKAEARAEIRKANKEKKEAEAKEIRREGVGDKRKPKRAEIESKDEGRGKRKRQNIGGRDEKKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K960	Helicase, putative	0.652	548-551	RKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9H7	BAG domain-containing protein	0.712	452-460	RKRKELVKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9H7	BAG domain-containing protein	0.692	112-121	RRVEEERKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Y8	Uncharacterized protein	0.974	334-376	KAPDGFKDNPRWKKTTKEKIKPAPKSQEKMKSPKQGILKFGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Y8	Uncharacterized protein	0.608	392-393	KK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBH7	Expressed protein	0.988	260-277	ERRRKKRAEKRAERSARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBH7	Expressed protein	0.734	654-669	KIRKEAMQKDGKWRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC59	Translocation protein SEC62	0.975	225-256	PKKKKKSGTHAKGHTHIKKHKSGSGSASGKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDB2	Chitin synthase	0.928	955-970	KSRLRKLRREERRRKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHT9	DUF2013 domain-containing protein	0.901	563-579	PTRRRKPPAPPRHAHPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ06	Uncharacterized protein	0.989	147-173	SEKPKKLNRRELKEKKEKEARAKRLVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ06	Uncharacterized protein	0.638	73-76	TKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKB1	Expressed protein	0.918	133-147	KPPRKRARQSKPRGH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKR6	Expressed protein	0.999	294-320	FAPKPKKSKESKESKKSKKSKKSKKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL70	Uncharacterized protein	0.996	252-317	KEKEDEKRSRKDRDRRTEDRGKSAEDKERRRKRKVQECERGRSRSQSPKRHSRHHFEEKGKSHRHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL70	Uncharacterized protein	0.933	178-189	KERRRRKEKKTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP36	Cytoplasm protein, putative	0.769	65-74	PPKGKAKQKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ98	Cation transporter, putative	0.945	185-224	PRKGRKRRGSFMSGLSRQASRGGAEGVKAKHKREQLPKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ98	Cation transporter, putative	0.74	566-575	KSERRRRGWG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI92	WD_REPEATS_REGION domain-containing protein	0.994	465-499	TKLKREMIEARNIKEDRRRKHSRAGREKPKAERKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI92	WD_REPEATS_REGION domain-containing protein	0.611	454-455	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP52	Patatin-like phospholipase domain-containing protein CNE02340	0.757	662-669	VRRRKQKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR00	ATP-dependent rRNA helicase RRP3	0.987	468-484	PRKKNKFTPGGKKKARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR00	ATP-dependent rRNA helicase RRP3	0.897	436-448	GGGKRGRDKGKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR70	Transcription elongation factor SPT5	0.967	98-109	RRAKRRRKQKKF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR70	Transcription elongation factor SPT5	0.775	343-357	REKRKERIAIGKPGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K789	Expressed protein	0.73	69-75	RRGRKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7G4	Expressed protein	0.779	78-86	LRKRHKRNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8A1	Uncharacterized protein	0.95	740-757	KDKKEKQEGEKKKKKLFG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K924	Alpha-amylase	0.601	598-598	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC87	HTH APSES-type domain-containing protein	0.993	233-268	EIPKMPPRKPAPKKQKENKRVDEKKQAVREKSKDKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC87	HTH APSES-type domain-containing protein	0.855	718-729	PHRGRPRKGGKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK0	Ubiquitin carboxyl-terminal hydrolase 12, putative	0.803	962-968	RKKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE84	Uncharacterized protein	0.892	25-42	SGEPKAKSAKELKKEKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX7	RING-type domain-containing protein	0.825	175-186	KRARTKSIRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX7	RING-type domain-containing protein	0.633	349-352	RRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGB8	Expressed protein	0.877	150-166	AKRARDMKRNKRAGGWK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGD7	DNA replication ATP-dependent helicase/nuclease	0.732	113-118	KEKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGD7	DNA replication ATP-dependent helicase/nuclease	0.729	131-141	AKKAKPLSPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGQ1	Brr6_like_C_C domain-containing protein	0.848	131-152	KKPRKFAKGAVTRTNRKRQQSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI11	Actin filament organization-related protein, putative	0.849	67-79	SKKKKVIRKIPPA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJM2	RNA binding protein, putative	0.999	145-375	PSPRRRSPSRSRSRSPPPARRRRSLSRSRSPSPRKGDRVPSYGRRRSYSRSRSPPRHRGGRDSFPGRNGNGYGPGPSGGRGGGGGRGGFSRGGGPPPPGGRDNGWRRERSPPVPVRKWGERGAPRRPSPEYGRGARSASRSVSPRGPRGGVRSRSPVRRRASVSRSRSPVRRRSRSRARSYSRGRSVSMSRSRSRSPLPRKRYSLSRSRSRSSTRSMSIDRSRSGTRSPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJT1	J domain-containing protein	0.833	269-279	KKVSKKTKKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN15	Expressed protein	0.985	120-145	EKPTKKRKKKGSDADGDEKKKTRPKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP42	MFS domain-containing protein	0.756	27-40	PRRPPVVNRRRRNA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPZ4	Transcription regulator, putative	0.989	506-523	NTPKRKKGPAPKRKREGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPZ4	Transcription regulator, putative	0.833	341-354	NTKKGKKQPEKAHE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR86	Clustered mitochondria protein homolog	0.98	1484-1502	SAKRGKNALRGKRRTGAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR86	Clustered mitochondria protein homolog	0.935	1067-1082	IKSKEKKKGSKAGAKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR86	Clustered mitochondria protein homolog	0.868	218-233	GRKGKGGKKELVKVKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6V4	ANK_REP_REGION domain-containing protein	0.931	273-292	AKSKAKTKHQFNKSKKRKAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K718	TFIIIC_sub6 domain-containing protein	0.767	186-198	RPRAGGKRGNKTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K718	TFIIIC_sub6 domain-containing protein	0.68	261-267	KKGRPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K725	Mutanase, putative	0.712	25-34	HRRRHVRRAL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7N2	Uncharacterized protein	0.986	165-204	GAPPKGGKVAENEEKRKAEERRKLIEDALRKDSKKKKHRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7N2	Uncharacterized protein	0.964	232-271	KKASQEKKDRDRAALEKQRADQAKAKADKQKRAAKQERRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7X0	ER to Golgi transport-related protein, putative	0.971	369-387	EQREKEKEKEKERKKFRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Y2	Proliferating cell nuclear antigen	0.99	255-273	PKKRKAAGKKDKANKRAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K823	Expressed protein	0.995	160-188	RVKELEKKEKERRMEMKKRRSMKKASRRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAE5	Uncharacterized protein	0.973	827-843	ESAKRSKKKAAKKHAQG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE60	Calcineurin temperature suppressor Cts1	0.905	111-121	KSRKIKKKGGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIS8	Uncharacterized protein	0.903	267-275	RKKKKQKKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJW0	B-block_TFIIIC domain-containing protein	0.991	1583-1601	KQKGKGTDKKLKRKGKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJW0	B-block_TFIIIC domain-containing protein	0.981	633-652	PHAKERAAPRNSKKGKGKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJW0	B-block_TFIIIC domain-containing protein	0.662	1621-1627	RKNRSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKC4	Expressed protein	0.91	109-118	KRKRRGRKNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KML6	Uncharacterized protein	0.998	667-715	VFERKLIKVKGIRNKRLRALGAKKRTKLERKKKIEEARMAKSMNIAAKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KML6	Uncharacterized protein	0.935	399-424	KNDGKRRRTGSPEKDGRGGKMKGKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KML6	Uncharacterized protein	0.896	231-244	KKKGDTRWKRKRRL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KML6	Uncharacterized protein	0.857	724-740	SKTRANDKATKKRRTRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KML6	Uncharacterized protein	0.767	51-65	RRLAKAPRYNKRKME
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNZ8	Expressed protein	0.688	79-88	RKLVKGRGRM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN42	Eukaryotic translation initiation factor 3 subunit A	0.996	741-783	KEEARRKIEEEKAQLREKVIKRKREEKERKLKEAREAEERKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN42	Eukaryotic translation initiation factor 3 subunit A	0.608	558-559	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO98	Chromatin modification-related protein EAF1	0.827	586-601	KRMNRRREAARAKSHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO98	Chromatin modification-related protein EAF1	0.754	14-30	KAENRWSLRQPKKARGP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO98	Chromatin modification-related protein EAF1	0.641	562-568	RMAAKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO98	Chromatin modification-related protein EAF1	0.601	573-573	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K754	RNA cytidine acetyltransferase	0.998	1035-1069	KAKAEKGKDAGARDAKKKRRESGGEKGGKKKVRRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K754	RNA cytidine acetyltransferase	0.904	68-82	RKKREAKIKRDVKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8A5	Zuotin, putative	0.995	297-377	RIKRIKAEEKAAREAKKKGGAVGAPKQLSAAEKKKLEEQKKKEEEEKKVAEKKANEASKADREAAKKAKEAARKNLKKWKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8A5	Zuotin, putative	0.865	266-278	EKKNKSERTRRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9L4	Uncharacterized protein	0.9	303-338	GKLKKPVVIPKRAPPPPPNSAPAPPIVRRSSRKIPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA28	tRNA methyltransferase, putative	0.961	65-79	PKKQTKRDRRKGRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBB2	Expressed protein	0.984	386-418	RKLKGPIKESRPPKSDSSRSRGESSKKGKRKPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBB2	Expressed protein	0.974	431-441	GKKKRRGRPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBQ8	Ribosome biogenesis-related protein, putative	0.998	593-683	KGGIGIQGKGLGKRVRELKDKLRERRWGEEPSQTKSREEKKEKKRKRDDGEERGQDERRGKKSEGEATEKSEKVRNGKRLGKKERMRLQKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBQ8	Ribosome biogenesis-related protein, putative	0.997	727-739	DKKKRRKKKKSKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBQ8	Ribosome biogenesis-related protein, putative	0.996	343-380	TRKSKRARRAERKAAEKAAKEEEIKREKGKKRREMEKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBQ8	Ribosome biogenesis-related protein, putative	0.995	492-508	SKKSKKKDKKKKNKNKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI3	Kex protein, putative	0.681	119-124	RAKRHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCQ4	Endocytosis-related protein, putative	0.992	537-569	KRDKRRAREARKKIEEEERKAAFKEARKAAKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCQ4	Endocytosis-related protein, putative	0.972	477-488	KKSKKKGKKNRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCQ4	Endocytosis-related protein, putative	0.961	809-821	KPKKKRRGRGEVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCT1	SWR1-complex protein 5	0.939	23-35	PKVKRSRKPRAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCT1	SWR1-complex protein 5	0.77	63-86	RAAKKAKLEEDAKNEAEERRRKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCT1	SWR1-complex protein 5	0.743	204-212	PKGPPRRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDB7	Ubiquitin-protein ligase, putative	0.931	8-21	AKRGKPRIRPPKKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDI8	RRM domain-containing protein	0.935	214-237	GAKVARGARGGRGRGGNAGGRPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KED1	Osmosensor, putative	0.948	342-357	ARRKGKGKEKEKEIKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH48	Uncharacterized protein	0.949	485-504	VRRARREQRESRRSKRIARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH48	Uncharacterized protein	0.929	59-76	GRKKGLKKEKTKDRLSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI23	Structural constituent of ribosome, putative	0.999	91-135	HRLVRSNLAEKVVKPSRKLRKERKNRSKKLRGKARSKAGEPAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIF9	Uncharacterized protein	0.809	168-179	KKVSRKRQKREK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIL3	RRM domain-containing protein	0.881	102-113	EGKKGKGKKDAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIL3	RRM domain-containing protein	0.867	253-266	KKAKMRGGRRVKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIL3	RRM domain-containing protein	0.859	81-92	PKDHEKKKRKTA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIL3	RRM domain-containing protein	0.675	207-225	KKKIQERNQRVGGQRERRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIL3	RRM domain-containing protein	0.622	18-22	KQKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIM8	Uncharacterized protein	0.641	988-994	KKGVLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIM8	Uncharacterized protein	0.612	2983-2985	KLK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJC9	Uncharacterized protein	0.758	88-96	PPRDRKKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJT9	Uncharacterized protein	0.937	1474-1491	GKAAKWLKKNFKNKKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJT9	Uncharacterized protein	0.844	1665-1678	EKEKEKKKAEEKLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJT9	Uncharacterized protein	0.734	357-367	GGRSMKKKSSD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJT9	Uncharacterized protein	0.617	375-381	RGASGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJT9	Uncharacterized protein	0.601	370-370	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKH0	Uncharacterized protein	0.989	955-980	RRKSKKEKEKEKDGEKEGKDKNKKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKH0	Uncharacterized protein	0.816	126-137	KLKEKKPGRAGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNA7	C2 NT-type domain-containing protein	0.923	807-832	KPAKKEGRRLGWIRGRGRQEKTGRTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNA7	C2 NT-type domain-containing protein	0.699	500-511	KKDVKQTRKERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KND7	RNA-binding protein rnp24, putative	0.884	22-37	EQARRDAKKAAKKAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KND7	RNA-binding protein rnp24, putative	0.848	100-109	RAARKKAKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KND7	RNA-binding protein rnp24, putative	0.796	373-391	RSGVARPKEKTKEKYNKHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KND7	RNA-binding protein rnp24, putative	0.638	412-416	RGKKW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KND7	RNA-binding protein rnp24, putative	0.602	421-421	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPC5	Protein-nucleus import-related protein, putative	0.911	81-96	PKRSRGRPKGSTNKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPC5	Protein-nucleus import-related protein, putative	0.885	180-226	KIPGGSGRGGFSVKGAAAAAARARWEKVRRERAERGEDDTPKSARRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPC5	Protein-nucleus import-related protein, putative	0.748	153-161	RRRGRPPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LJ48	Uncharacterized protein	0.971	94-112	KKRKRNSAPKLPKQTKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR06	ATP-dependent RNA helicase DBP10	0.995	708-802	GGGRRGRHGPPGQKRKAEDGDGGEDAGGKGRKDQGKSKGTGKGKDDFKQKSPGKPGKKGIKQSSGLKSAMDIRKQREIAQKRKEKNARKPQKFRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR06	ATP-dependent RNA helicase DBP10	0.715	552-557	KKRRKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR06	ATP-dependent RNA helicase DBP10	0.662	128-134	KGKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR06	ATP-dependent RNA helicase DBP10	0.613	654-656	KHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8C8	Uncharacterized protein	0.943	115-134	PGERRSARVRGKERGRDKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8C8	Uncharacterized protein	0.655	231-241	PRKSTPRTKPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8C8	Uncharacterized protein	0.617	803-805	RKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8C8	Uncharacterized protein	0.607	281-282	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9C1	Protein kinase, putative	0.951	888-900	HKRRKRGVRKGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9P2	Expressed protein	0.722	52-62	KRPKPSIKGKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAC1	Signal recognition particle protein, putative	0.983	320-355	KREKAEEKEKKKIGGGESAGEPKAPKMKKIVVRGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAC1	Signal recognition particle protein, putative	0.976	262-288	SKPSKKSKTKAKLPPKAPRPIVKLPTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAT5	Expressed protein	0.628	143-145	RRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAT5	Expressed protein	0.624	74-77	RKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB45	Cytoplasm protein, putative	0.639	2301-2307	KGLKRFG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB45	Cytoplasm protein, putative	0.611	2311-2312	RK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC9	Uncharacterized protein	0.991	944-960	SVKGRKKNAGKKKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC9	Uncharacterized protein	0.921	130-164	RRRKEREGATKLKMRMAAPPRPAHPASPPPRPPSP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC9	Uncharacterized protein	0.863	565-584	TSRRNRRPSHSPPPPARRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC9	Uncharacterized protein	0.633	86-89	RRKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEA7	Uncharacterized protein	0.949	155-175	RKGKSGKSKAVGRKPNKFAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEA7	Uncharacterized protein	0.819	255-263	NKREKRKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEV1	Ribosomal protein S2, putative	0.992	8-29	GRGRGGAGGRGRRGPRRGGKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEV4	Expressed protein	0.972	259-289	STKKRKERSQDVSPNRQKKRSRKVKWAFKSG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF80	Uncharacterized protein	0.711	134-141	QKPRPRRL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFU6	Uncharacterized protein	0.942	216-243	RYKRRRKVMQEAEEKQKKAHGIKKKEEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFU6	Uncharacterized protein	0.934	180-208	YSRRRAKQRAHQLAPPKIRAKPLRIQKRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFU6	Uncharacterized protein	0.917	275-290	KRAQGKRKEGPRRTKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFU6	Uncharacterized protein	0.862	1001-1037	QKKDRIDAMEKMKKMREMQKAEADKKKTERVEKEKAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX2	Uncharacterized protein	0.946	157-169	RRRRRLRRRTRPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGV7	Ribosome biogenesis and assembly-related protein, putative	0.814	15-37	KGFKSKHASKGSLKAAAKGKVSS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGV7	Ribosome biogenesis and assembly-related protein, putative	0.634	51-55	SKKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH77	Structural maintenance of chromosomes protein	0.968	65-86	KPKARRGVSKAKPKAVPAPKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH77	Structural maintenance of chromosomes protein	0.767	566-579	KKKHLETKMKKIKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD6	Expressed protein	0.634	832-835	GRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD6	Expressed protein	0.613	809-812	GARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD6	Expressed protein	0.603	807-807	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHF4	MFS domain-containing protein	0.674	492-500	RRDKREGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ48	Peptidase, putative	0.983	499-518	KKEEKEKKPAAKGGRGKKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ48	Peptidase, putative	0.955	1491-1522	ARKAPKRVAGRNDAETRANKRTKGGSKGKGRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ48	Peptidase, putative	0.752	924-937	AKAKNSASAKKGKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKQ9	Glycerol-3-phosphate O-acyltransferase, putative	0.643	686-690	KGKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL94	Zn(2)-C6 fungal-type domain-containing protein	0.833	416-423	GRSRKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNN3	Uncharacterized protein	0.971	344-371	RKRKGERSESKADRRARERKEGQMKPSG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNN3	Uncharacterized protein	0.967	6-49	ARSRKRSQKDIKPSAAHPPAFEERSKPVGPEQRPKKQKRPERGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNN3	Uncharacterized protein	0.652	446-450	KKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE3	Single-stranded DNA specific endodeoxyribonuclease, putative	0.992	1173-1217	KEKKRKAKGKRKMDEKEAGDDEKEEGRNSSSNKRKKTSARGRRRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE3	Single-stranded DNA specific endodeoxyribonuclease, putative	0.91	1242-1257	RGRGGSRARGRARGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE3	Single-stranded DNA specific endodeoxyribonuclease, putative	0.798	90-97	ERKRKKTG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI98	Uncharacterized protein	0.982	150-185	RHRSASARRRRRYSSSSSSSSPRRRSASPRRKRKDS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI98	Uncharacterized protein	0.971	83-105	KEEDRKKREEEAKRANNKGRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI98	Uncharacterized protein	0.868	196-212	SVSRSPSRSPPRRRRAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI98	Uncharacterized protein	0.787	129-136	SRARRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M621	POP4 domain-containing protein	0.981	333-350	KVNGGKRKRNKSRRKDPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M621	POP4 domain-containing protein	0.904	88-126	RKRNRGNAFEKKKAREEHERNVKTREELGLEGMRKVRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN26	DNA polymerase epsilon catalytic subunit A	0.962	1283-1300	MKKKWRKQRQEKARARKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN26	DNA polymerase epsilon catalytic subunit A	0.648	27-31	RRRGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6Z9	DNA dependent ATPase, putative	0.934	916-930	KHREGRRKDKGKEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6Z9	DNA dependent ATPase, putative	0.835	1059-1068	GVRREKRRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6Z9	DNA dependent ATPase, putative	0.761	1033-1046	RESREVKKEGRRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7L6	Uncharacterized protein	0.995	220-256	KTTSKGKENKPDKDKFKPGSRSKKEKKNDKEQKEKRT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7L6	Uncharacterized protein	0.739	451-465	IRKQARPKPSFGRQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7L6	Uncharacterized protein	0.675	383-396	GRGKNRYDSKRFKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7L6	Uncharacterized protein	0.615	186-188	KPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8B9	Expressed protein	0.991	8-25	SKKLKFKGDKPKKKKRSH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8B9	Expressed protein	0.84	271-284	KDRRDVKKAKKEGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8I7	BZIP domain-containing protein	0.924	161-188	RLKKKRRVTERRTLQNKTAQKKYRDKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K994	FmHP, putative	0.665	634-640	KMRKAAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA79	Uncharacterized protein	0.982	199-214	QTAKRAPRKRRKWLKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAI6	Uncharacterized protein	0.917	720-738	KKLERAKNGGGPVRRRHKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB22	Mitochondrial genome maintenance protein MGM101	0.898	297-308	KKNKKKLWRKKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBL1	54S ribosomal protein L31, mitochondrial	0.612	32-33	RK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGP3	ATP-binding cassette (ABC) transporter, putative	0.759	312-325	RMKRAYGKTKGRRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH26	Cell division control protein 45, putative	0.993	218-247	RKRRREDSVAARRKRRRDDDRPRKLPKAIK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIQ0	Uncharacterized protein	0.977	142-177	RRKRRDRTPKDGKIRTERPKRVDPVREFREKRAMLP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIK6	Uncharacterized protein	0.716	32-38	RKGRKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5P9	Uncharacterized protein	0.993	118-152	AKIEKPRKERRAAPKPPKKEIDAEKEVERKKREEQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5P9	Uncharacterized protein	0.993	165-210	KREPSGAPAQRLGRVASRRRPAPNVPGRKRRHAPAVPEGKSKKLPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP00	Myosin-1	0.87	978-989	PRKPKVKKAAKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP00	Myosin-1	0.83	1195-1230	PAIKAKPSIPAKPAIPAKPQVGAKPAPAIGGKPPVP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ90	ATP-dependent RNA helicase MAK5	0.973	752-772	GKRKLGSGRPGAVKKKKVEGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ90	ATP-dependent RNA helicase MAK5	0.922	6-31	KKTKLKLNKKSVRAPSKPTTEKKPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ90	ATP-dependent RNA helicase MAK5	0.896	414-427	LKRRSRSWKGKGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K777	Pseudouridylate synthase, putative	0.996	55-102	GKGRRGKRGNEGQARKEKKEKRDAKDPRAQRAWEPSEKTNGEKRLPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8I8	Uncharacterized protein	0.988	292-321	IRKKEKGRRASAKRNLQNKNAQKKYRDKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB47	TPX2 domain-containing protein	0.828	152-161	PSKRPRRPKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB98	Cytoplasm protein, putative	0.957	905-931	KEKEMARRREERKARIAAMKEQKKSKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBH5	Nucleolar complex-associated protein 3	0.998	554-596	RRGKNAKGSNKEKGGKDEIKGKKFKSEKRKKWATKNQKKRERE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBH5	Nucleolar complex-associated protein 3	0.987	3-30	KPGAKALGKRKAPASKPPAPKKAKAASA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBH5	Nucleolar complex-associated protein 3	0.917	37-53	NGRPKRKPDQPKKVKLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBH5	Nucleolar complex-associated protein 3	0.908	211-218	ERRKRKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBQ0	GYF domain-containing protein	0.941	266-286	RKKREAGSKKKSWAERQKERK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBQ0	GYF domain-containing protein	0.646	204-209	KARRAH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD79	Pseudouridine synthase, putative	0.997	264-294	KGRGQGRDRGRGRGKERGRGRGGRGGRGGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDV5	Uncharacterized protein	0.908	546-562	GKKFKSWAKGMRRKWRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDV5	Uncharacterized protein	0.834	402-420	RPVKSRQRIIRAEKKEKRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDV5	Uncharacterized protein	0.634	236-248	RPGGSSKLRQSRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEX2	Formin binding protein 3, putative	0.994	631-697	RDRDHKSSRRDDRDRDRGDRRDRDRERERDKERDRSDRRERDRERERERKHGGEQGEGREHKRRRLS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEX2	Formin binding protein 3, putative	0.866	512-521	RRIERRKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF69	Protein kinase CK2, putative	0.895	70-80	KPVKKKKIKRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGW2	Uncharacterized protein	0.944	641-667	EDRRKRKNAAWRRARYPSSRGEHLNSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGW2	Uncharacterized protein	0.922	167-175	KKRKRKARS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH85	AP-3 complex subunit delta	0.999	916-937	KVKRKKKAGEKKKKKEGKRESP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH85	AP-3 complex subunit delta	0.998	732-767	RVLREGRKKKKGKKGEEGEDRVERERRRAARRAKHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH85	AP-3 complex subunit delta	0.863	804-815	RPKSKSRQKKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHJ1	Aspartate--tRNA ligase	0.992	36-71	PSKSELKKRAKEAEKAKKAAERAAREEEDRKKREAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI55	RNA polymerase I transcription factor, putative	0.757	58-77	GRKRPRESDGDGKIRSRRTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIV3	Expressed protein	0.995	356-381	LPKREREIRRSERIRMRKRERRRRMR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKH3	Ribosome biogenesis protein RLP24	0.826	41-57	KMKRNPRKVRWTKAFRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKH3	Ribosome biogenesis protein RLP24	0.658	159-168	EKIKVRAAGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN17	Pathway-specific nitrogen regulator, putative	0.767	107-114	RAKKRTKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNV1	Membrane transport protein, putative	0.832	582-593	WGKKIRARSKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP97	DNA topoisomerase 2	0.997	26-62	KGKKAAVPKKKAPAAKAPAAKKAAPKKINKAPLASKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP97	DNA topoisomerase 2	0.943	1250-1272	KGSKPKAKAAAIKATQKPKKRAM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP97	DNA topoisomerase 2	0.617	1157-1159	PKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE1	Myb_DNA-bind_7 domain-containing protein	0.992	151-193	MLKKKEVAQKRAEETWKRNQIKRRKVRAAQNKDRAKRREEIRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE1	Myb_DNA-bind_7 domain-containing protein	0.986	8-34	IRRKAPRRRRIPAASTEASKKKRAGKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE1	Myb_DNA-bind_7 domain-containing protein	0.665	87-92	RAKRAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPN3	Expressed protein	0.955	342-365	RRKPSNSRKSKRSLKAPSRSHRIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPQ4	Cactin, putative	0.998	85-141	RDRDRDRDRRDRKRERSRSRERSYKKERKHRDSRSPSPSSKTRRKEAKAAAKAAAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPQ4	Cactin, putative	0.967	46-78	ESERNRDRDRRDKDDRGQGKDRERERRRDKGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPQ4	Cactin, putative	0.736	177-186	KKRDKEKKAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ96	Cell cycle arrest in response to pheromone-related protein, putative	0.908	537-553	GVKKAREKRMAAKRLRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5Z6	Uncharacterized protein	0.944	446-464	RVRGGRRAPRGRRQGARGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M654	Uncharacterized protein	0.998	273-306	KESSKKKKKQRRKNRHEHRHRSFSHSSKEKKRHN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR04	ATP-dependent RNA helicase ROK1	0.998	556-610	KKPTKNEKKKLAKAPPKRKAVGGGGRDLNREAGKKKKQMVEASKKRKMLERKGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR04	ATP-dependent RNA helicase ROK1	0.888	30-40	KKRKDRKGKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR92	Topoisomerase 1-associated factor 1	0.976	946-962	KKLLRRKARATRRRRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR92	Topoisomerase 1-associated factor 1	0.957	1044-1057	RGVKRKRGKKNGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR92	Topoisomerase 1-associated factor 1	0.947	568-580	RKRKNTHKKRKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR92	Topoisomerase 1-associated factor 1	0.894	979-992	HQHKKNPRQKRAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P40909	Ubiquitin-60S ribosomal protein L40	0.813	121-129	IRPKKALKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K790	ABC transporter PMR5, putative	0.691	210-217	RKKGDKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7T8	G-patch domain-containing protein	0.999	349-407	EKKRQKEEKKRKRDEKEVKEKEKKRKRDDDEDEKKDKKDRKSREGQKEKERKKKKEKSS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7T8	G-patch domain-containing protein	0.975	298-321	KTKKRARKEAKRLAKLDKETGKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8P8	Replication termination factor 2	0.783	222-230	KSSKKRKAD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9U7	Fe2OG dioxygenase domain-containing protein	0.79	5-14	KKQSKKRKLN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB40	Spindle pole body duplication-related protein, putative	0.905	358-386	RRKEVERIRKALAHWKRKWDDRRTERWKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB40	Spindle pole body duplication-related protein, putative	0.806	674-702	RRKATAWIKEKEKERLKPIFDRWRVLAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB40	Spindle pole body duplication-related protein, putative	0.769	793-805	RSQAKRSKRLRLA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB40	Spindle pole body duplication-related protein, putative	0.74	923-931	ARKHRGRPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDR1	Spliceosome assembly-related protein, putative	0.969	577-596	KKRARKDDKRGKEKAEKFKF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDR1	Spliceosome assembly-related protein, putative	0.95	26-48	AKSRGALKRLKAKARAGGGGGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF75	Endoplasmic reticulum protein, putative	0.992	347-369	GKKKKPGPGKASAMRKRKMALKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM1	Uncharacterized protein	0.981	13-35	KFKGGGDKKKKKKSHSSSDRAKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM1	Uncharacterized protein	0.908	86-103	QKRRREERAKHTAKKTHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM1	Uncharacterized protein	0.611	40-42	KQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFM1	Uncharacterized protein	0.601	44-44	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFW1	C2H2-type domain-containing protein	0.948	443-462	KRLPAEFKEMRKAWRKKKRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFW1	C2H2-type domain-containing protein	0.673	400-405	KKRPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGJ0	Origin recognition complex subunit 1	0.99	294-339	KKRKRPTKTAKTYAKRGRKVVTASRSKLPPRSKATPKSRKATKKPH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGJ0	Origin recognition complex subunit 1	0.699	480-489	FGKKGGGARG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH13	Expressed protein	0.989	440-474	KKSKKARKGKDEEGGEKKKKGLLGGLFSRNKSNKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH13	Expressed protein	0.654	1414-1422	RPLVKPKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHB4	Lgl_C domain-containing protein	0.79	893-898	KKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHV3	Guanine nucleotide exchange factor, putative	0.829	174-184	PKSKKAPPKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKD3	Uncharacterized protein	0.811	343-350	KREKRKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM68	PRCDNA95, putative	0.933	119-140	RRMEPKKFGGRGARARRQKSYR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM98	Uncharacterized protein	0.883	305-319	KARERERRRSRERGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMA5	Transcription factor, putative	0.998	220-283	KAKGKGKARQEAPKETAVKRKRGRPRKNVEQPSARAEEENRAGQKKKGKGKGTSGKGGWNRRPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMA5	Transcription factor, putative	0.815	358-364	PKKKKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMF7	Cellular response to glucose starvation-related protein, putative	0.839	167-191	KMGIHKSKELRREGEKEERERRERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP02	Histone acetyltransferase ESA1	0.98	121-199	KSKDEPKKKDRPAKAQPSKAPSRATGSPIPSDSLLKKAANKAAMAAGKATPGKAMPSSKLGKASKIGKAGKFPQKRKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP02	Histone acetyltransferase ESA1	0.745	533-541	KKTKAKPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR20	rRNA biogenesis protein RRP36	0.998	250-296	EKQGGKTAVKKLVEKKRKKLASKEKKSRPFAKGAEGMGRDTKRRRVA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR20	rRNA biogenesis protein RRP36	0.856	209-238	KAKKEEREKRTQGKAAWFMKKGESPKCEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6X2	Phospholipid-transporting ATPase	0.896	186-195	PKRRSKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7A9	Expressed protein	0.889	90-107	RRKKRRDLKRVEELAARA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9E2	Polynucleotide adenylyltransferase	0.999	31-119	SRKGKRKASDTPAPGEKQTKKNKKDKKKKGSKKSQPVDEPDKKDGLPGLSKKQKKALKEQEHKARKSDRKRDNSRGIEAGPRNKKEEQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9E2	Polynucleotide adenylyltransferase	0.993	726-743	KKGRKKRKRGVRSEERRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9E2	Polynucleotide adenylyltransferase	0.677	638-644	KGRGKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBA6	Zn(2)-C6 fungal-type domain-containing protein	0.742	24-32	SGKKAKQKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBA6	Zn(2)-C6 fungal-type domain-containing protein	0.717	744-752	KKRKSSAHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP9	Expressed protein	0.984	21-62	RKRAQAAEDAKRASIKASVDGVKKGKKRAKAAASKMANEAKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP9	Expressed protein	0.797	226-235	KDKQKRKQKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP9	Expressed protein	0.79	68-77	ITKSKAKKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC97	Expressed protein	0.991	349-366	HPKRIKGKGKGKKTRRMR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCL3	Ser/Thr protein kinase, putative	0.915	191-208	KHRASMRSKLRKGRERKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDJ1	Uncharacterized protein	0.992	291-322	PPARQKMLKKRRRRARGHLEKMEEQDRKEKIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDU5	Cytoplasm protein, putative	0.982	542-576	AEERKARKAAVKAERSARRAEKKSHKETFSTERKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDU5	Cytoplasm protein, putative	0.796	290-298	GGKKRHGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF12	General RNA polymerase II transcription factor, putative	0.985	618-644	SPPRTAMPRRKSKSKSKTKSKFKSNKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF12	General RNA polymerase II transcription factor, putative	0.938	261-308	KPRPRTRSRVRLETPVVRRQPRPSRPTRTLTKRHTKSEARSRRVRAQL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF12	General RNA polymerase II transcription factor, putative	0.8	117-124	PKKRKRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGT5	Zn(2)-C6 fungal-type domain-containing protein	0.916	73-84	RRRNKKRKASGA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH37	Uncharacterized protein	0.639	56-60	RRKNA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHE4	Fip1 domain-containing protein	0.987	666-692	DRERRRRRERSERSDKDKERSDKRKRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHE4	Fip1 domain-containing protein	0.846	721-745	RERERTRRKRSESEEDEGYRRSKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHE4	Fip1 domain-containing protein	0.802	623-650	KRDRERERDKESHSRDSRGRDRARDKDR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIH9	D-erythro-sphingosine kinase, putative	0.611	417-419	KPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJC7	Monooxygenase, putative	0.658	642-653	RREMRDRKDLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLQ7	Uncharacterized protein	0.998	168-245	KSKKPTVKLLPPSSRRAQKADEKKKEKKKISRSMETKAERRKGKEMELRKRSKKAALAMERKGKTPRGPKKGMGKGRH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLQ7	Uncharacterized protein	0.995	49-85	SKRKKAKAEEKKARAKERERQEHLEERRNARKELRQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLT8	Uncharacterized protein	0.996	683-705	RREAKKAEERAAKKGGKKKGKKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNI2	Chromatin remodeling-related protein, putative	0.637	33-36	KKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNI2	Chromatin remodeling-related protein, putative	0.636	51-54	SKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP50	PAN2-PAN3 deadenylation complex subunit PAN3	0.803	22-34	KAKEKEKKHSPEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6W9	Uncharacterized protein	0.978	859-999	PAGRFDKRAKRDGRDGRDRRDRHDGPGGREGLKGNFRGKQGQDREQGGKFDKDRPRGGQNGPRRDYNDRGGRNERGGRNDRGDRPGQVQPRQPGRRDQKSVNQVKKDVKTKEAGEKRGIEKFGSQLGSMIGRKRKMRKGAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6W9	Uncharacterized protein	0.939	664-680	GDKSGGKGKGKGGKKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7T1	Expressed protein	0.643	64-81	RKEARTIRNRESAQRSRN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8B5	RING-type domain-containing protein	0.7	432-437	RKHKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8D2	Translation factor GUF1, mitochondrial	0.925	655-671	KLKHLNKQKEGKKRLKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9B1	Expressed protein	0.982	564-590	LWRKFRKERKKVGSRLRQAEGQKRKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9J6	Uncharacterized protein	0.991	606-655	KSKSRSRVRGSRVRNPSPSRSRSRGRSDGRRSRAREMSKVRGSHSRHGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCF2	GPI anchor biosynthesis-related protein, putative	0.824	171-176	KKKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCR6	Spindle pole body component	0.656	901-905	RRRRV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCV4	Protein-histidine kinase, putative	0.795	249-264	SVRRRRSPPNSFKRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY9	Uncharacterized protein	0.972	513-542	EGRMRAGSAAKGKSNGKNKDKGKGKGQSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY9	Uncharacterized protein	0.751	477-484	RRKRREEE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY9	Uncharacterized protein	0.616	489-491	KGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY9	Uncharacterized protein	0.609	359-360	KG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY9	Uncharacterized protein	0.607	352-353	RA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCY9	Uncharacterized protein	0.601	356-356	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHQ8	Nucleolar GTP-binding protein 2	0.992	686-717	KNRNRDRKVPKNPGKRSRGDDEPTGKKAKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMR4	Uncharacterized protein	0.933	806-813	KKRKKKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNI6	60s ribosomal protein l7, putative	0.924	22-53	KRRTNEASREAKLAAAAEARKAQKAKRKVIFK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNL7	ARF guanyl-nucleotide exchange factor, putative	0.877	272-299	KATRRAHEERRSRSISGRPRSHSRGRAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNL7	ARF guanyl-nucleotide exchange factor, putative	0.848	117-123	KKKKRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP58	Pescadillo homolog	0.997	604-632	SNREKAAEKEKLEKKRKAIEKRKAKEAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP58	Pescadillo homolog	0.739	570-597	KKVPASQKEKKGEEDLRKIMMSNKKAKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6V7	Store-operated calcium entry-associated regulatory factor	0.676	272-277	RRRRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6W5	CUE domain-containing protein	0.992	97-133	RGGRGARGGRGGSRGGRGGRGGEPSRGGRGGRGGSRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6W5	CUE domain-containing protein	0.725	60-68	KKKAAKPKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K800	Uncharacterized protein	0.812	339-349	RKERHARKKGN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8K1	cAMP-specific phosphodiesterase, putative	0.838	209-217	EAPKKRRKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K966	Zn(2)-C6 fungal-type domain-containing protein	0.925	546-555	PKKKRGRPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB09	Uncharacterized protein	0.977	228-254	RRQEEGRRPSRQRGKEEQRKPPVRKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB09	Uncharacterized protein	0.927	132-157	KKGLRKKDDAGTGYAGRGGRKKNKRM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBG2	PWWP domain-containing protein	0.999	162-202	KAGKRKREEPKRKKAAKKEEEPKPKKAKAVSKAVSKAGDKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBG2	PWWP domain-containing protein	0.912	10-28	KPAPAKKPAPRPRAAAAKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBW5	Small nuclear ribonucleoprotein, putative	0.752	171-177	PKKRRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBW5	Small nuclear ribonucleoprotein, putative	0.633	144-146	KKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDP2	Expressed protein	0.998	353-378	KARKRAIRRRRRELKRKDAIKAKAKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDP2	Expressed protein	0.981	253-264	VKAKKKTKKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDP2	Expressed protein	0.731	218-227	PSKNKRKLDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFG1	Zds_C domain-containing protein	0.99	510-536	KEKKGKFFSKKKDDKEKKGKKDKDRFL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFG1	Zds_C domain-containing protein	0.718	245-256	RRSARTKIRKAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFR3	Pre-mRNA-splicing factor 18	0.983	28-67	MRRADIERMREEEERRKKEEERKEKEAKKAQEAKEKTVKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFR3	Pre-mRNA-splicing factor 18	0.644	180-184	ERGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFR3	Pre-mRNA-splicing factor 18	0.643	206-209	DKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFR3	Pre-mRNA-splicing factor 18	0.603	26-26	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIG4	Ribosomal chaperone, putative	0.995	77-100	GKKRKKKNYTTPKKIKHKRKKVKM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJW9	Kinase	0.709	77-91	MSKGKEREIPRQKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK98	Expressed protein	0.868	82-93	RGRGGRRRGRRY
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKX3	Fermentation-related protein, putative	0.743	1992-2008	RKAKEKLHAQKGWRSPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KME6	Expressed protein	0.754	443-450	RRRKGKLK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KME6	Expressed protein	0.601	187-187	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMI5	IPPc domain-containing protein	0.966	187-208	LRHKKEIKEKKEKEKEIKEKDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMI5	IPPc domain-containing protein	0.631	631-634	LKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV6	LisH domain-containing protein	0.954	949-964	PSPPERKRKRKNSEKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV6	LisH domain-containing protein	0.629	1028-1032	RREKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY4	PWI domain-containing protein	0.998	266-416	RDRARDEGWGSRGGGSSVNPRERNARRPTPPRRPTPPRRPSPPRRPSPPPTAQIRIRGRGRGRSLSRSLSRSRIPSRSLSPPVRRDRGHGRKYGQDSDRGRSLSQSRSRSRSRSDTPPRTQTRKRPRSVRSRSRSRSRSHSRSRSRSRTPV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY4	PWI domain-containing protein	0.993	179-230	RGGGGVPRGRDARDGRDGLPTRPYPPARSPRHRSRSRSRSRSRSRSPPPRRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY4	PWI domain-containing protein	0.617	259-262	PRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY4	PWI domain-containing protein	0.613	255-257	RRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNQ5	Uncharacterized protein	0.944	267-296	GMNRKMKRELFKRLKQKEEGDGHKGKKQKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNQ5	Uncharacterized protein	0.819	218-240	RKVEEKKKLSKRAINDTTRKIRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP29	Expressed protein	0.75	40-46	QPKKKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP29	Expressed protein	0.614	83-86	KLPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP50	Uncharacterized protein	0.682	151-162	KKRQRAAPWASK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV1	Expressed protein	0.984	12-27	VRASKRPERRKKRPKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPV1	Expressed protein	0.681	45-50	RPHRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ20	tRNA (Guanine-N2-)-methyltransferase, putative	0.999	89-111	KWRIRLERRGGKPRPKKKKNKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5V2	Ribosome biogenesis protein SLX9	0.997	126-167	EKRVKTKEEREEERRARLEKEKEKRKIGSGKGKTLGEKKRKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5V2	Ribosome biogenesis protein SLX9	0.75	85-93	LRRQKRKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAF2	Ras2, putative	0.956	185-204	RKIRAGKGKMRNRRYRQRRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV2	HECT-type E3 ubiquitin transferase	0.791	2625-2636	KHTSKKGKGKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC32	Uncharacterized protein	0.998	263-329	DKKKKGKKRSNEEEEEKPKPKKKKKQPAASSATAAGDAADGEKKKPAVKKEKGAASEKKKKVEKKKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCA9	RRM domain-containing protein	0.985	861-876	WKRRHREAKKQRRRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCA9	RRM domain-containing protein	0.767	178-191	KENSRRRARLPPAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCA9	RRM domain-containing protein	0.704	490-496	GKKKERE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCA9	RRM domain-containing protein	0.673	111-114	RKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP4	Uncharacterized protein	0.949	2110-2119	IKKKKKRLNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP4	Uncharacterized protein	0.932	2022-2030	AKEKKKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP4	Uncharacterized protein	0.832	551-561	RKRQQKKRRTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDH9	Uncharacterized protein	0.641	505-510	KSARKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEE1	60S ribosomal protein L36	0.969	72-95	NSKDKKAKKLTKKRLGTLLRSKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEE1	60S ribosomal protein L36	0.622	38-40	KKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEX6	Myosin heavy chain, putative	0.993	133-153	EPPKESKKSKKKAAKKEKQEA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEX6	Myosin heavy chain, putative	0.95	7-28	KEERAKQAERARKLLAQRKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHI3	Structural maintenance of chromosomes protein 5	0.887	397-414	RKKIERKEGEKHALRKKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHI3	Structural maintenance of chromosomes protein 5	0.782	319-333	AARLHKKIKLKVERN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHK1	RNA helicase	0.623	752-755	KKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIT6	Dynactin, putative	0.914	1248-1262	REWKKKEKRLEKKLE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ76	Transcription factor, putative	0.807	44-58	RRVGRQPGVKNRKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJA8	Retrograde transport, endosome to Golgi-related protein, putative	0.994	1286-1297	GSKKKKKNRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS2	Uncharacterized protein	0.855	397-411	KRRREERERKAREEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKC3	Expressed protein	0.702	585-602	PRRHKQEREESSRSRRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKN7	Pre-mRNA splicing factor, putative	0.998	98-132	SRKEKKKKKEKEKEKEGSRERDVVGVKKARHSRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKQ6	GTP binding protein, putative	0.998	1089-1154	KKDKAERRKAKQDERKGAYRKKVGEKDEKREEKIREERRERFKKEGLKRKREEMSEGKGRGKKSRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKQ6	GTP binding protein, putative	0.814	7-25	AHHKPSAGAKHAKKDAAKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKQ6	GTP binding protein, putative	0.618	429-431	RRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKU2	Expressed protein	0.821	148-154	PKKKKKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKU2	Expressed protein	0.744	52-57	KKKKKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLH5	Uncharacterized protein	0.997	278-333	RRAVKRREKERLRAEKAKIQQVQAEKRKTKAAERAKVRREKAKATRQQKAKGARKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMB8	Uncharacterized protein	0.698	53-67	HKRRHTLLGSKGRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMR5	Uncharacterized protein	0.783	568-584	KSKGKEHINVRERKKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV8	Uncharacterized protein	0.979	438-463	AEAKAKRVAKIKSKTFRKLARKRAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV8	Uncharacterized protein	0.953	130-146	KGKGKKKAKDVVRKPAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV8	Uncharacterized protein	0.863	848-859	GKGAKKRKANPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV8	Uncharacterized protein	0.674	490-504	RERAKERATLRHGAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV8	Uncharacterized protein	0.635	23-26	IKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMV8	Uncharacterized protein	0.601	20-20	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPZ5	Pre-mRNA splicing factor, putative	0.755	476-490	RKRREEEERQKRRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPZ5	Pre-mRNA splicing factor, putative	0.629	259-262	RRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIR9	Uncharacterized protein	0.924	555-579	KKFNKGKRRAVNAKLKAEEARRIKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIR9	Uncharacterized protein	0.871	918-928	RRKRKAKAERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIR9	Uncharacterized protein	0.774	39-69	STKKLEARVPRRAEELKKDEQKEPPTLEKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIR9	Uncharacterized protein	0.606	28-28	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM78	Polynucleotide 5'-hydroxyl-kinase GRC3	0.846	39-54	PKRRKTRQTSPKPRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM78	Polynucleotide 5'-hydroxyl-kinase GRC3	0.606	736-737	RK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7B8	Protein kinase domain-containing protein	0.989	499-514	REKEKEKRKSKRKAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7B8	Protein kinase domain-containing protein	0.735	576-587	KEKEKEKKQSKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8S6	Expressed protein	0.89	617-629	KSKKSRSKRISKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9M9	Uncharacterized protein	0.739	877-895	KGRRRRSLSLSLRSKSSKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Y7	Deadenylation-dependent decapping-related protein, putative	0.74	259-269	KRGPRKTAKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Z6	Uncharacterized protein	0.862	29-52	RSKSRPRPSSRSPGSRSRDGSRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAK3	Uncharacterized protein	0.99	267-287	EKPSKASGRRKKSEAPKRPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAK3	Uncharacterized protein	0.989	386-409	KKTRAKSKKEKKEQKATAKSKGKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAK3	Uncharacterized protein	0.954	218-237	KPNKASGRPKKSIAPKKSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAK3	Uncharacterized protein	0.882	440-459	KPEKKTRAKAATTAKGRKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAK3	Uncharacterized protein	0.75	340-348	KATKGKKKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBB1	Lysine--tRNA ligase	0.864	59-85	KRRQKERQRAAQKAEKAAAAPAAAQPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCX1	Chromosome organization and biogenesis-related protein, putative	0.67	733-741	DKKSVKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD45	Uncharacterized protein	0.703	169-181	AKTKAKSKSQAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE40	GATA-type domain-containing protein	0.937	597-610	AKRDGKQKPRKKRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEC1	Uncharacterized protein	0.974	403-416	TKKRKSGRKPKKVE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEC1	Uncharacterized protein	0.648	331-335	KKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KED4	Uncharacterized protein	0.904	1655-1690	KTKAKNVRKAEQQSERKRVDSKAKRQALGWGRKRDS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KED4	Uncharacterized protein	0.891	1756-1776	NKPRPLKDRGTNKSPAKRKPI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KED4	Uncharacterized protein	0.883	297-323	PKKTLRKEKTKSKVWGLLGRSKSKRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KED4	Uncharacterized protein	0.68	96-103	RTKAKPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KED4	Uncharacterized protein	0.675	54-61	VKEKPGRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEH6	Uncharacterized protein	0.995	430-480	SKREETREKLKIAKAETKAGPKGKAKSEPKKVKEEVKEKPFDRKELDRAVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEH6	Uncharacterized protein	0.962	689-707	KKEEKEKKEKNKEKKPEPG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET2	Uncharacterized protein	0.66	93-98	PRKARA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFC4	Uncharacterized protein	0.94	748-756	RKEKKKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFC4	Uncharacterized protein	0.937	115-133	KKTASQNKKGKKVVGKKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFC4	Uncharacterized protein	0.769	149-165	GREKKRSIKLEDAERRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFC4	Uncharacterized protein	0.753	540-551	RRRSRRNRDAAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFC4	Uncharacterized protein	0.701	554-564	SSKEDKERRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFG9	60s ribosomal protein l33-b, putative	0.68	14-19	HKRGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX3	UAS domain-containing protein	0.996	364-410	KDRERMRVAKQKEEAERIKKEREEKERREKEAIKEKRKVWRRYARKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFX3	UAS domain-containing protein	0.893	90-106	RRLSGTGARRPRPKPRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHB1	Cytoplasm protein, putative	0.766	9-19	GPLKKHGGKKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHR9	RNA processing-related protein, putative	0.685	36-41	KKRLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHW3	Uncharacterized protein	0.935	369-382	GGKGKKGKTKKGGA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHW3	Uncharacterized protein	0.744	20-31	HKKRSSKDKSGT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIC0	Calcium-transporting ATPase	0.994	185-201	GANKKGKKGKKGKKDKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLJ8	Uncharacterized protein	0.995	614-635	KERREKEKEKEKKGVRGKRRKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM57	PolyA_pol domain-containing protein	0.988	495-510	PPRPSKKAGKGEKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPD5	Expressed protein	0.943	799-827	EPKNKKRRQSASTGIKPKSGSRRNSKEKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5Z9	Uncharacterized protein	0.971	18-49	SSRGKRKAKGGSSSGNAASTSRRGRGRPRRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR74	FACT complex subunit POB3	0.972	554-584	RKKTQAKRTKAKETSGSGSEDEKPKKKKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR74	FACT complex subunit POB3	0.639	495-503	KNDKSKTKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8W4	DNA dependent ATPase, putative	0.956	194-211	KPKKAAPKKAVKKQNRAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K954	Rho-GAP domain-containing protein	0.908	603-628	AKRKEAGERRSIGERESYPKARKRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K954	Rho-GAP domain-containing protein	0.801	207-219	KWKRLPRKYRKNV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N5	Mitochondrial ribosomal protein s24, putative	0.998	12-52	KHKKDKSKEKHGKEKHHHDKSKSKKDKKSKSEKHEKGEKSP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N5	Mitochondrial ribosomal protein s24, putative	0.98	305-325	KAYRKEEEKKKRDARKARKEG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N5	Mitochondrial ribosomal protein s24, putative	0.954	345-360	RKADEQEGEKRKKKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N8	Replication factor C subunit 1	0.981	973-1001	KAVKPKGKAAAKSASKPTAAKGVKSKAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N8	Replication factor C subunit 1	0.978	201-261	REKPKPKSTANKSPAAPKKSTSVKKPAEPKTAKMEEPEKKEEKKFDWRAAAAARAAGPKAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N8	Replication factor C subunit 1	0.89	368-401	TKAREKEEKKILEQAKEMEEREKKEEKERIRKQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBN4	C2H2-type domain-containing protein	0.952	581-604	ARRGRPIARGRGRGRAGTSARGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC93	C2H2-type domain-containing protein	0.996	172-195	ERERRKDERRRKKMEREKREERRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC93	C2H2-type domain-containing protein	0.84	225-237	GKKDKRQERKEKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCB3	Expressed protein	0.788	51-62	KPKTSKPRKRVN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI8	S1-like domain-containing protein	0.934	3-18	KNKGKGGKNNRRGKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD01	Nucleus protein, putative	0.707	401-408	SADRRKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD19	Cell wall integrity protein scw1, putative	0.677	172-179	RDRRRERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFJ4	ERF-3	0.876	182-210	IGGKKEEKKEEKEASSKSSPKPAAPTPKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFJ4	ERF-3	0.854	678-688	KKTRRKSKKPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGK9	E3 ubiquitin-protein ligase listerin	0.94	42-65	SRKQRGEKKLSKAQKRAMPKVKQY
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGK9	E3 ubiquitin-protein ligase listerin	0.728	14-21	RKKHAAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGP5	AAA domain-containing protein	0.624	251-260	ARNKELAGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD5	Uncharacterized protein	0.636	203-207	RRRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHD5	Uncharacterized protein	0.61	516-517	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI73	DNA repair-related protein, putative	0.838	306-322	KRKIQASKKVMRQKRRN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLS8	RAD17 isoform 4, putative	0.982	429-464	RKHGDKDKVGKKRKEREEEVASAKGRGKGRGSMGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY9	Uncharacterized protein	0.642	219-229	RRRHSLRSTKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNA4	Uncharacterized protein	0.979	1390-1404	KEMKRKKRAGRARRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNA4	Uncharacterized protein	0.754	1484-1495	RGKRLGRPPKNR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNA4	Uncharacterized protein	0.729	1624-1630	IEKKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPB8	Endoplasmic reticulum protein, putative	0.839	474-487	RKALKRGLDKRKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPB8	Endoplasmic reticulum protein, putative	0.643	352-356	KKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ77	Transcriptional activator, putative	0.694	59-63	RKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIT1	FCP1 homology domain-containing protein	0.973	71-84	ATRRRGRRSRRKRL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM48	pH-response regulator protein palC	0.975	375-400	RAKLKGLSIGKSRERKKEERRARMGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CN36	Protein EFR3	0.687	941-948	KKKGTKAP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO28	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.714	719-729	KHLKEKGKLRN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO28	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.631	354-356	KKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO28	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.619	623-625	RKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR16	Multiple RNA-binding domain-containing protein 1	0.756	113-123	RGEKSKEKRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR16	Multiple RNA-binding domain-containing protein 1	0.681	749-753	RKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS10	tRNA (guanine(9)-N1)-methyltransferase	0.95	71-102	SKKAMKRAAKQARLEEIKPLKRAAERERRRQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS10	tRNA (guanine(9)-N1)-methyltransferase	0.812	378-391	APGRKTKRAKTETK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS10	tRNA (guanine(9)-N1)-methyltransferase	0.697	125-134	RRRRVEKERK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6Y3	Serine/threonine-protein kinase RIO1	0.998	574-622	KKSRGFRHEDRESKKERKKAVKEEQREKRKTKMPKAEKQKLIKKSASRH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q5	PIPK domain-containing protein	0.865	430-440	VKRRIPRRRHR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Q5	PIPK domain-containing protein	0.857	369-381	SKKGRATQRKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K949	Bacteriophytochrome histidine kinase, putative	0.944	884-900	RSRGRGRGRGRGGRQRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9E6	Uncharacterized protein	0.727	305-318	KRPRVKQSLRRRPI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBA8	Uncharacterized protein	0.814	188-205	AKWGYRKRLAREVRQKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC31	Defect at low temperature protein 1	0.696	52-56	RRKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN6	Exocyst complex component Sec8	0.711	51-62	RRPHKSEARMKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDP5	Sterol 3-beta-glucosyltransferase, putative	0.662	140-145	KKVKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDZ3	Pre-mRNA splicing factor, putative	0.891	196-209	RSERKETKRKRGGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE05	Uncharacterized protein	0.965	233-277	KRAKVKKIGKTKNDSKGTEDDGEGRTKARMEEEKKPTKTKKKSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE05	Uncharacterized protein	0.929	444-463	KESAKGKEDKREKERKERGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE05	Uncharacterized protein	0.754	12-20	LKKRPSRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEW2	RED_N domain-containing protein	0.999	188-215	FKSIAQKKAEAKAAVDEKKKKKKKKKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEW2	RED_N domain-containing protein	0.99	384-474	RYDRRRSVSPYRRRSPSPYRQRRRSPYSRSRSPVYKEDYKRRRTAYDRSSSPRRRYASRSRSPPRHRHPPSPSPKSRSISRSPPAPVRERS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEW2	RED_N domain-containing protein	0.984	330-378	HGYGKGLGPRSPGRRHSPGKRTRSRSREYRYLSRSRSRSREYSGRRYTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEW2	RED_N domain-containing protein	0.95	28-79	PPPKRGWGLKAKEGYEKKEEPPKEKESRPAFAPRQQMKKDSKYKDRADLRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEW2	RED_N domain-containing protein	0.797	536-544	EKKAKKAKW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEY0	Uncharacterized protein	0.987	263-332	AKEKEDKKATPHRLSKSESREKEEEIPPSPVVVKKTPSRKTTLDKDKKDKKDKEKEDKERKERERDEKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB8	Uncharacterized protein	0.981	74-107	RGAKTNPVPERNEVTPRKRAKGARGKAMGKAPKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB8	Uncharacterized protein	0.875	230-241	KTKEKNRERKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB8	Uncharacterized protein	0.668	117-121	PRKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH04	Ribonucloprotein	0.988	97-132	GKKLSKKLHKTVKKASKARQLKRGVKEVVKALRKGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH04	Ribonucloprotein	0.974	52-65	LKKQKKEKKEKRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH04	Ribonucloprotein	0.9	8-17	KKEKKDKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHI8	Expressed protein	0.641	290-294	KAKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIH3	Uncharacterized protein	0.996	50-100	NKSHKGQISKKKRAKLEKGKEKAAELSGKLEVKVREREDRKAKRQRAKKAW
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL58	Transcription initiation factor IIF subunit alpha	0.944	479-533	EKEKEKDKEKEKAKEKDSSRNPSQPPSRPSSRPPTARTSSPSGSNPRYPSPKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL58	Transcription initiation factor IIF subunit alpha	0.857	177-186	GGRKKRVKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL58	Transcription initiation factor IIF subunit alpha	0.808	673-681	PPRPKKHKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL58	Transcription initiation factor IIF subunit alpha	0.655	441-448	KLRKIMRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMB6	Uncharacterized protein	0.652	208-214	TKKQHKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNN4	TAFII55_N domain-containing protein	0.997	80-109	RGRGRGRGRGRGRGSRGGRGSRGARGGMRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNN4	TAFII55_N domain-containing protein	0.89	285-296	KHVRKRRFRKRM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPL9	mRNA-nucleus export-related protein, putative	0.955	465-489	DRDREPPRSRGQAPPRRRSRSPNRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPL9	mRNA-nucleus export-related protein, putative	0.885	421-448	KGAGTPRNNPRGGRGGKRPWDSEMRGKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPL9	mRNA-nucleus export-related protein, putative	0.607	458-461	RASR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ35	Expressed protein	0.864	408-420	PRPSPRTKGRRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K830	Rab GTPase activator, putative	0.766	414-428	KRKREREEMRQGRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K997	Uncharacterized protein	0.997	227-760	PGSRSHSKDKNESSKKKGETKKEQKESRSDKDNEKKEAGRKNGDEKDNDKDKKKSSSRISSKNDAAEGNDDKGSLKGKGEGEKKKDGSSSKSKKPNDDKKSSEKSDKVDGDKKSDPKKDDKAEGLEKKDVKKKSSSSDDKKEDKRGSGGEKKEERNKKEERNKEDENKASRGEKKEDKNSNSREKKDDKKAAGDKKEDKKATGEKKDEKKAAGASRNKDDKKSATGEKRDEKRAVGAEKKDDKKVAAADKDDKKAAGGNRKDDKEATGAEKKAAGAEKKDDKKAGDTKAERKVEKKEVEGERKKDDKKVGEKKHDEKVAEGDKKNDKSQSGRKKHDEKVGEKKHDEKVAGGDKKDDESQSGRKKPSSGDKEGGDKRLDHKKTDKKNNEEKDDKKAGEKKSGSKEGDKKPGDKKGDKKAENRNEEAGKKPANEKEAVNKPGEKKEMDKNPKDNKEMDEKLAGDKKNDGKSEKKGKGSVLEERGGEGKGDKKESKKSGNDKRKHEKKYEEDKEREGTKEEGKKDKSEQKDDPKKDG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9H5	C3H1-type domain-containing protein	0.909	863-872	KGKGKKKRGS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAC9	Uncharacterized protein	0.905	370-400	RTKVIPATAPARRRLSKAPSTSRKEPVKRRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAC9	Uncharacterized protein	0.673	413-420	NGKGRARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBL4	Uncharacterized protein	0.853	1668-1681	KPFIKKSKPEKKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBM9	Chaperone, putative	0.879	374-384	GFRKEKNKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX3	Transcription regulator, putative	0.979	137-159	RKKKAKKARVKMDSDRPVKQKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX3	Transcription regulator, putative	0.919	1475-1496	KSKAKPKRKTEDDPSKPNKKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX3	Transcription regulator, putative	0.8	1346-1357	KDRDSGKGKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX3	Transcription regulator, putative	0.661	1069-1075	KKPKAPG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBX3	Transcription regulator, putative	0.637	1386-1391	KKHLKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP3	40S ribosomal protein S26	0.874	4-16	KRRGGGRNKKGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCP3	40S ribosomal protein S26	0.777	89-109	AKPGAINSRKNRNPPPRAIFK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDP6	Rho GTPase activator, putative	0.83	304-317	KGKEKTKAKRSGSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDR6	Transcription initiation factor TFIID subunit 2	0.954	1354-1379	AKKASMARPPATEEKKEKQAKKRKEP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KED3	ATP-binding cassette transporter protein YOR1, putative	0.978	597-615	GGKPVGPPGKKEKKNKPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHB0	KEX1 protein, putative	0.689	640-646	KGKGKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHL8	FAD-binding FR-type domain-containing protein	0.901	96-107	KHRRRKREGLKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK11	Glutathione transferase, putative	0.788	484-497	KKLKKNKHQREEER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK87	Uncharacterized protein	0.995	160-218	PRPRSPPRSPPRRRSRSPPPFRRFDRESWRDRERDRERDRFYRRRSPSPYSPIRRRRSP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKP9	Vacuolar protein sorting-associated protein	0.764	1740-1759	RRSRRRSSVTRRTSISKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKP9	Vacuolar protein sorting-associated protein	0.655	411-416	KAKKDA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLM6	Nam9 protein, mitochondrial, putative	0.912	108-127	RERAGGRTRDEKKAKSKAKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLM6	Nam9 protein, mitochondrial, putative	0.627	300-305	MRNKTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN42	Uncharacterized protein	0.608	234-235	RR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K791	Expressed protein	0.987	85-113	FKKRRRSKGDPAREGERSNRRRGENKEKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7D5	RNA binding protein, putative	0.963	156-180	HTKRRLEEKKLKRKNNPLRQKAQAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7F1	RNA polymerase II transcription factor, putative	0.79	599-609	RPKKRLPSRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K839	Uncharacterized protein	0.967	304-316	GRIKKEKQKKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K839	Uncharacterized protein	0.916	436-446	RRKKKGRWKEA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K839	Uncharacterized protein	0.64	458-460	KKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8D8	Expressed protein	0.845	515-537	RRRRPSDGRSTKVNEGRAKKRVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI7	Uncharacterized protein	0.972	90-122	MGGAQRGGRGQNKDKEKEEKTKAIRERARKRVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBI7	Uncharacterized protein	0.7	260-268	KKKTKTKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBJ5	NAD+ kinase, putative	0.959	467-478	KGKKRKAIKKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD77	Expressed protein	0.994	146-171	HKGRKKTPKRKEAKNDRRAIRERQRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEM8	Uncharacterized protein	0.618	422-431	RRHSLRSTKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFQ0	Uncharacterized protein	0.977	396-414	RRQRSGRKNKKRDRQHRKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFV9	DNA-directed RNA polymerase subunit	0.721	982-988	TKSRRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGQ6	Lipase 2, putative	0.777	559-566	KEREKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGV1	Expressed protein	0.731	200-207	RKEKRGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGV1	Expressed protein	0.616	77-79	RKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHA2	Translation initiation factor, putative	0.958	80-87	KKKKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHA2	Translation initiation factor, putative	0.73	12-17	KKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHA2	Translation initiation factor, putative	0.657	111-115	KKKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL68	Uncharacterized protein	0.645	194-198	RKPAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLW0	Uncharacterized protein	0.773	822-830	KKKAPRKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM18	Uncharacterized protein	0.996	414-442	RKRKEKEYRERKEKERKERKEKEEKEKQH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN8	Uncharacterized protein	0.994	1158-1181	KKKGKRKAVDSVVSKRKKRKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNJ6	Uncharacterized protein	0.925	271-290	KRRTKALEKKDKKSKANMKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNU1	Poly(A) polymerase	0.612	526-528	KKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ46	Chaperone regulator, putative	0.796	118-128	RGGGRRKPAKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIF5	Uncharacterized protein	0.938	431-444	KERSRKRKREREEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIF5	Uncharacterized protein	0.896	593-608	EVRRNNRAGAPLKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR52	Pre-mRNA-splicing factor SLU7	0.887	515-529	GRLKNALKEEKKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR52	Pre-mRNA-splicing factor SLU7	0.627	488-490	KKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7D7	Uncharacterized protein	0.783	709-722	RRERRIMKRERLPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8G8	Expressed protein	0.967	332-344	KYGDKKKTKKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8G8	Expressed protein	0.867	210-218	KKKKRARLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8G8	Expressed protein	0.772	757-767	LKKRKEEAQKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8G8	Expressed protein	0.76	392-415	KKRNVSNKPKSNQAKSKGAPSSPE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9U8	ARID domain-containing protein	0.869	1303-1314	KEKKATKRKRQS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9U8	ARID domain-containing protein	0.644	1259-1264	PSKRQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9U8	ARID domain-containing protein	0.606	1335-1335	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAX7	HTH La-type RNA-binding domain-containing protein	0.964	410-461	SRKQNRMEAKKRASAREGGESGPTGSGAPGKGNKTRKGMQAAEGKKAKKEGA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAX7	HTH La-type RNA-binding domain-containing protein	0.949	100-145	SEEKEKEKRGSSSKNWRDRTHRDEKNQDDGEKRSGREKSKKEKGDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV5	Uncharacterized protein	0.943	826-863	SERDEADKKNSREARAKRRMGIQSGEEEKEKDKKKEKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV5	Uncharacterized protein	0.837	887-912	PHRPLKRARRTSEAKDQGEKEEEKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBV5	Uncharacterized protein	0.66	811-824	RGPRPPSPTSKIRT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC81	Uncharacterized protein	0.701	936-943	RKPPVKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC81	Uncharacterized protein	0.642	647-653	KTSRKPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI4	Pof4 protein, putative	0.806	400-412	RKKKEFKEIRKPQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI4	Pof4 protein, putative	0.762	232-240	KRRSRGRGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI4	Pof4 protein, putative	0.685	86-91	KKKGKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI4	Pof4 protein, putative	0.663	447-450	KKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCW5	Bud site selection-related protein, putative	0.962	15-30	KKRKRTGKEREERKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCW5	Bud site selection-related protein, putative	0.89	402-453	VRKNRRGQRARQAIWEKKYGKNAKHVVKAHEEEKLQAQKTREKAEAKGRTRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCW5	Bud site selection-related protein, putative	0.879	332-359	KRAKTAVPPLPPKSKPLKSEKADKPPKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDF6	Uncharacterized protein	0.849	687-696	EPNKGKKTRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDF6	Uncharacterized protein	0.757	580-597	KLKGLEKAEKEREKAERK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDX9	Zn(2)-C6 fungal-type domain-containing protein	0.756	420-436	RRTRSKAEREKDPKRYE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFC0	Expressed protein	0.963	173-186	RLLKKKRRKGYKKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHW7	Uncharacterized protein	0.768	97-104	KESKRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIN8	Ribosomal RNA-processing protein 8	0.99	330-344	GKGKRKNKKKGSRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIN8	Ribosomal RNA-processing protein 8	0.865	80-90	GKKRNKKNKSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIN8	Ribosomal RNA-processing protein 8	0.831	102-116	PRAKGDKPKPKPTPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIN8	Ribosomal RNA-processing protein 8	0.719	24-33	KGGKKTNKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ40	Peptidase_M24 domain-containing protein	0.959	374-385	RAPKKKKKAAKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL20	rRNA binding protein, putative	0.992	352-382	ERKRKAKEARRAEQAANVARKKAERAKKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL20	rRNA binding protein, putative	0.97	474-486	KPPPKKRASGKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL64	MRC1 domain-containing protein	0.929	1126-1139	LKKLSRKERKRREL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL64	MRC1 domain-containing protein	0.78	744-751	KRKSKKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL64	MRC1 domain-containing protein	0.75	493-513	RNLKEIKAKLAREAALRNKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL64	MRC1 domain-containing protein	0.723	1012-1017	RKKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL64	MRC1 domain-containing protein	0.669	1106-1109	RKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM06	Uncharacterized protein	0.785	5-11	KRRRKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMJ7	Uncharacterized protein	0.96	1063-1075	NKKGKKRKAPREE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMJ7	Uncharacterized protein	0.922	51-60	KAGKKRRKRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY5	JmjC domain-containing protein	0.957	378-396	GRKKRQRERASKGKLPLRH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY5	JmjC domain-containing protein	0.859	1176-1185	GKRKEKKRQG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY5	JmjC domain-containing protein	0.726	327-346	KRGRNTTRNRDSRGREKQGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY5	JmjC domain-containing protein	0.715	1701-1711	TPPKKLKNPAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNB2	BZIP domain-containing protein	0.862	34-49	NAKAQKRHREKQKARV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPI5	Uncharacterized protein	0.999	275-346	KRGRGRPKGSKNKPKPGPPPPKPPKPPKPPARPKGRPPKQRTPAEQAEYELRKHEKELGIKRQKGRPRKFPG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ13	Conserved expressed protein	0.834	368-382	KEKKKLAQREAKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI00	Uncharacterized protein	0.609	398-400	RGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM94	Pre-mRNA-splicing factor CWC21	0.982	155-205	KAARLAKREERERERIEAAITRERENEKRKQEWEEKERLRRREEYKRRRRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP80	Peptidyl-prolyl cis-trans isomerase D	0.828	358-367	KRKARREKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7I8	Osmoregulation-related protein, putative	0.966	51-82	GKKDVTRKEKRKATRDDRKGPAQTQKTRRRSP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7I8	Osmoregulation-related protein, putative	0.94	99-126	FKKSKTSKPKSVSSSEKSNSEKKEKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7I8	Osmoregulation-related protein, putative	0.845	10-27	SGRGRGGFRGGRGGRGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7S7	Uncharacterized protein	0.829	304-313	RLRQKKGKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8D0	Expressed protein	0.666	196-201	LRKRIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9A8	DNA mismatch repair protein	0.796	204-226	SPSPPRKITKAKATPSASSKKPT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9A8	DNA mismatch repair protein	0.67	162-167	GRRPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9A8	DNA mismatch repair protein	0.604	231-231	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9K4	Cytoplasm protein, putative	0.936	37-64	GKSKGDKAKEREREKAAEAKAAALAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9P0	Uncharacterized protein	0.602	42-43	RP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAZ8	Uncharacterized protein	0.736	45-65	SRRKPSSFKPTPKSQHPPSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI71	Phospholipid-transporting ATPase	0.982	75-106	EKREKRRRLFRSMKRKASDIGKGTLKRKGPAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI71	Phospholipid-transporting ATPase	0.857	1418-1430	IKSRKQKRRQNKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI71	Phospholipid-transporting ATPase	0.804	148-159	KTKGKAKNRKAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KII1	DNA supercoiling, putative	0.735	37-49	PKRESALPARKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJU1	Transcription initiation factor tfiid 111 kDa subunit, putative	0.771	162-167	KRKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJU1	Transcription initiation factor tfiid 111 kDa subunit, putative	0.603	111-111	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK81	PM-scl autoantigen, putative	0.951	939-950	KKKKKKFKEARP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK81	PM-scl autoantigen, putative	0.882	832-842	KKSKKQKKRER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK81	PM-scl autoantigen, putative	0.765	903-910	KNKKKKVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK81	PM-scl autoantigen, putative	0.692	87-101	GRDKGKTAKVMIRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLK5	Expressed protein	0.932	83-102	KKKKADEEHLSSSRRKRRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM84	Expressed protein	0.77	20-30	IRENAQKRRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNW2	WD-repeat protein, putative	0.796	172-191	GKAGRQRLRRWQRAVKGWKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP33	USP domain-containing protein	0.993	596-615	SKKEKKKFKHKEKGKPRHSA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ63	Expressed protein	0.998	433-462	KKQRRIYRRKEKGVNGEERPKKRGRPRKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ63	Expressed protein	0.997	331-349	LSKKRKRGRPRKKAERPGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5R4	Dimer_Tnp_hAT domain-containing protein	0.963	388-405	AERARKTKLKAKGEKRKM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	F5HGW3	Rho1 GTPase	0.64	184-191	KSKSGRGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ22	FACT complex subunit SPT16	0.98	1025-1035	DGKKKKKGSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ22	FACT complex subunit SPT16	0.66	1006-1016	KAKRADEKHRT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ22	FACT complex subunit SPT16	0.628	460-462	PKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ98	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.946	72-112	RRRDKDRYRDDDRDRRRRDDKDDRRREERDRGSDRKRDSER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ98	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.918	138-159	KKRKAKERLETWKRQRALKEGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ98	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.641	815-821	ERIERRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ98	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.606	801-803	KAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K781	Expressed protein	0.97	318-330	RKAKKERKKRVKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9E3	Large subunit ribosomal protein L3, putative	0.867	18-34	PKKRAARHRGRCKAFPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAE1	Expressed protein	0.749	424-435	RTKSQKSSKKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAN7	Protein-ER retention-related protein, putative	0.786	390-407	GRHEGWIERMKKMLRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAT1	Argonaute-like protein, putative	0.752	261-273	GRGGRGGRGGPRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAW3	Uncharacterized protein	0.994	397-439	KPKTKKQMKEEEKRMKEEEKAKKKDEERRMKEEEEERKKKKQM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAW3	Uncharacterized protein	0.632	376-379	KRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAW3	Uncharacterized protein	0.613	794-797	KARE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB68	Expressed protein	0.815	226-240	DRKERHERGRKLMKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCD0	Centromeric DNA binding protein, putative	0.996	333-369	RPVVAKRKKSPKKQEKGKDRARSARSGSTAAQRKRTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCD0	Centromeric DNA binding protein, putative	0.986	663-674	KKRRKSKGKSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCD0	Centromeric DNA binding protein, putative	0.855	433-453	RKSRKNGRARSGSVAVGKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI7	Uncharacterized protein	0.854	47-63	ADKDRKSRFKLSGKKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCI7	Uncharacterized protein	0.71	87-93	KKEKKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCZ6	PINc domain-containing protein	0.999	329-367	GKKQRERRRGRKRGGDGGKRRDREAAKKEPEPEREVKIL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCZ6	PINc domain-containing protein	0.958	528-585	HGHGRRGGHGGHGGHGGHGFGRGRGGHHGHGGGGGGGGGGGGGGGGGGGKGHGRRLKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD65	Uncharacterized protein	0.988	498-542	AGRARAAKAKAKALTREEEDRKGAGEKRKAAGGGQREGAGKKARV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD65	Uncharacterized protein	0.907	298-309	RRSPRKNKGKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB8	J domain-containing protein	0.992	275-290	EESRAKKKAKKGKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB8	J domain-containing protein	0.897	194-209	EKARAKRAKAGEKAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEB8	J domain-containing protein	0.745	324-331	QKKSKKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGC9	Uncharacterized protein	0.985	64-121	DRDRDRERRHRHRRRDETEEERKERHRRREEETEEEREERHRRRRERELREREREREG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGC9	Uncharacterized protein	0.971	193-227	RDGRMRSPPPRRRRLSPEYGGPRGPPPRRPPPPPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGM7	Non-specific serine/threonine protein kinase	0.784	360-366	SRKRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ90	Transcription factor, putative	0.676	40-49	RVRRRTGPFK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS8	Uncharacterized protein	0.93	315-326	QRQRERKAKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJS8	Uncharacterized protein	0.914	688-701	KNGFRRPKNKRAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL18	DNA replication regulator SLD2	0.978	386-432	KAKAPGGKMDGKGKSGKGASQPGIMGFFGKLKKAKEKEKEKEKEKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL18	DNA replication regulator SLD2	0.738	273-280	TKARKRLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL36	Uncharacterized protein	0.974	367-393	APSRSRTRRDSRRRSGERSRSRPRERI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLC2	Uncharacterized protein	0.616	302-311	RRHSLRSTKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLX3	Expressed protein	0.635	433-437	RQKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPQ7	Conserved expressed protein	0.646	197-201	KKERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPY8	Uncharacterized protein	0.977	91-119	KGKVEKKDKAPLGGPTKKRTKRPFKGQSL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPY8	Uncharacterized protein	0.639	126-132	HAARPRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ42	Histone domain-containing protein	0.984	18-64	GEGSRKTKNTARKSTGGKAPRHSGVQRNPPPDPKSPAGPKKKHRFRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIA9	Uncharacterized protein	0.971	158-170	RNPIKSKGKGKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIX5	Expressed protein	0.803	184-196	AKKEDNKKAKKIA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO70	Mitochondrial distribution and morphology protein 34	0.833	322-335	KAKRKRIFRIGKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7A5	GTPase activator, putative	0.949	789-822	EEKRKKSGGTQLATRKIRRKGAGLIKHLGGADKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7A5	GTPase activator, putative	0.826	425-457	HRLRAQKRARDRNPPLTLRKGQPQKSVVKEREK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7D8	Nucleolus protein, putative	0.999	107-129	KKRKEKKHKKDKSKGKGKGKKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7D8	Nucleolus protein, putative	0.998	36-63	RPTKRKRTKEEKERRRSEKRARKEKRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBF9	Expressed protein	0.858	230-241	KRRSSKKKLNKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC3	Expressed protein	0.813	599-613	KRRKKMVGTIKRLGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDC3	Expressed protein	0.65	158-163	RPKWRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFU1	Expressed protein	0.886	87-101	RGSSKNERDRKGKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGA0	Uncharacterized protein	0.828	45-54	EKKKSKGKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGA0	Uncharacterized protein	0.822	73-80	KEKKKKKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGK2	Small nuclear ribonucleoprotein, putative	1	536-584	EKKEKKSKKEKEEKKEKKEKKEKKEKKEKEGREEKEGKKEKKKKRKSEA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGK2	Small nuclear ribonucleoprotein, putative	0.999	499-523	PKKEKKNKKEKKDKKEKEEKKKRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI41	Nucleolar protein, putative	0.99	24-68	KKEKKARKRAKKDQPPSEAVSTEPKPNAESERPPRKPRARKSKGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI41	Nucleolar protein, putative	0.988	199-216	PKEKKPKREKRPKIKSVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI41	Nucleolar protein, putative	0.975	93-105	AKDKKKRRKRESR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI41	Nucleolar protein, putative	0.685	165-169	GKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIB6	rRNA processing-related protein, putative	0.981	366-395	SRGKGGKADKAGKVQSKGRPGKSRRQAGRV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIB6	rRNA processing-related protein, putative	0.888	321-351	KGGRAAPGKSKMPRHARDAKFSLGGGGRRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIB6	rRNA processing-related protein, putative	0.802	254-295	DAKKQRQLKKFGKQIQHEKLRQREQDKKSFEDRVQGLKRKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIB6	rRNA processing-related protein, putative	0.706	7-17	ETRKLKSNKKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJN1	Splicing factor YJU2	0.921	302-321	VKRKREGMQKLLGIKKKAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK06	Thioredoxin domain-containing protein	0.971	70-90	KAKKVVAAVSKPKKAPAKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKJ3	SWIB domain-containing protein	0.954	125-145	RTRKQRSSRSARPAKKTRPKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN7	Utp12 domain-containing protein	0.945	89-98	SKKKKRRKSG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5D0	Uncharacterized protein	0.895	246-264	NKRKSRKLTRSNAIRRYKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR10	ATP-dependent RNA helicase DBP9	0.992	599-627	RRGRGGHRGRGGRGSKSGRGKKVDPLKFK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR10	ATP-dependent RNA helicase DBP9	0.975	371-401	KEAKEEAKPAPGPSKRRATSPPSKPNKRARR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K780	Uncharacterized protein	0.921	67-81	RRVKKEIREIKRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K780	Uncharacterized protein	0.867	534-550	KLGTRGEGKRGVKGRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7T3	Uncharacterized protein	0.998	43-154	ARKRQSRSRSKGRAPDDDGQRRQKKDRERMREKERDRDSRKRKERDEVTVRDERQKEKDREARQSGEREHEGDRRERRRDREEDEGRRRREKKKRKDERDHSAETRYKEERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8I0	Essential conserved GTPase, putative	0.741	41-50	RRRRKADAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8V3	Uncharacterized protein	0.998	126-208	KKQASSKVALKKKATKVAKEPKEKKEKKANGETKKQTKTAGKMKEKAPKGASKNAQRGKEKTQKKTKEAEPRDAKPKSRVKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8V3	Uncharacterized protein	0.997	30-90	KTPKTVGKKRARSAEDKTAGPTKPKAKKVKASGKSAGETKNPKGSNSKKPTKEIVKKEKGA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9G9	Homeobox domain-containing protein	0.991	322-340	KKAPLPGKRRGREKKKRTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9W8	Expressed protein	0.876	424-448	KNHIEKYKGKFEKLKANARAKKEAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9W8	Expressed protein	0.824	242-259	KKSQEKRNSKSGKEEKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Z7	Uncharacterized protein	0.912	786-796	PKKKVKGKRKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9Z7	Uncharacterized protein	0.632	753-756	KKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAH9	DNA repair protein RAD5, putative	0.964	474-505	KKAAKKALRKKRGHTADAEAEEEKTKGKEKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAH9	DNA repair protein RAD5, putative	0.887	687-700	PKKIERKWKPPKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAH9	DNA repair protein RAD5, putative	0.78	797-805	SGKKGKGKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAH9	DNA repair protein RAD5, putative	0.763	1143-1153	PKRAARKKYIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAH9	DNA repair protein RAD5, putative	0.74	537-544	FRGKKGKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAH9	DNA repair protein RAD5, putative	0.609	529-531	KNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAS0	Uncharacterized protein	0.853	408-426	DKTERPKEKKPMLSRPRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB63	Protein phosphatase, putative	0.977	182-194	PKAGQKKKRKRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCF8	Uncharacterized protein	0.682	345-354	PPPVERPKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGB4	Nonhistone protein 6, putative	0.994	77-97	GKKERKKKEKKIRDPNAPKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGB4	Nonhistone protein 6, putative	0.984	227-240	GENKDKKKKKKSKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGB4	Nonhistone protein 6, putative	0.941	206-219	KNKKDKKRKTKEEE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHA6	Double-strand break repair protein	0.975	647-681	KSRGRAAAASTKKAPAKKAPARTPAKSTTKAPARR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHE9	2'-phosphotransferase	0.872	79-92	PRPKKKPTQGKTKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHE9	2'-phosphotransferase	0.687	324-332	RAVRRKEGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLJ9	Uncharacterized protein	0.856	91-104	KGKLKKRREEEGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLR9	THO complex subunit 2	0.992	1757-1891	RESRRSRRDGERERDREEKKNREREREDRKERDRERSYRGEDSDRKRKRDEESSSRKLEPDASSGSRKERERERRRYDERDRERERDFRDRERDRERDRNERDRDGHRDRRERERDGRRRDRDSRDVRENRERRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLR9	THO complex subunit 2	0.966	1697-1730	ERSKRREQGRDKYRRDKDHRDRDKEREREKEKDR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLR9	THO complex subunit 2	0.904	2025-2050	EAREESPGASKRVKIDRNKARGRRQE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLR9	THO complex subunit 2	0.606	2015-2016	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM61	Expressed protein	0.874	367-379	KAERKARKRAERA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMI7	Tubulin binding protein, putative	0.841	481-495	GRGSTRGRRGGRGKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMI7	Tubulin binding protein, putative	0.67	2074-2089	KREERSKSAMGHRDRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNF5	Uncharacterized protein	0.998	847-888	KAHKERQEAARKRKEEKEQERRERKEKKKKEAAAKQAAQERK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNF5	Uncharacterized protein	0.881	1391-1417	RKRSSKPLGKGLKIGKGGQSRLSFKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNF5	Uncharacterized protein	0.87	218-231	KGSKGKGKERARPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNF5	Uncharacterized protein	0.675	497-502	RKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW2	Splicing factor Prp8, putative	0.933	41-62	KKARKWRQSQKRRFNSKRRQGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW2	Splicing factor Prp8, putative	0.725	165-175	REKRDRRHFKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI68	Required for respiratory growth protein 9, mitochondrial	0.907	63-89	APKEKVDAPEALPNPPKSKKARHRPLL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI93	Uncharacterized protein	0.808	362-371	EKRRERRRTR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIG9	Uncharacterized protein	0.946	247-277	TTKKHRRSKADKAAAKSNLGAASKVSRAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIG9	Uncharacterized protein	0.639	182-186	PNKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIG9	Uncharacterized protein	0.625	174-179	KQKARV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIH9	RRM domain-containing protein	0.844	37-57	ARSPRRDRSRSPARAPERADR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM08	Protein AF-9 homolog	0.779	288-297	EARKKGKSAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM08	Protein AF-9 homolog	0.666	277-284	SRRPRDQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7R0	Expressed protein	0.777	88-99	ARTKRRRELAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8I4	Component of oligomeric Golgi complex 2	0.693	647-653	KHRKSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA53	Uncharacterized protein	0.952	180-212	RRRPRKARFGASAAEAAGKATGKKKDEKPHSKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA53	Uncharacterized protein	0.883	77-86	KNRKRHRKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA53	Uncharacterized protein	0.87	456-471	MISKIEKLKTKKAKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA53	Uncharacterized protein	0.614	451-453	KKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAI8	Uncharacterized protein	0.889	4-27	KRPLKRRSEDEGRKQTKRTGKNKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAN8	Nup54 domain-containing protein	0.673	523-527	RKRKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAQ6	Uncharacterized protein	0.998	1236-1264	RGGKRGAKTKANRAVGKKARREKAEKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAQ6	Uncharacterized protein	0.948	1180-1196	PRKRTKSSTKASRKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFZ1	Ribonuclease Z	0.919	968-989	KPASKSKRSLKKEAARAVKAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFZ1	Ribonuclease Z	0.838	1008-1029	KEEKKEKRGGSPGLEGPDRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGX8	Uncharacterized protein	0.923	87-112	GRLDKRPKRKTSKDTADRPPSRTSRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGX8	Uncharacterized protein	0.726	416-425	KKKKGGNNRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH70	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.94	450-463	AKRERKQKKKGNKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH70	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.931	542-567	RGGGGRGGGRGRGNQGRDRGRGRGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIC5	Ribosomal_L18e/L15P domain-containing protein	0.986	158-190	KGGKPYVASKGRKFEMARGRRKSRGFKIKSTHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIH6	H/ACA ribonucleoprotein complex subunit CBF5	0.998	446-503	KKRKREEEEVGSPKAEEKKKKKKVKTEDGAEREETAEERAARKAAKKEKKEKKKAKEE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIH6	H/ACA ribonucleoprotein complex subunit CBF5	0.805	369-382	LGPKAQEKKKMIKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIJ1	40S ribosomal protein S6	0.936	164-199	KKNGKTTTKAPKIQRLVTPLRLQRKRHLRSLKKRRT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIJ1	40S ribosomal protein S6	0.858	220-237	KKVHNAAVKAAKKARRSA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIJ1	40S ribosomal protein S6	0.628	135-138	PKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKC9	Expressed protein	0.853	767-777	RKRRRPAPRSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKJ2	Brix domain-containing protein	0.947	11-42	FKRSEVHRKTKREKEQAKLQRRLEIKKAEKDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKZ0	Pseudouridylate synthase 4, putative	0.636	56-59	GKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKZ3	Uncharacterized protein	0.933	400-417	PIKKSKAARKSPIKSKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKZ3	Uncharacterized protein	0.869	358-382	TTKKKAKKAETAVSPSKLSSKARAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKZ3	Uncharacterized protein	0.802	460-465	KKKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKZ3	Uncharacterized protein	0.772	298-310	GKEKEKILKKRLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKZ3	Uncharacterized protein	0.746	339-352	GNRKIRKESPVKEG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMC2	RAN protein binding protein, putative	0.734	485-495	GRGGRGPRGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMC2	RAN protein binding protein, putative	0.614	459-461	PKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMG4	Peptidyl-prolyl cis-trans isomerase, putative	0.726	64-69	GRKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI97	Chaperone regulator, putative	0.938	233-242	RRKRRRRERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5M4	Smg4_UPF3 domain-containing protein	0.988	261-279	KDKKSRGGRKRNKGKDKQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5M4	Smg4_UPF3 domain-containing protein	0.902	358-383	GEPRGNESGRGRQRGGRGRGGGGQPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M5X7	Uncharacterized protein	0.685	344-349	RRRRGV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M642	RF_PROK_I domain-containing protein	0.995	246-266	EIRAEKERRRKANRAKKAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M642	RF_PROK_I domain-containing protein	0.663	227-232	KKERRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M6D7	OTU domain-containing protein	0.871	120-132	GGGKKKKSSRQRF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM04	Actin-like protein ARP6	0.927	458-468	KKGGKGKRRKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ44	RNA exonuclease 4	0.919	334-351	SKRKNRKKSGNGGGRQQF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6T8	Expressed protein	0.995	265-306	DGRRRDHHHDREGKEADRHRDRERERYRERGERHKERRRDRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7R8	Uncharacterized protein	0.973	575-586	KKKEKKEKKKRV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7Z2	Chromatin remodeling-related protein, putative	0.739	817-828	KRKRGEKWTPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K828	DUF4604 domain-containing protein	0.986	186-197	GEKKKKKKAKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAR0	Expressed protein	0.798	181-188	KRKKPKLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP3	Uncharacterized protein	0.984	970-997	AAKEKTKGLKKKGSVKSKGSVKSKASRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP3	Uncharacterized protein	0.829	413-434	REHRPKKKGFFASIGRLFKSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP3	Uncharacterized protein	0.689	673-681	AKKKEQVKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP3	Uncharacterized protein	0.654	758-762	RERKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCA4	Eukaryotic translation initiation factor 2A	0.989	534-556	AGGDDKKKRQRKRGGKDKEEEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCK3	Uncharacterized protein	0.644	23-33	KRRQHQQAKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK8	Uncharacterized protein	0.896	644-657	KKMPKEKGRVKKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK8	Uncharacterized protein	0.858	237-247	KRKRKPREYPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK8	Uncharacterized protein	0.835	151-158	KGRKRGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK8	Uncharacterized protein	0.834	210-221	RTKKKAVKKSRI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDK8	Uncharacterized protein	0.706	127-133	KRKRGSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDL6	60S ribosomal protein L29	0.741	14-41	RKAHRNKIQRPKTNKYHSLKGVDPKFRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB7	Bromodomain and PHD finger-containing protein 3, putative	0.917	1023-1050	REKKRSKTTQAKEEKVAKTPPKGKGRVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB7	Bromodomain and PHD finger-containing protein 3, putative	0.915	659-688	PPPQPRKYRRPTKEEKQKKWNALVKERQEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB7	Bromodomain and PHD finger-containing protein 3, putative	0.696	885-897	APATSKSKSRSRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFB7	Bromodomain and PHD finger-containing protein 3, putative	0.656	874-880	RGKKNEA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGG5	Glucoamylase s1/s2, putative	0.798	55-64	IPKRPWKKKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGG5	Glucoamylase s1/s2, putative	0.748	267-278	KKHRFWKGKGKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK44	Glycerol-3-phosphate dehydrogenase	0.809	782-791	RREKRRKIPV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKP2	Uncharacterized protein	0.98	188-211	KGERKAEIKAAEKGKGKGKLPKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKP2	Uncharacterized protein	0.691	24-28	HKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLG6	ATP-dependent RNA helicase A, putative	0.79	602-629	KKRQRSQKEMGEKRAPTKEDEERVKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLG6	ATP-dependent RNA helicase A, putative	0.775	193-217	EKRKQKEEKDKEVGPSGESAKAKEA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPL2	Glyco_hydro_cc domain-containing protein	0.9	66-79	KMARKRAGKKFAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI43	Uncharacterized protein	0.785	213-230	EKVKGNIKGEKENKRRLE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI43	Uncharacterized protein	0.648	309-315	KRQRRLR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI65	BRCT domain-containing protein	0.974	52-87	SKSGRLKDKKQQSRKEENLKKRKAEFFSNRREKKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIS4	Uncharacterized protein	0.629	7-11	HRRNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M618	Uncharacterized protein	0.688	353-359	RRKKPGP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO26	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.966	1148-1165	KGKKRPTKAKGGKATKKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO26	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.705	997-1010	KSRPMPAVKKSGKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ82	ATP-dependent RNA helicase DBP4	0.992	767-785	EVAREKKKELKRKRKERER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ82	ATP-dependent RNA helicase DBP4	0.846	696-713	KRKLKAAASKKGLLKSRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ82	ATP-dependent RNA helicase DBP4	0.623	20-23	TKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR56	Pre-mRNA-processing protein 45	0.751	575-592	GGKRTAEDRDEERRKRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR56	Pre-mRNA-processing protein 45	0.676	227-233	KHKKIPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS46	Polyadenylation factor subunit 2	0.747	61-68	RKRKIKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7E2	Protein-histidine kinase, putative	0.996	208-253	KHGKKASSKQEKKAKVRPMKGDYRESSEEEPKKPSKRRARRPRSRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8A0	Uncharacterized protein	0.932	300-318	RKGARDVSAADSRKSKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9N9	DNA replication origin binding protein, putative	0.969	103-130	RSKRGTPKKRKPGSTTPTPRRTPVKTPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAU3	Eukaryotic translation initiation factor 2C 2, putative	0.673	282-291	GGRGGRGGPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD43	Arsenite-resistant protein ASR2, putative	0.843	98-115	RPKRRRSPSPLGPSHRPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEQ2	Uncharacterized protein	0.691	2029-2037	KRKRLEKIK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFI5	Uncharacterized protein	0.893	452-464	PGADKKEERRKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFY1	RING-type domain-containing protein	0.975	519-540	KEKAREKEGGKESRPRKRDRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFY1	RING-type domain-containing protein	0.754	270-280	KVARRAGKKEM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGR1	Uncharacterized protein	0.99	121-140	AKTAKNRAKRQKRKHGRKGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH21	G-patch domain-containing protein	0.993	772-790	NRAKDDKEKKKDKKSKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH21	G-patch domain-containing protein	0.828	811-818	KDKKKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHY7	Expressed protein	0.728	288-293	RRRRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHY7	Expressed protein	0.67	90-95	RPRKSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHY7	Expressed protein	0.644	127-132	KKMRPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIV4	Uncharacterized protein	0.98	632-650	ERTRREKREKKEREKRDKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIV4	Uncharacterized protein	0.63	366-371	KPKSVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLG4	Expressed protein	0.992	6-68	KKQKESGKAPKPKPRARSAPNASAKQGFKTAPSRAPKDAYLGKAKKIKTDLIQRAKVKKQYAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLG4	Expressed protein	0.912	83-115	GSRRRNEREESDNKLKGKTGSFKGKERREREER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLG4	Expressed protein	0.773	159-198	RKSRVEEAPPKPKVRALSPSPPPSAPSSEPKPSLRTLKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLH1	Expressed protein	0.711	172-186	RKQAKLRARMEKGDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM08	Bromo domain-containing protein	0.991	788-844	KMGDGKGDGKGKGKKRERGEGEDENGERKKSGKKQPGVGKGNWTRPSKEEKARLAGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM08	Bromo domain-containing protein	0.647	529-535	RAARERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPN9	Uncharacterized protein	0.973	160-197	GRPKRHGKENQTNSARRKSKEKERGQQKALQDKKAKKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ30	Adenine DNA glycosylase	0.889	30-58	RSSIKRKRAAPASTKSRTKTTIVKQARGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ10	Cysteine protease ATG4	0.869	40-69	PPPDRIPPPKGRSHQQKFKILRKEKDKDRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ10	Cysteine protease ATG4	0.864	121-150	EKKEKTSKSRGLVKKTSRLFGRDKDKDRGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ10	Cysteine protease ATG4	0.767	714-725	KKKRRGDNEAKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7L5	HMG box domain-containing protein	0.997	308-355	KFQPKRKAEKLKQRIEREREKQEARRLREEEKRAGKTKRRSRNREKRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7L5	HMG box domain-containing protein	0.788	235-247	PPVKKVKIRKGGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8A4	Uncharacterized protein	0.996	254-271	SHGKGRRSKREKKKKKET
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8A4	Uncharacterized protein	0.901	344-356	PKSDKKRRKSAAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8K3	Uncharacterized protein	0.989	146-159	EKKEKGKRKGKKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8K3	Uncharacterized protein	0.985	932-954	ESMRAEKAKKRKEIIKEKIKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8K3	Uncharacterized protein	0.922	896-919	KYRRTGERVKKRRERNLLQAHKAG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8K3	Uncharacterized protein	0.674	1077-1093	KSRGKVWKMFRWGWGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBF3	Uncharacterized protein	0.988	1151-1171	FREKEEKRRQRAAKRHKRQRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBY8	Small nuclear ribonucleoprotein, putative	0.821	373-399	RDSRYGGDRDRKKSYDRERSRSPVKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC15	Ubiquitin carboxyl-terminal hydrolase	0.736	385-394	RPHKKIKLEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC90	SD08430p, putative	0.89	58-69	PARRRGKGKEKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCH6	Uncharacterized protein	0.983	128-168	KRTKKENKRRARLEKLVKEGKVDKKVLEDFEKGVKEKKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCH6	Uncharacterized protein	0.691	269-276	AREAKNKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCH6	Uncharacterized protein	0.634	5-9	RAKRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN8	Uncharacterized protein	0.997	282-300	RRKKHRKQKRAKERLRRKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN8	Uncharacterized protein	0.989	328-368	ERKHKAKKKRDGQMGLARSKVKGWNARLGTVRRRKGKKEEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDX1	Chromatin modification-related protein	0.997	394-408	GSRKKGKKRKGKPKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDX1	Chromatin modification-related protein	0.789	495-506	ARRSRVSGGRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEV3	DNA polymerase	0.996	92-122	RKARKLKRAKAKAKALASSGKAPKSLKPKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFN5	Protein FYV4, mitochondrial	0.852	107-121	RPPKPPKKFRGWGPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG27	DNA-directed RNA polymerase III subunit RPC3	0.788	229-239	DKNTKRRKGGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGY0	Ribosomal protein L2, putative	0.845	355-370	HGGGRGKSKGNKHPRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGY0	Ribosomal protein L2, putative	0.767	71-82	RHRGGGHKRRIR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGY0	Ribosomal protein L2, putative	0.753	378-400	VRTRRPKDKDGNKAVVTERPRGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGY0	Ribosomal protein L2, putative	0.642	335-341	RWLGRRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHZ3	Uncharacterized protein	0.888	47-58	RRERKRLKKERR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHZ3	Uncharacterized protein	0.73	857-864	RKWRRPRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHZ3	Uncharacterized protein	0.604	27-27	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY0	Uncharacterized protein	0.991	382-425	PEKKDPNKFKDGEHKEKEVAKGKERKDESRRREEKKEREREEEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY0	Uncharacterized protein	0.944	512-544	RGRPKARVTSDEAARSNKHKRRDSESRRKPSRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY0	Uncharacterized protein	0.906	471-498	KKKTEDSPREKLAPLAEIVRKKEKRARK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIY0	Uncharacterized protein	0.783	328-350	KVPTKRGPQSKIAKERAKFVAER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKR2	Uncharacterized protein	0.748	848-855	KKERKRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLE9	Nop domain-containing protein	0.986	407-420	NRKKRGGKRARKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLX6	DNA polymerase	0.818	1846-1875	KRLGKYDKAGGKMTNRGNGKGKQGEAKGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMK7	Expressed protein	0.895	416-427	FPKLKRRGPVKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMY6	WD-repeat protein, putative	0.768	184-195	RRLKKIDRGKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPI7	Signal sequence receptor subunit alpha	0.985	240-250	GKGKKRKGKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPI7	Signal sequence receptor subunit alpha	0.961	165-180	KSKVKGKKKSGPGPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI83	BZIP domain-containing protein	0.861	233-252	RERKRVRNRISARTFRAKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M604	Uncharacterized protein	0.766	558-565	KRSRKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7S0	Expressed protein	0.66	66-73	RRTRKDPG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7S0	Expressed protein	0.602	81-81	R
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K871	CNNM transmembrane domain-containing protein	0.994	533-547	EGGKKKKRRRKNAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K871	CNNM transmembrane domain-containing protein	0.625	722-726	RVKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8Q4	ATPase, putative	0.945	1124-1145	GRERREKRRAQEAKKLKEDERL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8Q4	ATPase, putative	0.602	25-25	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB96	FixP_N domain-containing protein	0.999	146-184	KAKRDQERREEAREKAREKMGLKTKSKKRGKKGAKKATA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCH3	Uncharacterized protein	0.998	103-129	EEKRAKKAAQAKEKRKRTIEAKKKKKT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCH3	Uncharacterized protein	0.694	347-355	IRGGKLKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN4	Expressed protein	0.909	205-238	PRPKTPVSPARSSISPSPKKIISTRKVPAKRRRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEV9	Sde2_N_Ubi domain-containing protein	0.968	210-227	KKKKKAKSAGNEKGKEKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF41	Expressed protein	0.987	219-241	KNTGRATKGKGKGKGYRGKRKQR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFH0	Uncharacterized protein	0.93	266-287	KTLDERQKMLKAQKKAEKKKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFH0	Uncharacterized protein	0.929	165-182	KNKRAKPPTKKKPMTKEQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFH0	Uncharacterized protein	0.779	220-244	KKSAKRPPPESPAKPSTSSDSKKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFH0	Uncharacterized protein	0.627	252-255	PKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGW8	Cyclin binding protein, putative	0.652	244-250	RSRSRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIE4	Expressed protein	0.953	397-408	RKKRKRERERRE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJE0	Zn(2)-C6 fungal-type domain-containing protein	0.728	260-266	PSKPRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLE3	U3 small nucleolar ribonucleoprotein protein MPP10	0.994	698-764	KLRNKHRKHKKAERKKLGEMEELYGKKRKSAREEKEEALKGLVKSGKGVTVIGKGAKEMEKGKKRGT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLE3	U3 small nucleolar ribonucleoprotein protein MPP10	0.991	400-423	RGAKQTKGKSNGKEKKGKGKSKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLH6	Zn(2)-C6 fungal-type domain-containing protein	0.75	305-314	RKKAGGKRQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPZ7	Ribosomal protein, putative	0.98	94-125	RKRKNKHGFLSRLKGGKNGRKTLLRRLLKGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI13	Expressed protein	0.866	112-120	KHRRGRKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LI86	Chitin synthase, putative	0.999	251-272	VKKVERRRKKRERKKADKKMKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIW7	Uncharacterized protein	0.995	230-265	AKKEEKEKAKQEKLEARRKKEERRRQRAEEMEKEKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIW7	Uncharacterized protein	0.781	111-124	REKEKEEKSKVKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9R9	Uncharacterized protein	0.996	324-349	KKEKKRKTDKDDSPAKAKKKAKKSKD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBS0	Uncharacterized protein	0.764	348-357	HIKKRSEKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC47	Uncharacterized protein	0.856	785-802	RHKNPKSPKSPKNSKSRT
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCT5	DRIM domain-containing protein	0.998	2601-2657	AKRLERREGRVKLAVTNPEKYAERKGKKVERAKEGKKRKNIAFAEGRKTAGAKKRRQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDT3	Methionine aminopeptidase 2	0.999	48-62	AKKKKKKKKSKKKKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF87	Elongator complex protein 1	0.904	1058-1070	KSKRGKKRATGRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFA6	Cytoplasm protein, putative	0.634	229-232	PRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG51	MFS domain-containing protein	0.813	452-461	WRKRREKRLE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHI2	TAF15, putative	0.928	1018-1038	RAVGEAKGAWRKEKREREKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIK7	37S ribosomal protein S25, mitochondrial	0.669	84-92	RGYKQRKGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL75	Potassium ion transporter, putative	0.817	3-16	RPRFRVRKAFRKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLJ0	ATP-dependent DNA helicase CHL1	0.945	121-154	RLEKARKKEKQMRREGGVGAFRHGLGGGKRVKTG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN84	Sporulation-related protein, putative	0.656	980-995	AAKAEAKAIRQAEKAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPU0	Uncharacterized protein	0.845	561-572	GKFTRRRRWRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LJ80	Uncharacterized protein	0.641	245-252	KRPQKQKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CL90	Protein BFR2	0.991	376-395	RREKKKKREAERGGSKGRKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO24	Non-histone chromosomal protein 6	0.922	15-30	SDAKKRTKKDPNKPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ92	ATP-dependent RNA helicase DRS1	0.999	722-808	AARKTEMGIRAAKKNALPKKITEPQPRLEKAGKGKDKKKGKARRVTGGKGSAFDSEGKKSHEGMRAKPAKVNLEKGKKKGGKGKGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ92	ATP-dependent RNA helicase DRS1	0.958	89-105	RKRGKPIRAFKDRKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ92	ATP-dependent RNA helicase DRS1	0.958	686-712	SAEKEKEKLKRGKYDGLSRRLKRRKMA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7M5	Protein kinase domain-containing protein	0.833	904-934	KKAKKEAERQAKELAKAQREAAALKQKERAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA01	Ubiquitin-specific protease, putative	0.964	399-423	TGRGKGGKKKTKETGRGVWKTGEKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB99	DNA topoisomerase I	0.994	223-280	RPLAKKKAPVKRAPAKKSAKKEPSESEEDEKPLAKNARGKAKAATVKEEKGKKTKKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB99	DNA topoisomerase I	0.97	805-842	GKKKKTKGELDERLSEIKAEFKELKKERKAKKIDAKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB99	DNA topoisomerase I	0.888	402-421	EKEKKKALTKEEKKAIKAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB99	DNA topoisomerase I	0.746	450-464	LFKGRGEHPKKGTVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB99	DNA topoisomerase I	0.657	204-212	AKRVSAKKM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB99	DNA topoisomerase I	0.651	120-124	KKPRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC21	Expressed protein	0.956	555-569	RRKGEERRERRRRRL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC21	Expressed protein	0.915	179-207	VAGRVRRARKAKDGMGNIKVKEEHKEARR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC21	Expressed protein	0.704	606-615	KGRNGRTKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD53	Uncharacterized protein	0.858	190-202	KEQKKKKRETIKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD53	Uncharacterized protein	0.701	1067-1082	KRGHRPSLLPPPRPRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD53	Uncharacterized protein	0.7	669-678	KRASTGGKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KD53	Uncharacterized protein	0.679	938-950	KKRSRHQSRGAEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KF95	GTPase inhibitor, putative	0.776	91-106	KRKRLHEMKKEEKKGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG84	Hst4 protein, putative	0.855	294-308	EMAKSAKSKGRGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KG84	Hst4 protein, putative	0.781	155-164	KRKSPKAKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGL1	Uncharacterized protein	0.676	368-372	KGKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGW1	Uncharacterized protein	0.984	8-66	RSRSRSPDRENDRDRERHGHRHRNRSSSPRRDRHREDRNRSHGTDRDRDRDRPKSKRDK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH43	Uncharacterized protein	0.938	166-179	NAVKRPRKTRKSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH43	Uncharacterized protein	0.858	80-92	PRPQRRRRGGNKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH43	Uncharacterized protein	0.728	211-220	RKSKSKKLTK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH43	Uncharacterized protein	0.702	295-302	KKGKSKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIV6	Uncharacterized protein	0.98	298-332	RGGKAKKATSFRKKSWPRRGWNNTSSRSRSKAKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIV6	Uncharacterized protein	0.612	138-139	KR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ25	Pre-mRNA splicing factor, putative	0.75	83-92	KRKAAKMKAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.999	292-318	DKKKKKKKKAAAKPAEPVPSAKGKKIP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.993	123-136	KPKKGKKGKKDKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.993	236-260	SKAQKEKLKKEKEKAKKKAQAAAKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.99	173-185	KPKKGKKGKKGKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.981	78-89	AKKDKKKKKKAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.981	366-400	AKAAKKAKEKEKLAKAKAEGKLLTPAQKRERAAAE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.747	424-434	KKKKPVYGNKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMN3	Eukaryotic translation initiation factor 5B	0.635	7-11	VKKGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMP4	Uncharacterized protein	0.637	264-272	KKTEKLEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE4	J domain-containing protein	0.931	454-470	GKKKKEEKEKKGWFSRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPE4	J domain-containing protein	0.803	215-226	KKPESSKKGKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPW6	Tyrosine--tRNA ligase	0.968	392-427	PKKAKKKDVRSKPPTEEERAALRAAKEKEKAAKAAA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ52	Expressed protein	0.945	54-73	KSHPKRKPTKAKGKTTNLKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LHZ8	Uncharacterized protein	1	123-159	RRRRKRKERERKREKEEKEERRRRKEKKRAKRDKKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LHZ8	Uncharacterized protein	0.996	35-105	RDDRDRDRERRRVRSSSMDRDKDRDRERDRDSRRRHRDSESRSPSRHRRAKNRDEDRHHKPRSSRRRSRSG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIA2	Uncharacterized protein	0.677	108-115	KKQKLKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	F5HH24	Glycosyl hydrolase, putative	0.938	338-359	TCKRKKRSNIAGQKRHIRRSRI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM30	Autophagy-related protein 2	0.879	1496-1511	HKKTRLKGKRLVRSKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CM30	Autophagy-related protein 2	0.772	660-675	SEKAWRVRPRGRGILK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CP24	Nucleolar protein 16	0.951	6-38	QRNKAKSSRTQKPSLNAKRRMHQKLRKAPPLKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K787	Uncharacterized protein	0.999	179-253	DKAEKKDKKSRRKEKEETKEKRDARKAEKKAKAAKEIKKSEKKVKGKQKEEKGEEVKTKKEKKEQEKKEEDKERN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K787	Uncharacterized protein	0.963	260-289	GTERKHKRKSVVQIIDGAEREKKKRKGRES
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8M4	Uncharacterized protein	0.615	200-204	RSSKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8U6	White collar 1 protein (WC1), putative	0.951	1100-1113	ALKEKKAGKAKKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA46	Ribosomal protein S18, putative	0.943	117-155	LKKIRTHRGLRHHWGLKVRGQHTKTTGRRVGRAVAGKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP8	Ribosome biogenesis protein, putative	0.996	1084-1100	KRKKRGEERKERRKKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP8	Ribosome biogenesis protein, putative	0.992	541-560	GKVEKWRGRRKGAKPKGGRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBP8	Ribosome biogenesis protein, putative	0.946	887-901	KLKRKEKRGKDKEKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE43	Uncharacterized protein	0.657	318-323	KKSKKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE85	Hydrophilic protein, putative	0.923	250-273	KRREEFKKRKREEKFEQGLRDLRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEK4	Expressed protein	0.932	116-134	KLRGAESSAKKKKFIRKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEN7	Uncharacterized protein	0.978	306-358	KREKKEKAAAAPVEKPKKKSSTIGSTAGGAAKRAKQVAVGAKKPAVKKSKSKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFC7	Expressed protein	0.989	294-346	SEKRPRGRPKGSLNKKGKKIEVHNEGREMPKPLDGEPVKRGRGRPKGSTNKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGV4	Mitochondrion protein, putative	0.929	347-358	KLKKKKEGKKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHE6	Uncharacterized protein	0.953	210-228	KSKKEGKQKSGGKKEKKMH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIT9	RRM domain-containing protein	0.785	1255-1266	RSKARGRGSRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJ16	Phosphatidate cytidylyltransferase	0.703	157-171	KKEENKEQKKETPKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJH6	Suppressor protein SPT23, putative	0.888	1175-1199	SMPSRPRSKSRQSKDKRPMSIKSGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJH6	Suppressor protein SPT23, putative	0.853	1373-1394	RKKGREDEEGVKNGSKSRRRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJH6	Suppressor protein SPT23, putative	0.84	285-299	RETRRREAKDRNRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJV3	Protein kinase, putative	0.954	912-929	AGRRGKKQKQKEKEKGNN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJV3	Protein kinase, putative	0.621	565-567	KRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKW9	Uncharacterized protein	0.947	337-360	KIARNRIKAKNAAKRSRDQRRAKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMD8	Signal recognition particle subunit SRP72	0.967	302-313	GGGGKNKKGKRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMD8	Signal recognition particle subunit SRP72	0.817	9-24	STPKRKPFTPKPPRPA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMD8	Signal recognition particle subunit SRP72	0.781	235-247	KNERSRPRHKLPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNJ9	Uncharacterized protein	0.839	845-882	RAKDIKKVKWIAAGYEKSLKTRKGWRMKGVGQQREKSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M615	WD_REPEATS_REGION domain-containing protein	0.995	35-89	KPSKAENKPKATNGKAKKDKETSKPSKAKQPKEKKEETAKVSSPKPTKSDKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K893	Glyco_hydro_cc domain-containing protein	0.792	61-72	KPNKRKITRRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8P1	Uncharacterized protein	0.972	969-1008	RGRRARTGKRAIVGRGRGIGFRALEARRERRRLVAERRKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8P1	Uncharacterized protein	0.956	790-805	GKKRKPRHARKAYERI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9H8	Uncharacterized protein	0.958	751-788	HKHPLPPQSKAAKKAIARQLYKNAPKQPKQPKKLKAKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAR1	RNA polymerase III transcription factor, putative	0.999	773-805	KGRWSANKGKTKGESKGGDGKKKGGKKSKGKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAR1	RNA polymerase III transcription factor, putative	0.714	98-111	RSGKAPQKQPRRAH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC07	Transporter, putative	0.898	944-968	NKKKEEELKKLGEEAKKRKEEATMK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCT8	Uncharacterized protein	0.88	189-199	RRRERLRKRRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE78	Uncharacterized protein	0.976	160-182	HEKPSVRRRRLRSERHRRRFKEM
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEY6	DNA-directed RNA polymerase iii 34 kDa polypeptide, putative	1	294-362	DKEREKAKMKAKEKAKMKKRREREKERERKEKERERKRKEKEKERERRKKEKEKERKRKEKERGKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH18	DH domain-containing protein	0.842	1313-1329	RHVKKSKKLRPVSVGPG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH18	DH domain-containing protein	0.769	710-719	GKSPGKKKQK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KH18	DH domain-containing protein	0.749	66-73	ALGKKKRD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHR8	Negative regulation of transcription from Pol III promoter-related protein, putative	0.862	366-382	RRHSGRKARHPPPLRHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KHU2	Expressed protein	0.892	454-470	KQGWVRRGRKNEKGKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJL7	Expressed protein	0.988	1007-1041	KKKGKGKGKDVSNTASKRKKLDDEKSRKDKKRKTA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE0	Protein SQS1	0.957	484-504	KHQKKRANKNAKRLARRAAAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE0	Protein SQS1	0.862	1275-1287	GFKKNKKRGLEKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE0	Protein SQS1	0.761	1140-1147	KKGKKNKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE0	Protein SQS1	0.64	23-32	GRGSSSRGRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKE0	Protein SQS1	0.626	861-864	LKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KN90	WD_REPEATS_REGION domain-containing protein	0.673	167-173	RRVRKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNN6	Expressed protein	0.993	71-84	KRKKKNKRKKNRNS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.999	458-513	RRKDKKKTKEKKEEKQKKDRKEKEKQEREKSETREKNEAKEKGKEKEHGKGRKRKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.958	207-226	GTKEQTPAKAKPRKSKGKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.954	416-434	AGKKDKKDKKGKVPAPPHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.953	58-68	RKKEKKPKGKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.945	635-650	KGSSKKEKKIGKRGPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.805	97-107	KERQSKRGKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.782	176-184	DKKSARRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY3	Uncharacterized protein	0.758	249-259	AKAKTRKSKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY6	Expressed protein	0.996	187-228	RPAKNGHRKWEVKEGMGEWRAAKKGEKPPRSGKHKGRKSKHF
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNY6	Expressed protein	0.894	95-120	PRTHRDKGKGRLAKDESRLKFKHKHH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPD8	Chromo domain-containing protein	0.829	47-61	QRRASNVSRKRRREK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPL6	Expressed protein	0.71	81-89	KKKKQGERP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPL6	Expressed protein	0.662	28-33	HARRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO86	Chromatin modification-related protein EAF3	0.975	86-120	AKKGRSTGGSGGTGSPGAGKGGLKDKKKDTKKRGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ94	ATP-dependent RNA helicase DBP7	0.938	615-626	KAKKSKRKAKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ94	ATP-dependent RNA helicase DBP7	0.909	848-869	GKSKRPKSKAASSATHPGKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ94	ATP-dependent RNA helicase DBP7	0.634	31-36	RVRAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CQ94	ATP-dependent RNA helicase DBP7	0.612	24-27	KGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS40	WD repeat-containing protein JIP5	0.746	347-352	SKKKKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K7I2	Uncharacterized protein	0.829	178-195	EAKRRQDESKAGRGKRVR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8L5	Ubiquitin-like modifier HUB1	0.966	11-29	HDRPRSRSRSPPPRKKPKE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K8L5	Ubiquitin-like modifier HUB1	0.758	142-176	RKDRDRRDRDRDRDRDRDRDRDSERRTERDRDGSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9P9	Expressed protein	0.841	721-755	RGKRSMSKEELERMRKRLAEGGGPGLGRGLGRMKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9P9	Expressed protein	0.81	574-580	RRKRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KA33	cobW domain-containing protein	0.907	155-170	KGKKPKHEHKRVGGKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAL0	Mediator complex subunit 12	0.987	1560-1609	KKQKTAKNNNAAAKAPARKTTGGKGVSKKATGKSAKEGATGKAKGGRRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDL2	Uncharacterized protein	0.999	729-770	KKGRFAYLAKKEKEKGKRRNKEGERAKKDGEKEKEKEREKKN
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDL2	Uncharacterized protein	0.806	621-629	RPGRRRKSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDV4	Uncharacterized protein	0.993	79-102	RPMTKAEKQNAKKKRRKERERAAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDV4	Uncharacterized protein	0.969	255-275	KSLAMKRTRRGRRRKTTAAPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KEX5	Mitochondrial import inner membrane translocase subunit TIM44	0.987	207-228	KEARRKKREMRAKKAGRAAIKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGH2	5'-3' exoribonuclease 1	0.725	1440-1455	PNGGPRGRGGFRGGSR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGH2	5'-3' exoribonuclease 1	0.677	101-112	SRRFRAGKDARD
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI58	Uncharacterized protein	0.988	1640-1671	KRVKRRVKAKNIEGKGKTKKTAAKGVRQKSGS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI58	Uncharacterized protein	0.988	1816-1840	GKKQAGRKPRKRKASGQHQNPPKRA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKY1	Triacylglycerol lipase, putative	0.673	56-61	SRRKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KL66	Vacuolar ATP synthase subunit d, putative	0.604	211-211	K
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLB5	Expressed protein	0.884	205-213	RRRFKKRRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KM11	Expressed protein	0.875	380-388	IKKKKKGAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMM1	Uncharacterized protein	0.986	1254-1289	KGKGKRRKNIGGRRSLGTPTTTRGRGGGRGRGGRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMM1	Uncharacterized protein	0.971	1188-1230	AKRGGKATRGRASTGSSVADGRRSSTPMRGRKRASTGKRKAKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMW8	DUF1713 domain-containing protein	1	304-332	KRKRRKKISKHKHKKRRKATRALRKRLGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KMW8	DUF1713 domain-containing protein	0.89	25-45	PRPHTRGRIRPRLALPKAKKQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNI9	Uncharacterized protein	0.809	698-716	KRTLRKGKSPPNKNIRSPS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPT3	Conserved expressed protein	0.904	136-165	SRRKEKPPPPVQAQPGNVPAKTTKKRKPKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KQ95	Methionine--tRNA ligase	0.683	565-571	SKKWKGK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIZ0	Uncharacterized protein	0.987	161-197	RRLERKLRRRERAAIGKPKLPTPLRSTIKSKRKIKAS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2LIZ0	Uncharacterized protein	0.919	213-222	GKGKKKGKKY
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	A0A0S2M648	Uncharacterized protein	0.874	52-61	RKRRKNKKLP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO02	Histone H2B	0.978	17-47	KAPAAASKAPAKAAKTSAAPKDGAKKRSKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS78	AdoMet-dependent rRNA methyltransferase SPB1	0.996	839-908	KARQVRRMLARAAKGKEKAKEKKIVVAKGVNKGVKGRPTGVKGKYKIVDARMRKEVRALKRIKKAGSKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS78	AdoMet-dependent rRNA methyltransferase SPB1	0.994	793-825	RALDARPIKKVAEAKGRKKMKAVARMEKAKKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CS78	AdoMet-dependent rRNA methyltransferase SPB1	0.947	396-412	LAKTKRERKRANEKKAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K935	Expressed protein	0.99	396-415	RKAENKERKRERKERKERKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K963	C2H2 zinc finger protein Zas1A, putative	0.841	140-153	REGPRKPGRHRTRK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9G8	Expressed protein	0.859	160-170	SKKKKGKQPMR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K9G8	Expressed protein	0.832	513-539	KGKWGRGRGKSVVRLMPEEIRERRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KAG6	Uncharacterized protein	0.756	505-513	EKRGKSRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB61	Uncharacterized protein	0.992	282-296	FKKPKKKKAKRSIRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB61	Uncharacterized protein	0.915	336-349	RARRANAKKKPKVK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB61	Uncharacterized protein	0.867	101-112	KKQKKREKQRAR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB61	Uncharacterized protein	0.77	54-73	MKREKEERELKERIEKARNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KB61	Uncharacterized protein	0.752	612-626	KTSGRMKTEKRLKKI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBA9	RRM domain-containing protein	0.999	164-241	AEKKKGAKNIKGNDDDGKKRKHEGETKEERRARKEAKRAKKAVKEEKKRIKKDVREGNGSERPKSVKSERDERNGRSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBA9	RRM domain-containing protein	0.655	317-325	KPRNRGYRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBS5	DNA polymerase lambda	0.988	343-365	GPVGGKKGGKEKGKKKQPMAKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE61	Transcription factor BYE1	0.956	264-276	QPKPKPKPKPKPR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE61	Transcription factor BYE1	0.953	138-165	KPRPSDGKGKSKHEDQKKKSILAKRKSK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE61	Transcription factor BYE1	0.942	230-245	PSRKRPRPRPRVPSKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE61	Transcription factor BYE1	0.892	38-50	KIPRPRPKSKPKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFT5	Expressed protein	0.799	223-233	RLRNARLKRKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KFT5	Expressed protein	0.663	25-29	PKRKS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGI1	Nucleus protein, putative	0.997	513-541	PRKEKTKAQLERAKRKKAQQKVKGKKRKV
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KGI1	Nucleus protein, putative	0.843	459-474	RPKATKKAKDQRPPKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI88	Transcription factor binding protein, putative	0.962	671-681	KDKPKKGKRKK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI88	Transcription factor binding protein, putative	0.863	646-656	KDRARPGKRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI88	Transcription factor binding protein, putative	0.673	563-571	KKDGKRGGR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIQ8	ANK_REP_REGION domain-containing protein	0.829	1212-1226	KKKWNGLKKLGRHHK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KJT4	Uncharacterized protein	0.953	616-674	RKAKKGLNRLIRDAHPDSQPKSQIRKEKMKGQAVNPKKDGRLCFKSRKTTWGKSGRRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KNE0	PRCDNA87, putative	0.738	78-91	SPPRRIRVRLERKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CO12	mRNA 3'-end-processing protein RNA14	0.867	912-942	RPSSAEFSRSPKRHRAQSPPRRYPERDDRPP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	P0CR14	Pre-mRNA-splicing factor CWC2	0.634	11-15	RKLKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5K6X8	Expressed protein	0.988	243-292	SGEQRKDRKWKEYRRQKGIPGWVKKEDVPEFEQGKGKGKNKKNRKEDKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KBK0	Cell wall chitin catabolism-related protein, putative	0.987	709-722	KSQKKKNKKKKKAQ
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC05	Uncharacterized protein	0.971	653-665	VKKKKNKKRSKEP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KC05	Uncharacterized protein	0.965	570-582	GKSGKGRKKGRRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KCN5	Uncharacterized protein	0.862	36-64	QPRPSRNSSSSRSRERRLDPPRKADKDKG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDE1	UDP-glucose,sterol transferase	0.877	818-831	SKKWWKGKGKGKER
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KDE9	Uncharacterized protein	0.629	132-135	HKPK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE07	Uncharacterized protein	0.997	713-738	RKPRRSARKGGVRKRGSRTATKRRRS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KE76	Uncharacterized protein	0.72	39-49	RKSLRKQHKKL
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.984	204-227	AGARIPGPGEKPRSKGGKRRKEQS
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.954	1029-1057	KDREKLGKKPVPVGIGAGLKGSKKRAKRI
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.943	1069-1084	RVKKKLKEKEKEKKSE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.907	938-1008	KKKVVPSSPPLPPSKSKPNQPKLQSQVPGPKSKDRVKPLVKDREKNKVQSKSGKPFSSPNNGHQVKAKAKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.888	113-120	PKRKRKKH
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.882	1592-1615	RGFRGFAPRGVWRGRGFRGRGRGG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.826	238-253	MGPPAKPRRGRQQSNK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KET9	Histone deacetylation-related protein, putative	0.801	718-725	GKEKKKKP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KI59	Pol II transcription elongation factor, putative	0.899	58-68	RPKKRPRTKRP
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIJ8	Nbl1_Borealin_N domain-containing protein	0.951	115-159	EREEKGREEAVKGKRKRNIATTSRANSPARSTKNPRREAPTGPNR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KIJ8	Nbl1_Borealin_N domain-containing protein	0.808	285-294	SKSRSRKKRG
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KK70	Dephospho-CoA kinase, putative	0.939	236-248	RKGKKDRRRGRGE
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KKI5	37S ribosomal protein S24, mitochondrial	0.688	220-224	HRKKR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLC3	Gag-pol polyprotein, putative	0.662	239-243	RRKEK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLV4	Transcription elongation factor 1 homolog	0.934	3-16	KRKAAKKPVAKKKA
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KLV4	Transcription elongation factor 1 homolog	0.63	142-145	GKRR
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KP63	Elongation factor 1-gamma (Ef-1-gamma), putative	0.98	222-244	KDQKKKEEPKPKAEKAPKAPKAK
UP000002149	Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565)	Q5KPL0	Exocyst complex component SEC15	0.636	233-238	KWRMKR