ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT44	Transcription activator of gluconeogenesis TSTA_069700	0.909	40-50	PSRPRRKKARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUQ1	Uncharacterized protein	0.634	186-189	RKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2E7	PBSP domain protein	0.696	32-40	KEKIPKPKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2X4	Gelsolin repeat protein, putative	0.727	927-934	RARGPKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2X4	Gelsolin repeat protein, putative	0.634	42-48	KERQARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5J4	DUF1168 domain protein	0.996	113-146	FEKKRAETIRKDQEKTERNRRKREKRKAAAAKTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6M3	Ubiquitin conjugating enzyme, putative	0.974	886-907	TAAKGKSKKEERRSQSRKRKLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7L3	C6 transcription factor GliZ-like, putative	0.713	50-59	AGKPKGSKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7M6	Non-specific serine/threonine protein kinase	0.99	49-77	SPRSPARSPRRRSRSRTRSPYRRGEKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7M6	Non-specific serine/threonine protein kinase	0.828	235-246	ARRKRREAIKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7M6	Non-specific serine/threonine protein kinase	0.818	135-155	RDKRQKTRSRSPFKDVRKPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCS6	Zn(2)-C6 fungal-type domain-containing protein	0.723	19-25	KRRKIRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDN7	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.89	556-595	NRSKSRSRSRSKSIEPPRGPAAQSRGGFSGRPVPHNRGPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDN7	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.753	382-388	KKPRKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDN7	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.682	771-778	HKAHEKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MES0	C2H2 finger domain protein, putative	0.972	440-449	RKRRRRRRRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MES0	C2H2 finger domain protein, putative	0.951	503-519	NGRRGRPPGAKNKKPPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MES0	C2H2 finger domain protein, putative	0.693	247-257	KKEKKSLQRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFE6	Uncharacterized protein	0.958	7-43	KKAKSTTAKKSSSKVGPRVIAPKKAALAKQRKTMKKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFE6	Uncharacterized protein	0.94	68-83	VKKEKMKEKRAEYKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFJ4	Methyltransf_11 domain-containing protein	0.885	891-916	PEKEGKRRSRLAPVGRIPRVVSRRDR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJS3	Integrase catalytic domain-containing protein	0.959	1200-1232	RLRKRGIHVPDAPVMPPAPRRRGRPPGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK76	Zn(2)-C6 fungal-type domain-containing protein	0.884	416-428	LVRRERKRIRAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML60	Bromo domain-containing protein	0.874	586-597	APPQKKRGRGRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML60	Bromo domain-containing protein	0.63	696-698	KRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRQ5	Zn(2)-C6 fungal-type domain-containing protein	0.96	156-182	KAKAVQKPPRKTRSDKGMKREPRRTGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV22	Uncharacterized protein	0.623	438-440	KKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV22	Uncharacterized protein	0.609	427-429	RQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV22	Uncharacterized protein	0.601	431-431	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUP4	Aureobasidin resistance protein Aur1	0.762	39-49	RMRRKLRSKLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ5	HTH_Tnp_Tc3_2 domain-containing protein	0.897	248-272	LEPRKGRRPTFKFTAKNGKLERKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3F6	Uncharacterized protein	0.661	405-409	PKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6V4	Uncharacterized protein	0.95	637-649	KKKRGKGASRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDF6	Telo_bind domain-containing protein	0.956	1156-1168	SRPRPRRRKSHRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGS0	EF hand domain protein	0.845	1481-1496	LPPHKRTAPRRPPSKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU17	Uncharacterized protein	0.965	670-683	QRKNGGKKNKKRKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU17	Uncharacterized protein	0.935	419-437	SRKTRNSNRRKKLRSRLQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU17	Uncharacterized protein	0.779	163-172	IRIPPRKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU95	Transposon, putative	0.877	447-457	KEKRKRQRSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUN9	SNF7 family protein	0.608	66-67	RK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVN1	G-patch domain protein, putative	0.97	301-315	DKKRKKKIKGPEEGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3F4	HTH CENPB-type domain-containing protein	0.827	614-629	KRIDARKAEEIKKKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3F4	HTH CENPB-type domain-containing protein	0.802	589-598	RRKAKAKSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4L5	Chitin synthase activator (Chs3), putative	0.986	52-116	SGQPRSRPPPPRGAYGGPGGPPPPGSSSSRSRGGYGRAPPPGPGRGPPPPRGAPMARPPPQRRPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5L0	BZIP transcription factor (AtfA), putative	0.786	312-324	SRGKGKKSTPAKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5L0	BZIP transcription factor (AtfA), putative	0.705	329-343	NGRRKAEETPRGSNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5U3	Uncharacterized protein	0.88	133-144	IQKEMKRKKIRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M652	LysR family regulatory protein, putative	0.764	61-77	KKGWQKFGARLRRNKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB46	Ribosome biogenesis protein SLX9	0.938	71-88	KVAKSQLKSPKRRRPSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB46	Ribosome biogenesis protein SLX9	0.863	121-138	KTLKHRPGAMKRKEKMEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG6	Tryptophanyl-tRNA synthetase	0.979	419-442	EWKGNPNPKPKPKETAKKEKEEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGP5	Transcriptional regulator Ngg1, putative	0.981	141-160	RASKGNKLKKRKERPPKEDR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGP5	Transcriptional regulator Ngg1, putative	0.777	579-593	LGKSKKGSQAKHRPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKK2	Uncharacterized protein	0.635	115-118	KKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVT1	G-patch domain protein (TFIP11), putative	0.726	177-184	RRQKRKAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVT1	G-patch domain protein (TFIP11), putative	0.678	475-483	KKWKPRSSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ3	Uncharacterized protein	0.948	481-497	AKKSSPRRKKRDNHRII
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ3	Uncharacterized protein	0.686	1077-1091	PESRLGRRSDDRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ3	Uncharacterized protein	0.607	1069-1069	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ3	Uncharacterized protein	0.603	1071-1071	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2J8	RING finger domain protein, putative	0.865	340-357	SKSSKEKHKEGKSGKIKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3A6	C6 transcription factor (UaY), putative	0.625	169-172	SKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D3	PE repeat family protein	0.995	285-301	NPKKNKKKDKKNKKKNA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D3	PE repeat family protein	0.995	348-363	GGKKSKKKNGKKGKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D3	PE repeat family protein	0.984	1081-1159	RRQQEAKQRKEAKLKLERAQEKQRQEEAARRAKREAERESLRESERRKSKEIRSSGRTRHHSSDHSSSRSRHKRGEASP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D3	PE repeat family protein	0.971	1218-1262	RRSHEERASGGSRDETRRERPHRSERRREEPTEERRRHHENRRRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D3	PE repeat family protein	0.68	1022-1026	RRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D3	PE repeat family protein	0.665	4-8	KKNKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB25	RING-type E3 ubiquitin transferase	0.977	19-68	RGGRRRGGGRGASHNSNRTDHRRNEGRADGGEPRNSRGRGGRRGGRGHGH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB25	RING-type E3 ubiquitin transferase	0.868	743-752	GKKGKGKKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB25	RING-type E3 ubiquitin transferase	0.62	417-423	RGEREGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFK0	Integral membrane protein	0.859	64-79	KEPKKRERVSRRQPRI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG75	rRNA-processing protein	0.999	19-110	NGKNWHTPKKPFRPTAGLKSYEKRLEERNNLAAMKEREKEMKEEKEAERQRHIQAIKDRRAAKEEKERYEKMAEKMHRKRVERKKRREKRNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK5	Uncharacterized protein	0.738	91-101	PRRQRRSRPNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK5	Uncharacterized protein	0.64	30-34	KPRKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK5	Uncharacterized protein	0.627	128-132	RRNRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH78	60S ribosomal protein L12	0.844	86-100	KEPPRDRKKEKNIKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLR7	Kinesin light chain, putative	0.727	367-373	GRRGRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ05	Nuclear cohesin complex subunit (Psc3), putative	0.997	84-148	KERRKAARRAANKRRQSAKGNAKRTPSRATKKAKTNSAGKSLAIRSTTNGKAKKAAPKKRSAPPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR25	SH3 domain containing protein	0.81	396-408	KKKPPPPPPPRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSA9	Uncharacterized protein	0.874	340-353	PSKGKRKASKDRGS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSA9	Uncharacterized protein	0.79	89-96	RNKKKRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUP6	Pogo transposable element, putative	0.675	425-430	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUP6	Pogo transposable element, putative	0.648	489-497	REAEKVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW23	Uncharacterized protein	0.889	496-513	KAKKKWRRLSSMFGRKKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0V8	G-patch RNA maturation protein (Gno1), putative	0.999	198-261	RTAEAKDTKEKSKKKDKEGKKEKSDKKVKKEKKDKKERKERKERKREKEQKKKDEKDSSKKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M329	Uncharacterized protein	0.971	201-212	PKRKPKPKKPKI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M1	Universal stress protein family domain protein	0.976	276-324	RKGPVGPRGRSKSPRGRSKTKTGLSPGTSPARSPAPPGGWSGKRGPGPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M1	Universal stress protein family domain protein	0.823	650-662	RKKLKKHTKNTRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3R6	KRR1 small subunit processome component	0.999	277-339	ERVRKEEIQEKQREKREEKMKERQKDFVPPTEDADKKEKKKKRKRAEDAGDHTEKKKKKKKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4X0	Mis12-Mtw1 family protein	0.821	229-252	RNKEMREGRGGKGQRRNSLGMRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4X0	Mis12-Mtw1 family protein	0.78	187-198	KPAKTGRPPKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6L9	Nucleolar protein 58	0.998	541-587	AISKKELKKAKKEAKKATKEEGKKRKRDDEDADDKAEKKKKKKKSKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6L9	Nucleolar protein 58	0.85	494-528	KKSKKSKKSDSKDETEKLAAKAGLSVKRYLRKLER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6L9	Nucleolar protein 58	0.729	457-464	KSKKEKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6V2	PA and RING finger domain protein	0.798	603-613	RIRRRRWRAPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8P8	Nuclear protein export protein Yrb2, putative	0.63	421-423	KKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8U2	Triosephosphate isomerase	0.982	64-74	PRRKKKRKKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAM0	Pogo transposable element, putative	0.868	242-258	KSARRPKSRSYWRRKHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAM0	Pogo transposable element, putative	0.805	297-305	ARRRKLRRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAM0	Pogo transposable element, putative	0.699	786-794	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCH1	Stage V sporulation protein k, putative	0.731	26-36	RRDRGIKKSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF58	Casein kinase, putative	0.894	64-74	KPVKKKKIKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN8	Pentatricopeptide repeat protein	0.642	761-768	RSRVRARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN29	Uncharacterized protein	0.784	149-158	KKSKKSQKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ56	CCCH finger DNA binding protein, putative	0.922	7-66	ADQAKKKKTTVEDKTFGMKNKKGGSARRQIAQLEAQAKHNKNADEKRKEAEKARRAAEKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ56	CCCH finger DNA binding protein, putative	0.781	262-278	KKKRLDKKAAEEEARKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV01	DDE-1 domain-containing protein	0.679	290-297	KQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU02	Ima1_N domain-containing protein	0.642	163-169	AAQKARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW12	Histone acetyltransferase	0.953	356-371	SRPRPFKARRRRQPKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW12	Histone acetyltransferase	0.888	316-324	NRPRRKRKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW12	Histone acetyltransferase	0.728	95-102	RRPRRGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1T8	Tyrosine--tRNA ligase	0.778	350-365	KKVKKVKDKGSRYPGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2D9	Uncharacterized protein	0.983	131-194	NRERNRQKRRPKPNAFQKEMELAEKRRKEQEARQKERELKAKERQAMARARRPDQFGKRRLGRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2D9	Uncharacterized protein	0.828	43-65	RRKAQKIKRDLIQKAKVKKAYAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M317	Ubiquitin-protein ligase Ufd4, putative	0.955	31-63	SRKRKATTRRGKPRDEPEPPSQPSSPPRKVKRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M317	Ubiquitin-protein ligase Ufd4, putative	0.791	152-161	HRRSKKRSPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M317	Ubiquitin-protein ligase Ufd4, putative	0.764	122-134	RRKSGRNGKSSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3B1	Uncharacterized protein	0.996	124-203	KKKEKKKDKQKEKKKEKQPFERAKEPVQSLNNAENKKRQPKQILEPKKPKFEHQPPHISQHEEPLSKRQKAKRAKKSKEN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAR6	20S cyclosome subunit (Cut9/Cdc16), putative	0.73	700-708	RPRRTGKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBH8	Uncharacterized protein	0.771	312-320	TRPKRARRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBI1	Developmental regulatory protein wetA	0.804	556-571	KTKARREQEAREKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBK0	Pre-mRNA-processing protein 45	0.849	225-240	PKFKHKKIPRGPPSPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBK0	Pre-mRNA-processing protein 45	0.709	391-399	REKARRERR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBK2	DUF159 domain protein	0.733	387-407	RKMKSATSSSPSKPKSIRNKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBK2	DUF159 domain protein	0.666	290-294	KKKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCL0	Pogo transposable element, putative	0.699	431-439	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG0	WD repeat protein	0.837	585-593	ERKRKPKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF57	Valyl-tRNA synthetase	0.993	55-97	KVKTEKELERERRKAEKAKKFAEKQAKAAAAKPAQPKAEKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFC3	SANT domain-containing protein	0.831	225-239	RAAGSGRNHKHRKKW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFC3	SANT domain-containing protein	0.826	61-75	PKPRTHRSAKRRYRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIH8	Cytokinesis regulator (Byr4), putative	0.7	784-792	KKGKASRPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKA9	G-patch domain protein (Spp2), putative	0.686	440-449	SRPRSRERSH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNQ6	Cell cycle protein kinase, putative	0.87	150-157	GKKKKKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUU2	DEAD/DEAH box helicase, putative	0.765	1192-1218	KFEKWQKAREKQVLLVKEPKSKYRRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTQ3	JmjC domain protein, putative	0.97	847-867	VRGKSRPLKKKGKHVVRLRPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTQ3	JmjC domain protein, putative	0.887	908-917	AKKRRRRGEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYR3	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase	0.865	76-90	RRAWLEKRRRDKKAL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M086	S-methyl-5'-thioadenosine phosphorylase	0.851	643-650	IRKKKRRY
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M613	Uncharacterized protein	0.832	85-106	KANSYRKRPAPSGRKSTTRSPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6H6	Uncharacterized protein	0.831	8-20	RRKGSRAARSKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M970	Solute carrier family 40 protein	0.704	426-433	RKDRKSKI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEV4	Uncharacterized protein	0.989	102-136	RPPRRGQRLKAERKRKRTAAEVLSEGPPSKRKREK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGQ0	HTH CENPB-type domain-containing protein	0.627	30-35	KKLSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHE4	C2H2-type domain-containing protein	0.942	461-475	RPKGSGRGRRRRGHS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHE4	C2H2-type domain-containing protein	0.895	59-72	GRSPKHRRLHRKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHR4	Na/K ATPase alpha 1 subunit, putative	0.724	51-60	RGRSSRSRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW7	rRNA processing protein Bystin, putative	0.613	36-38	KKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT86	Uncharacterized protein	0.805	175-185	PRKGRPRLPKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT86	Uncharacterized protein	0.67	208-217	KGSRLGSRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVF9	Uncharacterized protein	0.864	135-151	RSKPRTKSYIKKKAEKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZW6	Zn(2)-C6 fungal-type domain-containing protein	0.858	372-387	PKRRRLAAEHKRHRGP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M166	Uncharacterized protein	0.975	111-133	YKKQARAERKRAKRLDAKLRRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6G4	Ubiquitin carboxyl-terminal hydrolase	0.895	376-424	RDKVREIRKDEEDAERARKRQKLAHRQEEDRKADAESGRPAEPLQKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M847	DnaJ domain protein	0.832	364-385	DRDRDRDRERRERQERREQRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAF0	Pogo transposable element, putative	0.735	458-465	AKKPKNKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAF0	Pogo transposable element, putative	0.685	520-532	KQAKEAEKVKRAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHF1	Uncharacterized protein	0.868	184-222	RERLRRELAEKRRQGGRRDEGDGDYRRIRFDEREHRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHF1	Uncharacterized protein	0.855	257-266	RRRPRRERRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ77	Helitron_like_N domain-containing protein	0.647	136-146	RRREQDRRAHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML92	Ubiquitin carboxyl-terminal hydrolase	0.611	203-205	HKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMZ5	Uncharacterized protein	0.684	54-62	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPF7	Zn(2)-C6 fungal-type domain-containing protein	0.709	57-73	KKDASEKSRASKAPARN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTK0	Uncharacterized protein	0.828	24-42	AKRRGSSSSQIPPKKGKKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTV3	Uncharacterized protein	0.702	15-32	KARRAANAFKAARGASRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV02	MULE domain-containing protein	0.951	435-474	RGSGHVRGSRGGGQARSGRGARQRGRGSHGGGQAGRGRGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV02	MULE domain-containing protein	0.703	65-72	KRRSKRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV02	MULE domain-containing protein	0.606	520-521	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVW7	Ribosomal protein	0.719	94-103	NKNKKLIKKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWF4	RWD domain protein (Gir2), putative	0.776	183-190	EKKKKPSA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXA4	Uncharacterized protein	0.988	264-296	KKRVRPTGDGGRLRQPGPRKKPPLKKSSEAKHA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYN5	Uncharacterized protein	0.996	258-279	KRNKKNRERKIKRRQKERERKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYN5	Uncharacterized protein	0.977	224-238	KKKSKPGKKRRIILR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU1	Kelch repeats protein, putative	0.996	3-36	KKDKKKSAEKKERNAAKQLKKADKKEKKNKSKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU1	Kelch repeats protein, putative	0.609	324-325	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYY9	Pogo transposable element, putative	0.701	471-479	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y7	Uncharacterized protein	0.999	267-292	KKSKKSKKDKKDKKTKKGKERKDKAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y7	Uncharacterized protein	0.989	135-164	EGKKEKKRKRGQEDDESKKLREEKRKKQKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y7	Uncharacterized protein	0.967	180-193	RKVKKKEKRSKKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y7	Uncharacterized protein	0.955	214-226	KERKRKKKNRSDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y7	Uncharacterized protein	0.944	236-248	KKSEKRKEKRRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M404	Rad4 family protein	0.93	206-219	KTKADKKKGSKKKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M404	Rad4 family protein	0.88	904-914	RGSNRRRRRGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M404	Rad4 family protein	0.608	618-620	RPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Z3	Pogo transposable element, putative	0.857	378-391	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9J1	Chromatin assembly factor 1 subunit A, putative	0.999	126-219	KKLKLSPGSKEAKRKEKEERDRLRAEEKAKKEAEKKAKEEERKKKEAEKEEERKKRETEREEKKKQKEEERQAKEEGKRKKEEEREKKERSQMR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MER8	C6 transcription factor, putative	0.756	107-116	GYKGPSKKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGJ4	C6 finger domain protein, putative	0.718	166-175	RPSRRRSSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHE0	Cytochrome b561 domain-containing protein	0.972	596-612	RESKRRSRERRGSRRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHE0	Cytochrome b561 domain-containing protein	0.694	770-776	RRRRAER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHE0	Cytochrome b561 domain-containing protein	0.637	548-552	RRRSG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHX8	BZIP domain-containing protein	0.754	383-399	KRKANSDASRRFRNRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMM3	WD repeat protein	0.834	214-221	KRRKKKLA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMM3	WD repeat protein	0.707	174-180	RRRRRNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMS9	Uncharacterized protein	0.905	68-78	GRQKRRRRARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNP8	ATP-dependent DNA helicase CHL1	0.941	102-126	LARIRKEEERRKKLAQNPHRPSKKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR56	WD repeat protein	0.798	584-590	EKKKIRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW49	Formin binding protein (FNB3), putative	0.906	632-682	RERSYRKVSGLSPVRERRDDRDRIRDKERERDRDRDRRGLSHYDRERRSRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW49	Formin binding protein (FNB3), putative	0.855	729-751	SRSAKRYRRDEREKERSRDRSHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW49	Formin binding protein (FNB3), putative	0.665	369-375	AKARRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYJ2	Translation elongation factor EF-1 subunit, putative	0.728	77-86	GKKVKEIKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZZ1	C2H2 finger domain protein, putative	0.749	210-216	KKRRMKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2I5	HET-s/LopB domain protein	0.722	831-838	KVPKRRRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2I5	HET-s/LopB domain protein	0.671	730-735	KKVKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3P2	Transposon, putative	0.972	464-479	RAAHGKEKKKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7N9	Fungal_trans domain-containing protein	0.777	34-55	PKRRAPAGSTRESTSKRIRGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8V0	Asparagine-linked glycosylation protein 10	0.873	468-488	SKREEKEAKKQQKKQASKSKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB91	LigD_N domain-containing protein	0.868	280-292	RPTNQKRRRRRIN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME46	Telomere length regulator protein (Rif1), putative	0.989	1512-1553	PIKSRRSRSRKRRSLRLSGVPALSPPKSDKTSKAQKRKRTKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME46	Telomere length regulator protein (Rif1), putative	0.955	1407-1440	TRKRKRNAETEEASTPERVKRRQSKKSKAARSER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME46	Telomere length regulator protein (Rif1), putative	0.696	1304-1312	KQNSRRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFG5	C6 finger domain protein, putative	0.747	326-342	RKRVPRKSTPGQRQAKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFG5	C6 finger domain protein, putative	0.649	73-77	RRPRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHQ0	G-patch domain protein, putative	0.674	224-230	KVKGKKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHQ0	G-patch domain protein, putative	0.631	43-53	RKQRESEAKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML19	Small nucleolar ribonucleoprotein complex subunit, putative	0.983	455-495	KKRREEREQDNKPKDPIEKLKNRGRGRNSALRKYLRKRGKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML19	Small nucleolar ribonucleoprotein complex subunit, putative	0.869	36-55	GKAVQMKKIKDKKLRGNLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MME4	G-patch domain protein, putative	0.91	443-462	KPKTDSKAPKESDKARKRKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MME4	G-patch domain protein, putative	0.897	95-114	SRSRSPSRSRSRGRGRDRDR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUK1	ATP dependent RNA helicase (Dob1), putative	0.95	23-35	KPRPKKDKSKKRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUK1	ATP dependent RNA helicase (Dob1), putative	0.936	383-398	RKGKGKDKKFNKGGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYN6	Uncharacterized protein	0.645	177-180	RKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH2	DNA excision repair protein Rad16, putative	0.667	300-307	RAARERRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6A6	Phospholipid-transporting ATPase	0.623	62-64	SRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M816	Forkhead transcription factor Fkh1/2, putative	0.722	33-39	ASKKRKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF98	Myb-like DNA-binding domain protein	0.852	202-224	SKKQSVSGSKKTSTVRSKPKRKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH25	Calmodulin-binding protein Sha1, putative	0.995	985-1011	RERKMSRKQVTSKGKKPKSKPARRARF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH25	Calmodulin-binding protein Sha1, putative	0.687	57-64	AKPRRALR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ3	Zn(2)-C6 fungal-type domain-containing protein	0.655	52-58	RRPAPRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ3	Zn(2)-C6 fungal-type domain-containing protein	0.604	64-64	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS9	C-4 methyl sterol oxidase Erg25, putative	0.903	284-299	KRWREKKAEKAAKKAN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPX3	Sister chromatid cohesion and DNA repair protein (BimD), putative	0.941	1312-1343	GDGEAKKARRKSSTAPRRASTSANTKLFRKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPX3	Sister chromatid cohesion and DNA repair protein (BimD), putative	0.756	1299-1308	ASKKRKSEHA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPX3	Sister chromatid cohesion and DNA repair protein (BimD), putative	0.749	1444-1453	KKKAAGKRTS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRQ7	Ribosome biogenesis protein (Bms1), putative	0.986	1120-1179	KRAKRAAAQEERRKGYRAKVAENLAKKAEREKREKSEYWRQEGKKRKNTEGDSGGGKKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRQ7	Ribosome biogenesis protein (Bms1), putative	0.789	10-45	HKTKEKKKYEGQNPKAFAFSNPGKGKRQAARSHELK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRQ7	Ribosome biogenesis protein (Bms1), putative	0.618	319-321	GRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTQ9	Uncharacterized protein	0.985	86-121	QRSNRVRKQIKRKPRNKMVFSKPHQGKQQRKTQKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTV1	KH domain protein	0.637	28-32	RRSRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU05	Uncharacterized protein	0.674	471-479	KRWSHRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF1	Ribosomal protein S23 (S12)	0.727	4-20	GKPRGLNAARKLKDHRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF1	Ribosomal protein S23 (S12)	0.702	137-144	KEKKEKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0N4	ATP dependent RNA helicase (Rok1), putative	0.973	162-184	KTKKQKKRKISKEIASLSKKKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0N4	ATP dependent RNA helicase (Rok1), putative	0.662	93-99	KKSKNSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0N4	ATP dependent RNA helicase (Rok1), putative	0.646	678-686	RHGVKARAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0P3	ABC ATPase, putative	0.654	51-57	KPKAKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M356	Transcription initiation factor subunit (TAF30), putative	0.807	143-158	GKRGATGEESVKKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C3	BZIP domain-containing protein	0.901	89-122	KKEKSRKSRSAKTPTSEEDTPEKKSRRRREQNRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4H7	F-box domain protein	0.833	456-463	KRRRIRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5C2	Dual-specificity kinase	0.811	1283-1291	SKGRRRRPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDX7	CCCH zinc finger protein	0.952	374-394	IRAKAKAEKLRKKLLKEERRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDX7	CCCH zinc finger protein	0.851	309-357	RKKRFPTQARIEEKKKAQEEVKKQRDLQREEARRKQQEIKEQREQARKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDX7	CCCH zinc finger protein	0.791	240-245	KKKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDX7	CCCH zinc finger protein	0.73	477-487	PPQREGHKKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDX7	CCCH zinc finger protein	0.706	47-59	GFRGRGRGGMNRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPZ7	C6 finger domain protein, putative	0.964	511-551	RAKKQKVKSDSVSSSKSRATKSAPAKPTKNGKARPVARKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPZ7	C6 finger domain protein, putative	0.879	681-687	KNKKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPZ7	C6 finger domain protein, putative	0.663	187-193	SGRGRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSE7	FAR1 domain-containing protein	0.704	65-72	KRRSKRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVL2	Uncharacterized protein	0.841	3-18	KRKKKSSRSIIQARAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTJ6	Uncharacterized protein	0.63	425-429	KGPRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M447	Integrase catalytic domain-containing protein	0.837	318-336	RRHGHPRAKMLQRIKKKLE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M447	Integrase catalytic domain-containing protein	0.804	1091-1099	SRKKHKKLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Q6	Clustered mitochondria protein homolog	0.881	873-879	KKKKKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Q6	Clustered mitochondria protein homolog	0.721	592-601	KRRSKKAEEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Q6	Clustered mitochondria protein homolog	0.682	1220-1235	KQSKRGTANPKLRGTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M612	DDE_3 domain-containing protein	0.834	171-182	KRRKWSRKQLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6E6	DEAH-box RNA helicase (Dhr1), putative	0.886	174-181	KKRKRARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6E6	DEAH-box RNA helicase (Dhr1), putative	0.841	57-66	KMSSKKKKRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6E6	DEAH-box RNA helicase (Dhr1), putative	0.692	7-15	RDRKQRHRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M757	rRNA processing protein Utp6, putative	0.813	69-79	RKKRSKRFGIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MER7	Uncharacterized protein	0.97	202-232	KQKRKARRKEAKQQAKQEEKQAKANDKPEAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG69	Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyldiphosphate specific)	0.817	49-63	ARKSKSTKSKSKSKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPF2	RNA exonuclease Rex3, putative	0.895	88-124	SARRKVSPPPARPATTSPSLKRKAPKESLNPRLLKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPF2	RNA exonuclease Rex3, putative	0.65	54-59	KRKLVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPF2	RNA exonuclease Rex3, putative	0.604	66-67	RK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUD9	Uncharacterized protein	0.913	140-157	LKREGWSKKTSKRKARQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2B8	HTH CENPB-type domain-containing protein	0.744	492-501	HKKEKQKRQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K7	RNA helicase	0.991	565-588	EKRKEREQRRERKRARREHERWGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCA4	Eukaryotic translation initiation factor subunit eIF-4F, putative	0.603	742-742	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDT7	Histone deacetylase HosB	0.977	62-79	KKDRKLQRKADKKKNKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDT7	Histone deacetylase HosB	0.948	1056-1087	LREKKAAEQRKKAATAKKATTSKPAASKAARN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEB0	GAJ protein, putative	0.775	219-229	RKSGKNKRPRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIG3	Aflatoxin biosynthesis regulatory protein, putative	0.831	48-60	GKPRKSAKAKAMM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLR4	Uncharacterized protein	0.986	43-93	RSRVAHEAEGKPRRKPQASKSRSRSSGSASRRLGTNSRPRSKMRRESKGRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU80	Integrase catalytic domain-containing protein	0.871	279-302	DKKRKERDPDTPNEKKRNAPKPGV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU80	Integrase catalytic domain-containing protein	0.647	309-313	KKLRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT00	Siderophore transcription factor SreA	0.692	300-305	IKRRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT79	mRNA splicing factor (Prp1/Zer1), putative	0.871	123-134	RRRKARREAREK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWU5	Peptidyl-prolyl cis-trans isomerase, putative	0.933	527-554	EKEKEKTGRDREREHKRERAGEREWDRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWU5	Peptidyl-prolyl cis-trans isomerase, putative	0.919	193-220	KLKKRDKVAKVIEPAKGDVTIKKKKKAN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXF7	AdoMet-dependent rRNA methyltransferase SPB1	0.997	670-717	RPVTKAAAAAIKEKLRAINARPIKKVREAKARKKFKVAQRLEKLRKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXF7	AdoMet-dependent rRNA methyltransferase SPB1	0.992	737-798	KLMSKAAKKKPKQKVKLVVAKGANRGISGRPRGVKGKYKIVDSRMKKDIRAQKRVAKAQKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXF7	AdoMet-dependent rRNA methyltransferase SPB1	0.953	373-386	RKKERRKENERKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXF7	AdoMet-dependent rRNA methyltransferase SPB1	0.767	236-241	KKKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXF7	AdoMet-dependent rRNA methyltransferase SPB1	0.676	6-23	KHGKGRLDKWYKLAKEKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZZ5	Dynamin GTPase, putative	0.997	830-846	GKSKKAKKNKKKKKLAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M510	G domain-containing protein	0.998	290-330	KRMKLEADKERQERQRRREIKELEKRERGELKRRKRRAKRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Q7	Uncharacterized protein	0.992	432-452	RGRKVVKPQKKKRSKITKRRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Q7	Uncharacterized protein	0.886	777-791	PLRNSKRPRRKYQRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Q7	Uncharacterized protein	0.886	888-899	PPKRGRGRPRKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Q7	Uncharacterized protein	0.722	76-86	RKPESKRVKHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Q3	Phosphoglycerate mutase family domain protein	0.65	313-316	RKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7H7	Serine/threonine protein kinase, putative	0.894	164-173	TRIKKKKGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M997	RNP domain protein	0.984	8-34	RSRSPRGDRGRRSRSPRRSRRSYSRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D7	OTU-like cysteine protease, putative	0.786	111-124	SKKPNRQKARLARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D7	OTU-like cysteine protease, putative	0.744	21-31	QKKKNATKKTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAX9	60S ribosomal protein L7	0.98	20-53	KKRKSQEAARAARREEAEKKKQANKEKRGVIFKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC50	DEAD/DEAH box RNA helicase (Ski2), putative	0.887	560-592	RGRGQPRGGGPRGGGQGRGGPQGGQGRGRGQPA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MII1	Uncharacterized protein	0.976	79-124	RYRSRSPPGFHRSRSPPYRQPQRARSPLRPRSPRRDRPPSPIRSWR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MII1	Uncharacterized protein	0.972	35-66	RYSRSRSPSRVRRPRSPPPPHGPRNRSPPRLG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MII1	Uncharacterized protein	0.838	154-199	SPRRDRPLSPPGRRADISPPPRSAFKERESYGRPPARSRSPYRGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPC8	Alcohol dehydrogenase, putative	0.621	291-298	KPYRRDAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTE5	Isochorismatase family protein family	0.654	424-427	KKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTE5	Isochorismatase family protein family	0.642	98-102	RKGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUI2	Uncharacterized protein	0.833	453-478	RRKLQGLIHAASAKKSGRSRQSPKRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUI2	Uncharacterized protein	0.782	148-167	PPRPAKLNTGIKHLKLKRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV64	C2H2 finger domain protein, putative	0.714	97-106	KLREKALKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXL6	Ubiquitination network signaling protein, putative	0.833	614-626	KRSRLKKAKADHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXL6	Ubiquitination network signaling protein, putative	0.713	404-409	AKKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9E4	AP-3 adaptor complex subunit mu, putative	0.999	477-498	KSSKPRKPKSTKMKKKKPKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9F0	RNA methyltransferase, putative	0.869	145-160	KKLGKGSGNIKRRRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBQ8	Low-temperature viability protein ltv1	0.967	453-467	SKQAKRKGAKGKRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBQ8	Low-temperature viability protein ltv1	0.814	339-344	RKKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQV0	HTH CENPB-type domain-containing protein	0.785	465-475	KEKQKRQRSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTX7	Oxysterol binding protein (Osh1), putative	0.778	1124-1133	KQRAKRRERE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTX7	Oxysterol binding protein (Osh1), putative	0.746	647-654	KRKRTKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTS1	RSC complex subunit Sfh1, putative	0.942	459-476	RGERSKRKRRFRSLSPAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTV5	Uncharacterized protein	0.936	63-88	KSRKRGRPRLIRDDRREADLKERRKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVQ5	Sas10/Utp3 family protein	0.998	575-607	KNKGLAAKRNKDVRNPRVKKRKKFEQKKKKLAS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVQ5	Sas10/Utp3 family protein	0.836	344-380	KKSSKATRKEKKTSTSQQAAEKARAEAEARRAEKIKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVQ5	Sas10/Utp3 family protein	0.719	533-541	KQKKAEKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXU9	Uncharacterized protein	0.79	25-72	RKSTKPSTMPEHRKPQNPHHRGLPKTQPLAQRRENGRKPPSFFIERRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXU9	Uncharacterized protein	0.615	185-189	RRLPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYF8	U1 small nuclear ribonucleoprotein 70 kDa	0.673	188-195	KGWKPRRF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYH8	Translation initiation factor eif-2b delta subunit	0.964	77-97	EMKKKQKAEKAARRAREKLER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ62	Uncharacterized protein	0.988	37-65	ERRRHRSKHHRHHHRSHSRDRHHRRKSEG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ62	Uncharacterized protein	0.709	1020-1024	RRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ62	Uncharacterized protein	0.624	247-249	GKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZG7	Formin 1,2/cappuccino, putative	0.974	313-339	RAGKIKKQEEKKRKQAAEREAKEKEAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZG7	Formin 1,2/cappuccino, putative	0.973	188-244	RERKEREERLKKAEEEDAKREQERQRRLADERAPAPAADKVAGKKPPPAPPSRKGRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZG7	Formin 1,2/cappuccino, putative	0.681	607-624	PPPPPPPPGGAPPPPPPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6C1	ASXH domain-containing protein	0.988	360-376	AKKGTGRKRGRPPKRKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M796	DUF814 domain protein, putative	0.982	136-159	KKQRKEERRAREEKKAAEKKEKQE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M823	Uncharacterized protein	0.997	156-220	PPKKKESSRPPRPREGRPRPRRNSESSIMERPKGLDPEDERRRRERRHRERERERDGKSRSKRPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M823	Uncharacterized protein	0.983	99-146	KERRPAPPPPDKSSSSRPPAPRPSASRPRPEIRDRERPRDPSKDKRRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M823	Uncharacterized protein	0.684	473-481	LRRPRPERR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Q2	Pentatricopeptide repeat protein	0.621	102-104	KRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHD4	WD repeat-containing protein	0.675	376-380	RKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMS5	Oxidoreductase, FAD-binding	0.627	287-290	RRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMU6	Cir_N domain-containing protein	0.985	243-305	DRKHRRRRDDRVSGPRSQSPVRHSRSRRSPSPSRHTSRRSRSPYRRDHREHRERSYSPRSRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMU6	Cir_N domain-containing protein	0.948	209-237	AEKERRHHRHRHRHRDDEERHSRHRSGRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV41	Uncharacterized protein	0.692	15-21	GRQKKRI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVX8	Vacuolar protein sorting-associated protein	0.81	1722-1735	KEIKGTDKKSKRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4E6	HTH CENPB-type domain-containing protein	0.779	465-473	KEKQKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAR1	Spindle pole body component	0.781	804-811	RRRRHRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB49	Uncharacterized protein	0.949	881-892	RRRRPKRRNERR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB49	Uncharacterized protein	0.913	92-123	MAKSPKTKDRERDAVEKDKEKRRYSRPSHGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD03	C2H2 finger domain protein, putative	0.819	66-76	RKGKNHKRRLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDS5	R3H-assoc domain-containing protein	0.916	97-124	RRREPIRRDSLRRREALLKGKEGSRRRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDS5	R3H-assoc domain-containing protein	0.718	191-207	EKTRVSKEIRKSLKHAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDS5	R3H-assoc domain-containing protein	0.622	182-187	KSKNRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MES4	TBC domain protein, putative	0.781	543-555	RRKKRQKEAALLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU96	HTH CENPB-type domain-containing protein	0.795	313-321	KEKQKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVA7	Uncharacterized protein	0.993	124-142	AGKRRRMRFKGRKPKPKPT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTF2	Cell pattern formation-associated protein stuA	0.958	199-224	RSRRSASPAKSSPKKNASPRKSRAHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTF2	Cell pattern formation-associated protein stuA	0.6	276-276	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYA5	Nucleolar complex-associated protein 3	0.983	370-392	GKKKNKKEFRTKKERKLLRDRKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYA5	Nucleolar complex-associated protein 3	0.977	54-70	RRPRKGKNKKEKEKTRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M090	Uncharacterized protein	0.778	6-15	KRRKASGRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M090	Uncharacterized protein	0.723	285-289	RKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M090	Uncharacterized protein	0.702	300-305	SRRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M090	Uncharacterized protein	0.616	410-412	KRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2P5	Transposon, putative	0.885	477-488	KEKQKRQKSKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M733	Uncharacterized protein	0.903	164-180	KAGAPAATSKKSKKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Y0	Sensor histidine kinase/response regulator, putative	0.611	204-206	KSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCP4	HTH CENPB-type domain-containing protein	0.694	460-468	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI61	DDE_3 domain-containing protein	0.834	139-150	KRRKWSRKQLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNB8	Uncharacterized protein	0.729	109-130	KMKKKLSSETRPKSSSSKPLKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR07	tRNA nucleotidyltransferase	0.857	69-83	RIRKIKQSKRRNGKM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWP4	50S ribosomal protein L24	0.945	82-103	ISKGRNKGKTRRSWKPNVRWKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2X1	Protein translocation complex componenet (Npl1), putative	0.948	64-76	KRKRLRKERRVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M375	RNP domain protein	0.945	338-369	KRDKKGKKNGHGGGGGNKNSPHGTVGGGKHKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S6	C6 finger domain protein, putative	0.674	41-46	RGPKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W7	Phosphatidylserine decarboxylase proenzyme 2	0.96	222-236	KRRRRLRIARLKRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W7	Phosphatidylserine decarboxylase proenzyme 2	0.865	139-146	KRRRGKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W7	Phosphatidylserine decarboxylase proenzyme 2	0.8	765-777	RDMEKKRIRKMLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M501	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	0.761	59-76	KEEAKRSKSQSRNGRGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M559	Uncharacterized protein	0.81	138-152	VPRRRRTRSEPPQKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5N9	Transcriptional activator spt7	0.716	465-473	GRKAPGKKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M610	HTH CENPB-type domain-containing protein	0.733	507-517	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Q4	Component of oligomeric Golgi complex 8	0.935	699-738	KKAAPSRPKQQTNPLRQPKRAPKAKAASTNSSAKAKPQPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M759	C6 transcription factor OefC	0.95	169-194	PRKRGRPRKHPLPVPGGQMKVAKGRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M821	PHD transcription factor, putative	0.975	423-456	KGPSVKKRASASVNGSPAPEIKKRSKPTKKKPTG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M821	PHD transcription factor, putative	0.608	795-797	KAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M821	PHD transcription factor, putative	0.603	399-399	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8J9	SH3 domain protein	0.96	272-284	QKKEKAKKPPKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M994	GTPase activating protein (BUD2/CLA2), putative	0.674	23-31	PVERRASKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Q2	Cysteinyl-tRNA synthetase	0.728	746-761	KFRQKQLEKEKREKEA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Q2	Cysteinyl-tRNA synthetase	0.696	803-811	RTKKLKKDW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCY3	Transcriptional regulator (Cti6), putative	0.919	421-442	PPPPRQSTRKSGRPPARRGGRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCY3	Transcriptional regulator (Cti6), putative	0.792	366-376	PRRKSRSEKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCY3	Transcriptional regulator (Cti6), putative	0.695	332-343	RAKRGASGRGQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK38	RING finger ubiquitin ligase (Tul1), putative	0.877	734-744	KPPRPKDKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTW7	Ras family GTPase (Rab4b), putative	0.611	317-318	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV66	Transposable element tc3 transposase, putative	0.886	115-126	IHKRKWKQRKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUG3	G-patch DNA repair protein (Drt111), putative	0.993	130-145	REKRQRGGRKKRKKNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUG3	G-patch DNA repair protein (Drt111), putative	0.639	77-82	KPRAKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUG3	G-patch DNA repair protein (Drt111), putative	0.604	422-422	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUG3	G-patch DNA repair protein (Drt111), putative	0.604	427-427	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUJ3	Uncharacterized protein	0.994	87-121	EKQKRKKEKEKEKDKEKNSKDDDKDKKEEKSKKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0P9	Ribonuclease Z	0.762	1715-1726	QARTGKKKSGVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1R1	Uncharacterized protein	0.701	479-487	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M283	SNF2 family helicase/ATPase PasG, putative	0.901	156-168	SKKAPAKKGAKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8V8	54S ribosomal protein L4, mitochondrial	0.947	217-237	TAKAAKLEAKRQSRAEKKKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M995	DNA damage-binding protein CMR1	0.938	53-68	TSRSKKKPAPRVKKED
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME39	Uncharacterized protein	0.954	140-153	ERKISRRMKKKKHT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGJ8	50S ribosomal protein YmL27	0.924	142-152	NRRKKKLKGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNF2	Flap endonuclease 1	0.997	359-394	KASLKRKHDEKIEEQKKRKKEEAKAKKEAKARPRGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNF2	Flap endonuclease 1	0.742	93-105	KGGELAKRSARKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNP5	GATA transcription factor LreA	0.989	865-874	RRKKRKRKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUP7	NDT80 domain-containing protein	0.908	251-267	RISSGQNKRKKANRHRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUP7	NDT80 domain-containing protein	0.643	235-241	RGPGKFK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT05	Extracellular OTU-like cysteine protease, putative	0.962	441-474	PNAKPKKTQTKAKVKPKSRAEQGQCRKLRPRKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVR2	Endopolyphosphatase	0.997	402-420	KKKKNKSDKKKEKEKKKKF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVR2	Endopolyphosphatase	0.988	611-626	KKNKKKKKNRPNKNNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYC0	Sodium/hydrogen antiporter, putative	0.964	515-529	GRRPQSLRPKRRRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D5	Phospholipid metabolism enzyme regulator, putative	0.951	385-400	RPKKEKKRTTRKPANP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1P9	RNA helicase-like splicing factor (HRH1), putative	0.943	191-231	RNRDRRKSTSRSRSPEPRERHRKDTDDRERYDRKERRNGYK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3R0	NTP binding protein, putative	0.637	677-682	KAAKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3R0	NTP binding protein, putative	0.629	449-456	RTRAAPKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3R0	NTP binding protein, putative	0.61	708-709	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M698	RING finger protein	0.853	283-289	RKRKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K1	Protein kinase domain-containing protein	0.792	797-804	RKRRREKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC00	H/ACA ribonucleoprotein complex subunit CBF5	1	439-474	EKKKRKHDGETPEERAERKRKKKEKKEKKERRKSKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEU7	Zn(2)-C6 fungal-type domain-containing protein	0.697	431-435	RKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEW2	HTH CENPB-type domain-containing protein	0.699	467-475	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM82	Uncharacterized protein	0.9	234-249	PPRHRGRPRGSKNKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS3	Histone H2B	0.991	4-48	KAAEKKPSTGGKAPAGKAPAEKKEAGKKTATAASGEKKKRGKTRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRM0	Zinc finger protein, putative	0.664	297-301	RRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU36	Uncharacterized protein	0.757	125-131	PKPRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUC8	Integrase catalytic domain-containing protein	0.933	1197-1214	PPAPRRRGRPPGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT31	SNF2 family helicase, putative	0.658	2011-2017	HGRGKMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUT5	RNA-binding protein (Nab3), putative	0.973	505-564	RRRDDYRPPRSPSPRSFRNRDSGFLSRNRTPDRFERRDRRRSRSPYSRDRRHRSPSPRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV30	Polyketide synthase, putative	0.879	1632-1643	KSPKKVKAPKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXW2	Uncharacterized protein	0.87	13-23	EHRKRRRAEKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZB2	Polynucleotide adenylyltransferase	0.999	671-692	AAKKQKKKKKKAPKQNSKAKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2F0	Rho GTPase activator Rga, putative	0.908	135-145	RRRKKKTAAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2R0	Histone acetyltransferase	0.921	87-105	KPEKKKAPSKSASQKRARA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2R0	Histone acetyltransferase	0.618	471-474	KIKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3E4	Uncharacterized protein	0.865	354-369	KRKPPPPPPPAKKPNL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7B9	DDE-1 domain-containing protein	0.88	391-404	AKRKNNKKTKRQVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7B9	DDE-1 domain-containing protein	0.806	3-31	KRSKSAKNLKSKYLLSKGLLKKKCKRSYK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB21	SWIB/MDM2 domain protein	0.993	147-176	KRARPTRGSATRKVAPSKKKSKAKTSKKIR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCK5	Signal recognition particle 14kD protein, putative	0.995	111-130	KKRDRSAKKKGKAKAKTTKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME65	60S ribosomal protein L25, putative	0.927	240-255	WKQRGHGRGWKKWPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ0	Uncharacterized protein	0.739	31-39	RRRKGNIRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMX4	C6 transcription factor, putative	0.666	81-85	KKRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR55	Cyclin Ccl1, putative	0.951	392-422	AKKRRLERERREKEGKDIFGGELVARRKKAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVM9	Ribosomal RNA processing protein, putative	0.975	153-170	KKRKRKGDEKSNNGKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH1	DNA repair protein Rad7, protein	0.992	65-93	EKKKRKRKEAATLAKIKQSKEFARRKARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH1	DNA repair protein Rad7, protein	0.943	153-170	KDEKKAKPKKTAPKTGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZK3	C6 transcription factor, putative	0.617	124-126	RRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Q4	BZIP domain-containing protein	0.938	9-29	KRRRQNRESQRRYRKRQKWKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S9	Spindle pole body component	0.849	97-115	RGEFGRSRSKKTASPPRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M560	MFS multidrug transporter, putative	0.701	479-487	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5P9	Telomere and ribosome associated protein Stm1, putative	0.99	317-348	PRGRGNGPRGGGRGGRGRGGRGDGPRREGGRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5P9	Telomere and ribosome associated protein Stm1, putative	0.877	94-126	PAQRHGKRDAPKEAPSAPPTAPRGGARGGRGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5P9	Telomere and ribosome associated protein Stm1, putative	0.808	293-304	EKGKRERQRKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M726	IQ calmodulin-binding motif domain protein	0.976	457-472	ALRKAKREKKRSKSSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M726	IQ calmodulin-binding motif domain protein	0.7	169-175	RAKKKAE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7I2	Uncharacterized protein	0.997	18-76	RSHTRSRSPTRPSSSPRGSHRDRSRSRRHHRRSSRSPARNSRHGERHGERKSRHHGERR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7I2	Uncharacterized protein	0.868	334-367	KAKEQETRKKNEREMRREEILRAKKVEREERLGE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7I2	Uncharacterized protein	0.829	285-299	ERKMEKKREKAAANR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7I2	Uncharacterized protein	0.608	369-369	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9C6	Pogo transposable element, putative	0.954	379-389	EKEKKKRKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBK7	Uncharacterized protein	0.852	190-205	PRIKFFKPARKRTSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBK7	Uncharacterized protein	0.812	395-408	SKKRKGSPLPPPPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDM5	Ribosome biogenesis regulatory protein	0.985	190-217	GRAERKERIKRNERKMRANERRSRKFGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDM5	Ribosome biogenesis regulatory protein	0.919	101-140	KPLPKPKEPTKWELFARKKGIGKYSSKPGAALAEKERRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH23	Uncharacterized protein	0.967	498-541	GRSKGTLKKKTTRASPRRVHSPAPRAHGQVSPKRMKSPAPKPRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH23	Uncharacterized protein	0.963	628-663	RKRQKRKEKFWRQHCRKAAAKEQSERRAARGKGAER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHU9	mRNA-capping enzyme subunit beta	0.819	389-397	RPPKRKKMR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJP0	Pogo transposable element, putative	0.694	463-471	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK93	INO80 chromatin remodeling complex (Ies1), putative	0.966	583-606	GGGRGGQSSRSARSRPRPPRRKPA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK93	INO80 chromatin remodeling complex (Ies1), putative	0.861	558-573	GPSKDRKKAREERQKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML47	NACHT and TPR domain protein	0.671	501-509	RLRDKKAAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLB5	DNA-directed RNA polymerase subunit	0.817	1436-1441	GRRKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQC2	Uncharacterized protein	0.959	46-72	TKKTKGDGQPPKRRGPKPDSKPALTRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVE0	Transcription initiation factor TFIID subunit 13, putative	0.968	145-160	KKAKGKGKRNAGRRGS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVH0	Fungal specific transcription factor, putative	0.747	27-35	KGKRRRTTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL5	Protein kinase, putative	0.776	527-537	RKKGRERSPKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0C4	Uncharacterized protein	0.688	112-116	KKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2T0	DsDNA-dependent ATPase (Rad54b), putative	0.71	945-950	RKRKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K5	Rad2-like endonuclease, putative	0.992	498-523	KKQEAEKKMPKKPAPKKATANRKKKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K5	Rad2-like endonuclease, putative	0.966	744-768	KKVRKSRSKAAANKSKKPPSAASKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K5	Rad2-like endonuclease, putative	0.859	866-875	KGKGKKKRIA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6X4	Ribonuclease P	0.995	211-236	KREGKEESKHQRRRRRRRERIREQRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G7	Uncharacterized protein	0.842	96-104	RPRRRRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA02	Myb-like domain-containing protein	0.881	76-96	ANKSKPKTRSRKTTPKTTPKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAV8	Uncharacterized protein	0.922	191-214	SGGGRPVVDDRNKMKHGRSGKRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAV8	Uncharacterized protein	0.871	169-189	KKRKIEKEERKADRAMQKATS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDC3	1,3-beta-D-glucan-UDP glucosyltransferase	0.951	294-309	KANRRTRKARKAAKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSN0	37S ribosomal protein S9	0.933	299-320	RRVERKKPGHVKARKMPTWVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSN0	37S ribosomal protein S9	0.712	196-203	ARGKGKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVA4	Uncharacterized protein	0.934	100-112	YGKKKGSRKRSRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWG0	50S ribosomal protein L2	0.973	80-128	RRPINDHLWKGRPVHRLTFPKRGHAKGGRNHSGRITVRHRGGGHKRRIR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWG0	50S ribosomal protein L2	0.922	358-407	GGRGKSKGNVHPKSPWGIPTKSGYKTRPKWKINKAVVVPRVRNQGKRRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M224	Uncharacterized protein	0.824	9-33	RAVPKTNDRRSDSGKARKRIVTPAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M439	Integrase catalytic domain-containing protein	0.933	775-792	PPAPRRRGRPPGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M439	Integrase catalytic domain-containing protein	0.747	154-171	RKNRDDAKQLRKSNGRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6B0	MMtag domain-containing protein	0.998	170-288	DGGRGRESRCHRSRRDRSREHGRKRERGHRDHGRSHRHDRDLDREHLHRHHHREHREHRRHRSRSRSGSRSPRPERRDRRHESGRRRDADRSGRRRSSSPRHDRAGRENDREAHRHHRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6R1	DUF1295 domain protein	0.975	337-358	WSVKARGQKGKAKAKIEQKKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6X6	Uncharacterized protein	0.68	386-407	KIRSRPDIKETTKIKPALSKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M755	C6 finger domain protein, putative	0.656	59-63	PRKKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Z3	Branchpoint-bridging protein	0.915	56-67	ADGVKRRKKRNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M990	Methionine aminopeptidase 2-2	0.999	69-89	KPKKKKRSKKKKNNKKKSGAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9N7	Mitochondrial ribosomal protein, putative	0.64	182-185	RKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDF4	Ulp1 protease family protein	0.837	1071-1090	SKKPGRDRTSPRQVKSKRRT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJY0	Pogo transposable element, putative	0.675	425-430	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJY0	Pogo transposable element, putative	0.624	493-496	KVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLQ1	Pogo transposable element, putative	0.779	446-454	KEKQKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR38	Fe2OG dioxygenase domain-containing protein	0.941	3-18	KRGKKQQGKNPKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRC4	HIT finger domain protein, putative	0.889	108-122	GKKRKRGDKNANAAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU22	Uncharacterized protein	0.97	498-517	SKKRGRNKPDLGKKIRGRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTP4	U3 small nucleolar ribonucleoprotein protein MPP10	0.968	600-616	EKSRRRRNEKKKFKATS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTP4	U3 small nucleolar ribonucleoprotein protein MPP10	0.918	304-317	PPRKASKKKARPLP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUM4	Mitochondrial translation initiation factor, putative	0.986	312-326	ERRQRREKRKQKKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUM4	Mitochondrial translation initiation factor, putative	0.824	285-301	KAQRSEKAKDARRGRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX83	Transposon I factor, putative	0.656	61-66	KRKTQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXI0	Sarcoplasmic/endoplasmic reticulum calcium ATPase, putative	0.843	256-266	KKNRKVKKSRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0G1	Uncharacterized protein	0.997	128-163	RPPRRRRRLKAERKRKRTAAAEILSEGPPSKRKREK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M291	Uncharacterized protein	0.649	895-901	KRGRFNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Q7	RNA exonuclease 4	0.999	294-308	KTKKKRKPKKKSRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6A5	Protein transport protein sec16	0.772	1791-1802	KGGTVKSKKKGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6A5	Protein transport protein sec16	0.703	462-472	RPRRAAARRTA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M756	Peptidyl-tRNA hydrolase domain protein	0.922	165-191	KNLRKAETEARIKSKKMHSAKKSNRRN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA70	Uncharacterized protein	0.788	352-370	AEKKKPGIHIIQKVGRKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA70	Uncharacterized protein	0.777	268-277	KNPRKKDPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAF9	Pogo transposable element, putative	0.857	474-487	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDQ0	Ribosomal protein L39e, putative	0.731	97-105	AKRRHWRKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED5	RNA binding protein (Rbm8A), putative	0.983	122-153	PPGNKGKGGGNQRGGRGGRARSRSRERSRSPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG1	Uncharacterized protein	0.984	570-595	ADKKREELKRQLDAKSKAPTKKKRKF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG1	Uncharacterized protein	0.966	429-455	PTENAPKKKGVLSKIGGKKPEPKRAPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG1	Uncharacterized protein	0.905	487-503	TPKKGKKLGLIGGKKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG1	Uncharacterized protein	0.632	351-354	SPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH28	RNA polymerase III transcription factor TFIIIC subunit (Tfc4), putative	0.995	129-160	PPRKRRRRGHGPFSGRFGARGGKGIKRGPRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH28	RNA polymerase III transcription factor TFIIIC subunit (Tfc4), putative	0.955	576-588	SRGRNRRRRKDRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKH1	Uncharacterized protein	0.9	133-154	KPEARKRWERKMIIREVRKRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSR7	Clr5 domain-containing protein	0.821	50-67	RLKKWRVTKPSRQIRKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MST5	C6 transcription factor, putative	0.767	16-25	RKRPRRFAPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTJ8	Lysine--tRNA ligase	0.995	28-60	KSELKRRQKNREKEAKKKEKEAAAPAKPKQEKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU69	RING-type domain-containing protein	0.98	169-190	HRWKEERDRWKKKKDEWKKKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVM0	Nuclear mRNA splicing factor-associated protein, putative	0.865	88-95	RKKKRKQP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX42	Myb-like domain-containing protein	0.789	249-268	RLPPTPNRRRATSIRSRKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ36	SWI/SNF family DNA-dependent ATPase Ris1, putative	0.999	916-964	SKPKKKPKGPKFSKGKGKSKGPKNPKKTLAVLRKEGQRNAAARRKYFKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M379	Nucleotide-sugar transporter, putative	0.996	95-116	QRNERRRRRKRQRRRLDAKIAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M863	DnaJ and TPR domain protein	0.967	14-47	KDKEKKEKKVKSKDSREDSVSPRRKDTRSKGRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8C7	Uncharacterized protein	0.965	832-859	VRRRVKEARKQRARAALEARRERLKQSI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8C7	Uncharacterized protein	0.821	773-787	RRISKSRKSRRQQAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9N9	BZIP transcription factor HapX	0.916	63-97	PRPKPGRKPATDTPPTKRKAQNRAAQRAFRERRAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDE9	5'-3' exoribonuclease 1	0.647	1398-1411	HGGGRGTGLARGRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEA3	Uncharacterized protein	0.757	204-210	PKGKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN75	Uncharacterized protein	0.6	374-374	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQF9	Chitin synthase	0.992	164-194	ERAPSSRHKKKKLYRKGSKKHIESEEKRQQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU60	Uncharacterized protein	0.66	552-557	RRGRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUC5	Non-specific serine/threonine protein kinase	0.612	229-230	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSY8	Uncharacterized protein	0.722	335-343	RREPPKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSY8	Uncharacterized protein	0.685	179-190	KEARALAKAKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWV2	Nucleolar RNA methyltransferase (Nop2), putative	0.979	24-46	IKKRKAAEAGAKADGGKKRRKAV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWV2	Nucleolar RNA methyltransferase (Nop2), putative	0.936	761-770	KSKKTKKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWV2	Nucleolar RNA methyltransferase (Nop2), putative	0.926	675-702	ERNRLRRKGINPKAVLEKARKDGNKAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWV2	Nucleolar RNA methyltransferase (Nop2), putative	0.897	88-106	ATPKKTPTKAEKSKKSAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWV2	Nucleolar RNA methyltransferase (Nop2), putative	0.861	724-733	KKKGSKKEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Y5	Pre-mRNA splicing factor (Srp1), putative	0.993	97-154	RDRRRDRTPPRRGRSPSPRRGRGDYSPRRDDRRDKDYDRRDRDRDRERERERDRDRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1L0	RNA binding protein Pym, putative	0.95	235-256	KEKKARNLKKKLRQARELSEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1L0	RNA binding protein Pym, putative	0.942	186-199	KNAKRREARKKAKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6T0	rRNA-processing protein EFG1	0.993	285-308	KKKKEEKTETRKEDDKKKNKRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7A1	Type 1 phosphatases regulator	0.917	145-155	KKVRRKRRPSP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED9	Zn(2)-C6 fungal-type domain-containing protein	0.99	278-296	RKKRQKKKEHGKGKQRAIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED9	Zn(2)-C6 fungal-type domain-containing protein	0.647	483-486	RRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJD9	Uncharacterized protein	0.922	265-277	PWKNRDKRRRKHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ59	WD domain, G-beta repeat protein	0.993	1052-1107	KRRSRSHTKGSSRVRASSKADRHQRSTSRGIERKHKVKSRNSSRRSRGRSGDRSKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ59	WD domain, G-beta repeat protein	0.918	1142-1175	HRSRQRSSSRRRGTSSVRRDTSPDKRRPRARSSS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRG1	cAMP receptor (Car4), putative	0.812	279-298	KWKLSDKVKGMAPAKPRAPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVT6	Uncharacterized protein	0.864	490-510	KKRASRLLAGKKGSKGALRSG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Y0	Uncharacterized protein	0.972	476-495	AKAAAKKPPPEKKKPIKFKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Y0	Uncharacterized protein	0.961	584-608	EPPAPPPEEPKKPAAPAPKKPKVRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6X8	Exosome complex exonuclease Rrp40, putative	0.809	736-746	RRPAKKPKPAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6X8	Exosome complex exonuclease Rrp40, putative	0.637	444-446	KRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDS3	Zn(2)-C6 fungal-type domain-containing protein	0.8	538-549	PPNLKKRKPANR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME42	FAD_binding_8 domain-containing protein	0.716	211-219	KRKKVPWKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET8	DnaJ domain protein	0.991	192-211	WQKGKQKDKEGGKKKKKMKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET8	DnaJ domain protein	0.814	142-172	RRRRQLKAKMQEEGREKQKEEEEMEARKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHP1	rRNA maturation protein (Nop14), putative	0.922	848-892	KLKAEHKRERKGAMRELRKDANFVAREQLREKKEKDAAYEKKYRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHP1	rRNA maturation protein (Nop14), putative	0.89	902-919	GREAKAYEREKKWRQGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHP1	rRNA maturation protein (Nop14), putative	0.734	25-29	KKKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNE9	Uncharacterized protein	0.816	825-846	RQHRLRSSSSPSPRGRGHRRGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUU4	Zn(2)-C6 fungal-type domain-containing protein	0.958	44-68	RAGKPKGSKKKVTLRLEAARRRIGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV17	HTH CENPB-type domain-containing protein	0.833	442-455	AHGKEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVI3	Uncharacterized protein	0.846	689-719	KANKERIKEIEKSYKEREKQQRKAMKVLAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVI3	Uncharacterized protein	0.836	546-577	KRESKLLREKFHEVERRAKREVRDMQKARRET
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Y3	60S ribosomal protein L18	0.994	149-184	KHFGMGPHSHKKPYVRSKGRKFERARGRRRSRGFKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M488	Endo/exonuclease/phosphatase domain-containing protein	0.937	601-617	RARNKKKRLVKKSLRLG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M488	Endo/exonuclease/phosphatase domain-containing protein	0.755	95-105	KKQPRGRPPKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6C7	Uncharacterized protein	0.903	283-296	KSKKSKRQSKKPPQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6J3	Uncharacterized protein	0.799	31-52	RNKGLKHSAGKKTVAASNRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6J3	Uncharacterized protein	0.749	615-622	PPRKRRNP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6J3	Uncharacterized protein	0.717	98-105	KSRRGRKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB82	RNA polymerase II transcription elongation factor Rtf1p, putative	0.982	56-88	KESPPRKSREMARKGVAKSVKASKPARRNKQKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB82	RNA polymerase II transcription elongation factor Rtf1p, putative	0.687	234-244	EQKGKRDEQRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ15	40S ribosomal protein S30	0.97	46-71	GKVKAATPKVDKQEKPKQPKGRARKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKU0	Non-specific serine/threonine protein kinase	0.65	138-144	RAKPVRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLM8	Histone-lysine N-methyltransferase (Ash1), putative	0.986	804-862	KVRIRFKATARRSTSFKKGTQTLKAKSPAKKTPLKKTPSKKTPIKTPSGSVKSRAALTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLM8	Histone-lysine N-methyltransferase (Ash1), putative	0.842	646-671	PRPKGREIRESKAEQKKVALQKKAKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLM8	Histone-lysine N-methyltransferase (Ash1), putative	0.668	375-380	AAKRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW4	18S rRNA factor 2	0.865	245-257	VEGIRKKREDKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW4	18S rRNA factor 2	0.674	90-98	KPLNKPPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTB3	Uncharacterized protein	0.675	158-162	RKRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTB3	Uncharacterized protein	0.631	131-134	RGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVB3	Uncharacterized protein	0.998	279-311	RKSAKKKKKISARAIKKRATAEEKKAERKRLKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUM6	Uncharacterized protein	0.98	25-41	GGRKNSGKRRLKGKKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUS6	Uncharacterized protein	0.901	122-132	KKKKEVKKARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWJ0	Conserved lysine-rich protein, putative	0.829	245-262	KKEEKKDDKKSRSQSRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWJ0	Conserved lysine-rich protein, putative	0.704	337-345	AKPAAKPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWJ0	Conserved lysine-rich protein, putative	0.637	464-468	RKPSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYG5	DUF4604 domain-containing protein	0.838	150-163	KPSTKPSAKRKKIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYG5	DUF4604 domain-containing protein	0.791	122-128	KKRRKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZB5	Replication termination factor 2	0.945	197-213	AHSLKKLSGSKKRKKHA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZQ0	Integrase catalytic domain-containing protein	0.92	1142-1167	PRRRIPSKRARSPEIATSKAERKRHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M256	Uncharacterized protein	0.996	14-38	KLKLKGVKDGRVDKTKKKKKKHHKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M256	Uncharacterized protein	0.699	108-118	RKKRLNDRLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5D1	Fungal_trans domain-containing protein	0.67	29-33	LRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M986	Uncharacterized protein	0.997	409-421	HKRRKRKKKKRHT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAT5	F-box domain protein	0.925	15-27	KSAGKKKKEKRFR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDP2	Uncharacterized protein	0.987	250-280	RGKGGRKKKGNLKNLGSYAKKGKGNGGKKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH3	Stress activated MAP kinase interacting protein, putative	0.818	127-138	HHGKSARKNRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRC5	Uncharacterized protein	0.931	166-184	AKRSTKKKRPVMIAGKKHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS81	Uncharacterized protein	0.7	30-46	RRKRQNRLNVRAYRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTW9	Membrane bound cation transporter, putative	0.991	359-373	KRIRRALRKKRRRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTW9	Membrane bound cation transporter, putative	0.77	453-461	KKRKPRYTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU81	SANT domain-containing protein	0.912	572-587	DKRHKSQTKGRRKPRT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW34	Uncharacterized protein	0.865	134-145	SPSPRPRRRKSL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW34	Uncharacterized protein	0.771	160-198	KAARDRSRDRDHDSDRGRSRKYRSYSDSRSRSRGHRAKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0R5	tRNA-dihydrouridine synthase 3	0.777	369-378	KKQKRSKEKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2T6	Hsp70 family chaperone Lhs1/Orp150, putative	0.966	944-972	SSSKKSEGKKKDNGKTKSKSEKTSTKPKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6P1	Ribosome biogenesis protein Ssf2, putative	0.991	365-393	NRRRKEKEERKKQQRANIEKKKQDKAKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M808	PHD finger domain protein, putative	0.988	624-640	LSHGKRKSKPKKRAPGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M808	PHD finger domain protein, putative	0.964	194-223	KARSRRGGPVINPEKEALQPKKEKKRGNKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M808	PHD finger domain protein, putative	0.881	603-613	ARRKKRPAPGP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M808	PHD finger domain protein, putative	0.867	132-146	PAKRSRGGRKAEKGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M808	PHD finger domain protein, putative	0.819	437-447	KGRAKITRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB96	Uncharacterized protein	0.945	24-49	MRSRGRGRGGFGRGSNRGRGRGHGRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB96	Uncharacterized protein	0.795	109-122	RRRNKKPANTQSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB96	Uncharacterized protein	0.638	388-391	PKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBN2	3' exoribonuclease family protein	0.867	29-41	EKAERPRRARKPT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCD2	Uncharacterized protein	0.773	319-328	RRRSKRIAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCG2	Fungal specific transcription factor, putative	0.658	50-54	KKRHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCR9	Gag/polymerase/env polyprotein, putative	0.743	96-112	KKKPSVRIVKTASRKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME74	C2H2 transcription factor (Seb1), putative	0.666	390-399	KKRSGASSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MII2	Splicing factor 3b, subunit 2, 145kD	0.93	10-22	KNQLKRARRKAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MII2	Splicing factor 3b, subunit 2, 145kD	0.876	547-559	KRIRKEEERRGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MII2	Splicing factor 3b, subunit 2, 145kD	0.697	115-119	KKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJS6	Pogo transposable element, putative	0.694	461-469	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKX2	Signal recognition particle subunit SRP72	0.995	556-615	ARKRAAKEQQNARAKKRIRKSRLPKDYDPSKKPDPERWLPLRDRSSYRPKGRKGKQRAAD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKX2	Signal recognition particle subunit SRP72	0.969	636-649	GGGSTLAKKKKGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKX9	Uncharacterized protein	0.961	15-44	QRKLEKQKALKKGKAEAVARRNEKLARRNP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQQ0	Uncharacterized protein	0.93	30-45	QLKTRGRKPRAKNPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRB7	Uncharacterized protein	0.886	77-97	KLLARFRDDAGKKKPVEKRKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTD2	Uncharacterized protein	0.704	405-412	KRNPKKHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU49	Pogo transposable element, putative	0.684	471-483	KQAKEAEKVKRAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU49	Pogo transposable element, putative	0.675	410-415	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTU4	DNA mismatch repair protein (Mlh3), putative	0.79	388-394	PRKRKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUN4	C6 finger domain protein	0.874	17-31	GRARPRPKKLYHKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUP1	Uncharacterized protein	0.868	258-269	ALKPKNKHKRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ7	Sec2p domain-containing protein	0.799	257-268	EKRDGEKRKRLD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYS3	DNA repair protein REV1	0.975	909-934	RPVRAAPFLKRPTTPIKKRRGRPPKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYS6	Transcription factor TFIID complex 145 kDa subunit, putative	0.678	1032-1042	KERRFAREKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ96	Chromo domain protein Chp1p, putative	0.972	128-139	ERKRRRREKRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4S6	SAGA-associated factor 11	0.941	256-279	KKKKPNTPKKLGTNKPAPPSKLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4S6	SAGA-associated factor 11	0.601	162-162	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5C8	Uncharacterized protein	0.948	9-34	KAEKLAAARKRVAQMQKQKGKKGAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5J3	PARP-type domain-containing protein	0.98	228-250	AKKVRGKAATTNSEKPKRGRKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5J3	PARP-type domain-containing protein	0.966	138-203	KSKKRSRADVEEEAHSKNTKKTKGKPAAQEEAPEERPAKRSRARKAVEEATATQPEKPVKKSRKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7K1	Stress response protein NST1	0.999	552-690	SAKKAREAQKKKDRKKQQKQAREEEKARKDAEKAAEEAAARALEAKKLEEQKRKKEELRKKKEAEKKAQEEERLRKEAEKQKRLQEERERQAEIERKQKEQKERERKKREEAKRKEREEREAKEKELRDKKAKEEQERK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7K1	Stress response protein NST1	0.913	134-143	SKSKKKKKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7K1	Stress response protein NST1	0.826	59-67	RKKQKRRQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9I6	Glyco_transf_28 domain-containing protein	0.699	734-741	KKNKGKHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIT3	DEAD/DEAH box helicase, putative	0.873	636-646	RRKKKEEKMRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIT4	Uncharacterized protein	0.856	332-342	KERRKRRHFVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ26	Uncharacterized protein	0.945	146-173	TDGKTAMSKRMLKRKEAERLRERQKKGL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ26	Uncharacterized protein	0.754	126-135	RRKKQAKKLN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRZ8	Uncharacterized protein	0.974	58-79	GSKVKPVQRKRRRPLAAKKAIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUW8	Uncharacterized protein	0.86	110-122	KRKNNKKNKRQVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUC3	BZIP transcription factor (MetR), putative	0.825	199-217	KRRRNTAASARFRVKKKQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUW7	RNase H domain-containing protein	0.84	311-330	SWDRQKAGKPIKKLINKPSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWP2	Steroid alpha reductase family protein	0.903	282-300	KKKERRYRKEFGDKYKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXQ0	Histone deacetylase	0.622	710-715	RKPSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY49	Uncharacterized protein	0.729	33-40	PKRRGRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZB0	Uncharacterized protein	0.797	69-80	KPAKPKKANGKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH9	DNA polymerase V, putative	0.831	294-304	SKKEKKDKKAE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0R2	40S ribosomal protein S25	0.946	8-23	GKKQKKKWSKGKVKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M690	Pogo transposable element, putative	0.701	471-479	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF60	Ribonuclease P complex subunit Pop2, putative	0.927	280-293	LSKREMKRRAKKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIX8	Uncharacterized protein	0.955	198-218	KADGKRVKKDPKAKPSKEERK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIX8	Uncharacterized protein	0.86	366-388	KLQKRKAQALEEGKAPVKSTKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIX8	Uncharacterized protein	0.742	344-353	GQGKKTKKIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLD9	USP domain-containing protein	0.904	540-560	PKKARTRAKSEAAGGKKRSTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLD9	USP domain-containing protein	0.638	515-520	KGRAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLD9	USP domain-containing protein	0.61	465-469	KPGTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMP9	Uncharacterized protein	0.638	226-236	RKHPLRSALKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW6	DDT domain protein	0.95	678-702	MERKRRREAEKERREQLAKQPKGSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTJ5	mRNA (guanine-N(7)-)-methyltransferase	0.998	770-790	KSSSRRKSAAKKKRKREKKTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTJ5	mRNA (guanine-N(7)-)-methyltransferase	0.988	184-273	QHHSKRRRREERPQRTPRREGPSAYSRRDRSPQGRSRESRNSRSVSPVRRAADFRRSRSPLPRERSVTPEAEARQRKRPGGGARLGTAGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVC4	RING-type domain-containing protein	0.842	93-101	RPRRRRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2L5	Phospholipid-transporting ATPase	0.67	199-209	KKKSSGFRFGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y0	Histone deacetylase complex subunit (Hos4), putative	0.992	644-675	KYKGMKKARKAEAKSPKRSREQEKSSKKPARQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y0	Histone deacetylase complex subunit (Hos4), putative	0.896	954-1038	RKERDARKAQEEEEKKAAEQLEKERVAKEEKAARRAEEQARIAREQGEEEERKRKEVEQRRARQQEEERQRRAEQERLRIAKLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y0	Histone deacetylase complex subunit (Hos4), putative	0.83	821-856	KLKRPRNSVSPERSRSRGSERGRAFEDISQKKKRRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y0	Histone deacetylase complex subunit (Hos4), putative	0.773	767-782	KRRRLIAGRPPDRDRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y0	Histone deacetylase complex subunit (Hos4), putative	0.754	442-451	AKANPPRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y0	Histone deacetylase complex subunit (Hos4), putative	0.643	112-115	RKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M779	Nucleolar protein 58	0.999	456-505	KPKKAKKEKESKDKENKKDKKDKKDKKSKEEKKKRKRDSEVGSSKKKSKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD72	Response regulator, putative	0.601	249-249	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME63	Uncharacterized protein	0.729	174-187	RRSHSSRRGHRHSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET1	ATP-dependent RNA helicase DBP10	0.998	865-945	KQQAPKQLDKLRGDYEKKKKKWDAAKEAAAAAAGGNEGGRKAKNEIRNNEDIRKARNLKEKRREKNARPSKKGKGGFRGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET1	ATP-dependent RNA helicase DBP10	0.97	355-371	KGKRNKKRKRSDSNKPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET1	ATP-dependent RNA helicase DBP10	0.673	828-833	KKGKRM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGZ6	Chromosome segregation protein Spc105, putative	0.923	158-184	KEREERERKEREKKAILEQREARRKSM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGZ6	Chromosome segregation protein Spc105, putative	0.71	837-845	KKRKVGTRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGZ6	Chromosome segregation protein Spc105, putative	0.651	665-669	KKPRT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ03	Molybdenum cofactor sulfurase, putative	0.786	191-202	PKKWAKRIRQKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKD5	Eukaryotic translation initiation factor 3 subunit J	0.825	58-74	AKAKAEAEAAAKKKSKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKD5	Eukaryotic translation initiation factor 3 subunit J	0.718	231-239	KGSKKSKAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MML1	40S ribosomal protein S9	0.907	167-179	GRPGRVRRKKARA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNG7	Eukaryotic translation initiation factor 2A	0.981	548-564	KSAAKNKKKREAKKAKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNG7	Eukaryotic translation initiation factor 2A	0.631	591-595	RSKSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV15	MYND-type zinc finger protein samB	0.604	1193-1193	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVH8	Uncharacterized protein	0.865	66-88	KTSKRDRSPEPSPISRKRQRKLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV45	Uncharacterized protein	0.97	387-427	RRSKHSRHSRHSRHSSSKGSNSKSTTGESKKKKSEPKRSSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW04	Uncharacterized protein	0.71	403-419	KRDPSAKGIRERRIENR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU6	DUF814 domain protein, putative	0.996	1084-1111	GAGKADRGGKGKGGGGGGPKGGKGGKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU6	DUF814 domain protein, putative	0.911	836-846	LRGKKGKAKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU6	DUF814 domain protein, putative	0.673	893-903	KQRRRAQHERA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU6	DUF814 domain protein, putative	0.605	193-193	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0U5	5'-3' exoribonuclease	0.958	413-446	RRRRQAEERKAANEQRRKEEEKARNAERSQKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2H8	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.964	562-583	EKSSRGRKRKHEGDEPRSKRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2H8	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.944	181-226	ARRGERRRTQEKAPRPAAVKTHTTTVRSGSQKRGPGRPPKRTREVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2H8	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.895	272-289	AKRKGRQPKSVSSRRKHN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEV8	Integrase catalytic domain-containing protein	0.837	318-336	RRHGHPRAKMLQRIKKKLE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEV8	Integrase catalytic domain-containing protein	0.804	1091-1099	SRKKHKKLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFG6	Transposon, putative	0.891	462-472	KEKRKRQRSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG36	RNA helicase	0.741	579-589	PKQANRFKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG36	RNA helicase	0.669	42-51	PKKQKTAHRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG36	RNA helicase	0.624	15-18	KIKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHW2	Zn(2)-C6 fungal-type domain-containing protein	0.881	61-72	PRKKRPHSKSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJP1	Uncharacterized protein	0.974	47-88	RERRDRKNQEKRESRIREREAKKQQKELEKEQRRIARETKRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTL7	RNA helicase	0.992	12-41	KSRKKLKTKSGKVEKHAEDKDKKKKKDKNN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S7	Ribosomal RNA-processing protein 8	0.989	97-116	KSSKKTKNKKAKDKKKEQKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S7	Ribosomal RNA-processing protein 8	0.985	405-418	TQKKKLKNKKKKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S7	Ribosomal RNA-processing protein 8	0.875	137-151	RVNKKQKKARGEERK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S7	Ribosomal RNA-processing protein 8	0.664	387-392	NRKKAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4Z0	Uncharacterized protein	0.822	124-137	ARRRPHRIDNRRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAK9	60S ribosomal protein L8	0.934	17-44	RRFRPPKGKKVAPAPFPQGKAGANKKTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAK9	60S ribosomal protein L8	0.688	123-132	KAEKKERLHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAK9	60S ribosomal protein L8	0.616	269-271	KKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAK9	60S ribosomal protein L8	0.602	141-142	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBJ6	60S ribosomal protein L4, putative	0.99	186-208	QKSRKSRAGKGKMRGRRFRQRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCY2	Uncharacterized protein	0.998	473-506	KDRKERRRLAEKRRLLEKAKMKGRKGKKATKNAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFU9	Uncharacterized protein	0.794	38-44	RQKKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG08	Ankyrin, putative	0.814	1700-1712	WKKGRELKKKQEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG08	Ankyrin, putative	0.662	1038-1044	KVRKLKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG08	Ankyrin, putative	0.661	1274-1278	KKGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIA3	CUE domain protein, putative	0.981	663-706	RSRGRGRDGTGRGGSGSGGPNRGRGGNRGRGANHRRRDQHAKKM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLW3	Uncharacterized protein	0.999	266-288	AKRKGPPPPKRKGRGLRGRGRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN80	Uncharacterized protein	0.975	629-647	PRRRGRPRGSKNKPKAYAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNR4	Cystathionine gamma-synthase, putative	0.77	868-883	KSRWGAKRRMAREDRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNU2	Uncharacterized protein	0.833	27-40	AHGKEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSB6	HTH CENPB-type domain-containing protein	0.961	519-568	RETRIREREEKRRQEELEKEQLRVAREAQKEVKRAKERPAKQVNTKKRRY
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSB6	HTH CENPB-type domain-containing protein	0.675	448-454	KKRQKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU5	DNA helicase	0.967	1261-1280	RRKATPKAAPKAKGKRGAVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU5	DNA helicase	0.765	379-391	KKLSPKKVSPKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU5	DNA helicase	0.633	1491-1496	SRARGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYU5	DNA helicase	0.631	1507-1509	RRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0V0	Phosphatidylinositol 4-kinase (STT4), putative	0.817	1583-1593	IKKSKPEKKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1Y8	RNA splicing factor (Pad-1), putative	0.988	39-115	RDRSRDRERRRKDGSRDRRRDRDDKDEDIRSEHGSANGSHRSRRRSRSRRRDRHGDRSGGDYYRGGGRARTRSRSPD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1Y8	RNA splicing factor (Pad-1), putative	0.984	118-155	RYYRPSGRSRRDQRDDDRHSRRERDGRRRSRSRGHRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4G7	ATP dependent RNA helicase (Dbp9), putative	0.997	585-620	NRIRKARERNRGKGRRGAVGKKADPLKNFNAKGRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDQ4	Membrane-spanning ATPase, putative	0.9	72-83	RGGSRRRRKQKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME22	PWWP domain protein	0.982	270-292	KAQKEAAKEAREAAKEEKKKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME22	PWWP domain protein	0.982	311-363	KKPKSTKKRKKDAGSDAEDEKPPKTPKTATKLKLSTPKDPNAEKPKTSKAKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME22	PWWP domain protein	0.843	97-116	SAKRKSVGGPSSSKKLNKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGB3	HTH CENPB-type domain-containing protein	0.833	467-480	AHGKEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHP9	Uncharacterized protein	0.708	13-23	RRKKVNTKPDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQN8	Uncharacterized protein	0.713	307-316	KEKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRJ1	Kinase	0.832	772-786	KKSKHSKKRSNGAIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU26	40S ribosomal protein S26	0.926	85-109	RVRSREGRRNRAPPPRIRYNKDGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU26	40S ribosomal protein S26	0.837	3-18	KKRASNGRNKKGRGHV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW76	SLD3 domain-containing protein	0.991	371-384	RPKKRKSKKKKLGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXU0	Integrase catalytic domain-containing protein	0.943	340-354	LKRVKKGLEKKKKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYD5	Ceramide synthase membrane component (LAG1), putative	0.949	48-67	KSGKAHHHKRRKSRSLLRRF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYD5	Ceramide synthase membrane component (LAG1), putative	0.638	429-431	KRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M202	Pogo transposable element, putative	0.979	411-462	RRETRIREREEKRRQKELEKEQLRVAREAQKEVKRAKERPAKQVNTKKRRYS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M202	Pogo transposable element, putative	0.694	341-348	KKRQKRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2P4	Signal transducer, putative	0.873	112-132	RVERKKRKAQESLRLTALRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2P4	Signal transducer, putative	0.691	299-303	ERKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2P4	Signal transducer, putative	0.654	206-212	KRKQRLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6N5	Small nucleolar ribonucleoprotein complex subunit (SOF1), putative	0.961	389-433	RRIKNYRHVPKAIKKAGEIKKEELAAIKRRADNVRKHSKKGSVPQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6S3	Mitochondrial inner membrane AAA protease Yta12, putative	0.809	64-73	DKNKKKKVEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8R0	DNA polymerase	0.861	92-104	RGKAAKRKREEEN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8R0	DNA polymerase	0.647	184-190	KTKPRMR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAT6	20S cyclosome subunit (APC8), putative	0.673	134-139	GKRKSF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF89	Pantothenate transporter, putative	0.726	475-483	EKKRVRNGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH55	Phosphodiesterase	0.834	904-920	LPRKRSRLRLAFWRRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPU9	Uncharacterized protein	0.603	386-387	RK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQA2	Uncharacterized protein	0.911	299-322	ERRHGHPRARMLQRIKKKLEKEGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQA2	Uncharacterized protein	0.857	129-143	KKKLAPKPNREKIKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQV8	DDE_3 domain-containing protein	0.962	337-349	KKRPKLRKKYKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRH1	Uncharacterized protein	0.953	21-29	PRKKRKRKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSL4	Uncharacterized protein	0.761	337-348	KKKRGSWFKRRF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT71	Uncharacterized protein	0.941	116-135	PKKNSASGSPIKRRKKSSKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVC5	Uncharacterized protein	0.839	16-34	RKERKANAKRWHARLGHPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWQ8	Small nucleolar ribonucleoprotein complex component (Utp5), putative	0.925	725-738	RRRKRKKTLSHIKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWQ8	Small nucleolar ribonucleoprotein complex component (Utp5), putative	0.923	98-105	SKKKRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWQ8	Small nucleolar ribonucleoprotein complex component (Utp5), putative	0.899	846-859	PPSKKSKGIHKSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZA5	ARS binding protein Abp2, putative	0.919	272-285	KPKRGRKRAEDKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2C1	SBP-type domain-containing protein	0.775	29-44	KKGKRNKTCRRHSRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M332	Ankyrin repeat domain protein, putative	0.93	21-42	RRRMQNRLAQRKRRLKRAQMAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4G4	Uncharacterized protein	0.848	135-155	SKRKIGSSRRRSIQASLRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6D8	Peptidyl-tRNA hydrolase domain protein	0.995	117-138	IKNALKRKRKASSMKKKRRKYR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Y2	37S ribosomal protein Rsm22	0.94	804-828	ERRKKGHNIPSWKRHADKKRIRQAV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDY2	Uncharacterized protein	0.915	3-17	KKSKSKAKADKKKNQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIY2	Uncharacterized protein	0.661	219-224	NKKNRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJS7	HTH CENPB-type domain-containing protein	0.733	411-421	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPK9	Sodium P-type ATPase, putative	0.944	232-248	SKRRPVKRGPTGKAKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPP5	Uncharacterized protein	0.998	10-118	SNKSNKSNKSNKSNKSNKSNKINRSNKINKSNKSNKSNKSNKSNKSNKSNKSNKSNKSNKSSESNRSNRAIRVTRARRSNKSNKSKKSNKGKKSNKSNKSNKSNKSKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRT9	Uncharacterized protein	0.964	83-106	PRSRHKGGRRVKLIRGRNRLWRIR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSQ1	Bas1, putative	0.944	149-168	KNRHRQLTRKRKREHRPSTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTT5	Pogo transposable element, putative	0.675	459-464	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTT5	Pogo transposable element, putative	0.648	523-531	REAEKVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSW9	Uncharacterized protein	0.924	21-39	KKTASKKSKAGPKEPKVRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSW9	Uncharacterized protein	0.914	156-170	SAKPQERKKPGRKPL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSW9	Uncharacterized protein	0.746	121-131	RPHRKGAGKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVJ2	tRNA ligase	0.639	608-613	EKKMEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M153	RTA1 domain protein	0.634	383-385	RKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M319	Sister chromatid separation protein (Src1), putative	0.627	233-236	RKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBY7	Uncharacterized protein	0.898	164-189	HRRKKKDVSKSSQHGNKGTRRLGRKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME57	RNA polymerase II transcription factor B 38 kDa subunit	0.643	223-237	KSSARRSEEERLRQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKX7	Uncharacterized protein	0.609	127-128	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLJ2	Uncharacterized protein	0.899	427-454	RRRRRDLASRREELRARRAYRNAARRLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN95	Uncharacterized protein	0.997	59-76	KPNPRGKKKKKKGHKNAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP14	Monooxygenase, putative	0.778	491-511	AGKLQKIRARFAREKVERERK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQK8	RNA interference and gene silencing protein (Qde2), putative	0.982	5-65	GRGRGSSRGGGRGGGDNRGRGSSRGGGDGRGSSRGGGDGRGGGRGRGDNRGGGRGGGRGGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQK8	RNA interference and gene silencing protein (Qde2), putative	0.677	404-412	KDKKSIRRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQK8	RNA interference and gene silencing protein (Qde2), putative	0.641	87-96	SRGGHGGRGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQK8	RNA interference and gene silencing protein (Qde2), putative	0.619	77-80	GRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTX2	Uncharacterized protein	0.951	49-82	KAKSKRDTNKQGTSKSNDTKVSKRKRGRPRVLDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LST9	Microfibrillar-associated protein MfaP1, putative	0.669	257-263	KRIKRQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTE0	Uncharacterized protein	0.997	33-59	AERAKVGRKPSRKRSKREKHRSSPAPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTE0	Uncharacterized protein	0.963	258-281	RDRRRREKKRLEEQERRQRRLQRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTE0	Uncharacterized protein	0.8	103-117	GNTLKKRLSKRSARE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTE0	Uncharacterized protein	0.781	8-18	RKGKRPRSQMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYS4	FK506-binding protein	0.802	309-320	SKKQQKKLKKNN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2F7	Hsp70 chaperone Hsp88	0.746	527-537	KKTRKVKKQVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2F7	Hsp70 chaperone Hsp88	0.721	671-683	KKRAEEEAKRKAE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8B7	C6 transcription factor (Leu3), putative	0.971	10-21	RKRKGKERRRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Q4	C2H2 transcription factor (Con7), putative	0.838	133-146	EIRKEWKARKKEEE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Y0	Uncharacterized protein	0.675	74-79	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Y0	Uncharacterized protein	0.648	138-146	REAEKVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Z0	Uncharacterized protein	0.732	104-109	SRKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC43	Uncharacterized protein	0.997	516-543	RAWKRRRREAAKEKRQRENRRKGLKGRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC43	Uncharacterized protein	0.982	129-163	RVKRGWTEPASAKKLKKQKKADKEASKTKLQPKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC43	Uncharacterized protein	0.883	59-87	LKKKLNGSILKGRKFKVEAARADPKKTKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC43	Uncharacterized protein	0.852	185-195	ASKKSKSKKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC43	Uncharacterized protein	0.654	262-274	GAKERATVKGKFR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHC1	Cell cycle control protein (Cwf22), putative	0.807	30-46	RKRSPPSRSPSPNRRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK04	Uncharacterized protein	0.996	151-165	KNKKAKKKRPQKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLP7	Exosome complex protein	1	220-288	KNSKKKTAKAKAKKRKEDAMKAKKAERQAKREAKGIPEPNSKQSRSARRKERRRKKEAKRKDQTKDKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPQ3	Uncharacterized protein	0.963	4-15	KREKKRRIRKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQA0	ABC multidrug transporter, putative	0.642	164-167	RKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQA0	ABC multidrug transporter, putative	0.607	480-482	KEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSF0	Pogo transposable element, putative	0.699	425-431	KKPKNKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSF0	Pogo transposable element, putative	0.648	489-497	REAEKVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSG3	Uncharacterized protein	0.787	212-226	PPRRQGRPRESKNKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTF9	PX domain protein	0.799	867-878	RRRRAKKQDHLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTF9	PX domain protein	0.644	250-255	LPRKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTT2	Integrase catalytic domain-containing protein	0.638	415-421	ERKADAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU13	Uncharacterized protein	0.967	403-418	KKEKQPIRRAKKRRPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWV4	DNA repair protein Rad14, putative	0.972	280-313	RREAEKKRRREVKFKQKLTDLKKRTRVEAYRRNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0C5	Uncharacterized protein	0.735	28-34	RKKRKVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0T5	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.99	345-365	KRRLKQKKKERKDGGKPRNAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0T5	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.872	423-447	RGRGRGRGGFDRGSGRGRGNDRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1C9	Ribosomal protein L19	0.967	2758-2786	RSRARELNAARRIGRHRGLGKRKGTKDAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1C9	Ribosomal protein L19	0.963	2833-2878	KRALVEHIHKAKAEKQRERILKEEMDAKRAKTKAARERRQERILAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2J5	DUF2040 domain-containing protein	0.651	192-197	KREKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3G6	Signal recognition particle 19 kDa protein, putative	0.994	253-265	EPKKKKEKKKGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAK2	Uncharacterized protein	0.614	37-39	RRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB15	Uncharacterized protein	0.803	59-68	RRRSRKKTKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBB5	C6 transcription factor, putative	0.927	52-70	RGKRKRTKPLREGLHAKLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCZ1	Uncharacterized protein	0.977	440-506	RRRRREKSSSRKKHDSSSSEGGRDRRKEESGKSLPVRKGDGESVERPRKPVAVEPPATKEPEAPPKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCZ1	Uncharacterized protein	0.96	409-424	HARRRHRRHRDRSKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCZ1	Uncharacterized protein	0.831	328-342	RHRHSSRARESRKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDC2	SprT family metallopeptidase, putative	0.922	252-268	PTPKPSRRRLIRGRKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDC2	SprT family metallopeptidase, putative	0.619	466-473	KKTAAARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJC9	Uncharacterized protein	0.722	116-125	KEKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKS2	Uncharacterized protein	0.941	1009-1019	KKKKRKDKAKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTV4	Camp independent regulatory protein	0.922	79-93	PGEKKRAMKKGNRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU37	Molybdopterin synthase sulfur carrier subunit	0.962	523-539	NNKQSSRREAKKRREKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE1	Ribosomal biogenesis protein Gar2	0.979	399-417	PKKKESKKEKSKEKVKKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE1	Ribosomal biogenesis protein Gar2	0.948	444-458	KKSKSKKSKKSVGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE1	Ribosomal biogenesis protein Gar2	0.944	185-202	PRIPDSKKAKRKIQKKLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE1	Ribosomal biogenesis protein Gar2	0.943	100-127	KSKNKKKQAVQKVEKKETKKAAPSKTKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE1	Ribosomal biogenesis protein Gar2	0.939	301-346	NRRYKRVPWNRIEKQRLERGKTRDKWAQKIEQEGKRRLAKAEKLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE1	Ribosomal biogenesis protein Gar2	0.715	6-11	KDKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE1	Ribosomal biogenesis protein Gar2	0.663	73-78	KIKPRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUU9	HMG box protein, putative	1	87-135	APKRRGRPPKSDGGETLKQRKPKKKKAKKVKKVRKLSEGALEKRREQRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV63	DUF21 and CBS domain protein (Mam3), putative	0.997	717-727	KKKRRRRKKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M011	Uncharacterized protein	0.91	143-161	PRRRHGPRTRRETRLSHKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2D6	Uncharacterized protein	0.768	189-198	SRGRRGKPTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2D6	Uncharacterized protein	0.757	277-298	SKKDKKSAAASSTTTRRTGRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4I6	Uncharacterized protein	0.743	232-242	KKRASSRRSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W3	Actin associated protein Wsp1, putative	0.753	290-303	SRRGPPPPPPSRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W3	Actin associated protein Wsp1, putative	0.752	320-335	PPREPSPPRPRFRAPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W3	Actin associated protein Wsp1, putative	0.721	467-516	PPPPPAPSSGAPPPPPPPPPSGIPQPPPPPPPPPPSGIPQPPPPPPPPPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W3	Actin associated protein Wsp1, putative	0.625	404-422	APPAPPSRSPVHAPPPPPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4Y3	Nucleosome binding protein (Nhp6a), putative	0.97	8-27	TRKTKPRSEKRKKDPNAPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5F4	Zn(2)-C6 fungal-type domain-containing protein	0.609	12-13	RR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7W3	MFS transporter, putative	0.665	31-39	PSRKEKNAS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M838	BAG domain protein	0.994	175-189	GGVKKKGNKKKKKKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAL7	Acetamidase regulatory protein, putative	0.694	52-56	RRKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAM8	EH domain binding protein epsin 2	0.712	170-180	RRPDREKRERR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRP3	Myb-like domain-containing protein	0.878	33-46	PKPRIRRSTKRPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRP3	Myb-like domain-containing protein	0.613	151-153	KHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUK0	Uncharacterized protein	0.615	434-437	RHGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV82	Uncharacterized protein	0.984	27-67	KVASRPPRRGQSLKAERKRKRTAAAAELLSEGPPPKRKREK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSY4	Ribonuclease P protein subunit	0.93	46-75	RSRRRLQRIRKKEYFYRKQRPRPLSAREKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTW8	SAP domain-containing protein	0.723	73-81	SKTKERKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUQ3	Fe2OG dioxygenase domain-containing protein	0.657	6-10	PPKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW66	60S ribosomal protein L35	0.709	88-100	KQTRAIRRRLTKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW66	60S ribosomal protein L35	0.672	108-113	KQRKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXE6	Chitin synthase	0.833	63-79	RRELWIKRKKSQKATLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYK8	BTB domain and ankyrin repeat protein	0.758	1585-1600	QGKRPTHHRPPKNPQP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYK8	BTB domain and ankyrin repeat protein	0.661	650-655	KEKRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2F8	HTH CENPB-type domain-containing protein	0.756	447-455	KEKRERKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5A4	Atypical serine/threonine protein kinase BUD32	0.874	270-279	RMRGRKRKNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5B6	Uncharacterized protein	0.767	211-217	SRKKKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBM7	Uncharacterized protein	0.87	784-793	DKSSKKRKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIB0	Non-specific serine/threonine protein kinase	0.995	671-691	KKKKRQRGQRGGKSHKRKPKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK35	Uncharacterized protein	0.649	147-153	KRLSRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKY4	Uncharacterized protein	0.863	50-58	PSRKKRRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRD8	DDHD domain protein	0.692	691-698	RRGRNKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRD8	DDHD domain protein	0.629	881-884	KKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU02	Uncharacterized protein	0.677	34-46	RKKAGRFVKVLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU98	Pogo transposable element, putative	0.857	779-792	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU98	Pogo transposable element, putative	0.675	236-241	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU98	Pogo transposable element, putative	0.648	300-308	REAEKVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWA3	Uncharacterized protein	0.793	449-458	RGRQKRKRNA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWM9	Uncharacterized protein	0.901	314-325	PVRRRKRKSAPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0H4	Integrase catalytic domain-containing protein	0.92	1142-1167	PRRRIPSKRARSPEIATSKAERKRHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4F9	Uncharacterized protein	0.998	96-121	EKRHVKRQRRERRARSKRQRRGRKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4J5	L-ornithine N(5)-monooxygenase	0.66	161-164	KRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M820	Sigma-70 region 2 family protein	0.84	56-71	TKKTRRPRTKTIKPTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9R0	50S ribosomal protein L27, putative	0.999	228-264	RKNRWLAWRKRQARAQRAAQMKSLKGKKKAGKKGKGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9R0	50S ribosomal protein L27, putative	0.626	64-66	GKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEQ3	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	0.673	90-100	VGNKDRRASRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEQ3	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	0.607	88-88	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHJ3	HTH CENPB-type domain-containing protein	0.706	41-55	RLSRRVKGIPSRSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI56	Uncharacterized protein	0.76	606-615	SSGNKRKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIH1	SAE2 domain-containing protein	0.788	470-479	KRRARAPKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML29	Translocation protein SEC62	0.972	336-349	KKKKKVKLSKKAKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLC1	Cyclin, putative	0.82	367-379	KHGKHNKNKGKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRG0	HTH CENPB-type domain-containing protein	0.779	465-473	KEKQKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSD9	Uncharacterized protein	0.954	5-19	KPKIPKRRRLLRKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU61	Uncharacterized protein	0.966	104-121	PPRRGQRLKAERKRKRTE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU61	Uncharacterized protein	0.74	129-137	GPPSKRKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU94	DDE-1 domain-containing protein	0.662	371-376	RKNKKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0K1	Ankyrin repeat protein	0.899	545-566	RKLKAKRNNKSGKDIPKNDKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6L5	Ubiquitin-like modifier HUB1	0.991	6-81	SRSPRPERRRRSRSPDYDRSRRPRNQGGFRWKGKRPRDDRNRDDDRRLERGYRERYRPQSPRRDRSRDRYGERDRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDL9	Transcription initiation factor TFIID subunit beta, putative	0.979	81-94	PKKRGRKKKADKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFS6	Pogo transposable element, putative	0.921	475-488	AHKKEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGP9	HMG box protein, putative	0.99	241-300	PPPSKRRRGGALKTPASPVSTKKASPEKKKQSTPPKKDTSSRKSIGGSTDGKRKSKKRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGP9	HMG box protein, putative	0.944	103-117	EKKKRKRAPHDPNAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP28	Ribosome associated DnaJ chaperone Zuotin, putative	0.997	291-363	RIKKFRQAKRAGKDKKRLEKEAEAKRIAEEKEKAKQEEERKKKEAEEAAKAEREANKKSKEAAKNAAKKNKRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP28	Ribosome associated DnaJ chaperone Zuotin, putative	0.901	257-272	RHVERKNANSRRKKKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP28	Ribosome associated DnaJ chaperone Zuotin, putative	0.856	121-136	KRAHRKKVLRHHPDKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS06	HTH CENPB-type domain-containing protein	0.883	465-478	AKRKNNKKTKRQVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS06	HTH CENPB-type domain-containing protein	0.724	41-55	RLSRRVKGIPSRSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS54	Uncharacterized protein	0.994	130-182	REAKRKEAEARAEKRKSKLENIKDELRNKKKKRSNDGPTEDKKSTSKPREKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS54	Uncharacterized protein	0.989	27-62	KVNKSKSKSKSKRPSPKEVKSQSRSAPNRQKKTKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTR2	Uncharacterized protein	0.696	394-403	KSGSPRLRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTZ8	Intu_longin_1 domain-containing protein	0.959	336-347	GRSRRRRRPKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUF3	L-ornithine N(5)-monooxygenase	0.644	567-570	RRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUK8	18S rRNA aminocarboxypropyltransferase	0.901	5-26	KKDNFARGGKKSGPPRHRPSPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW87	Origin recognition complex subunit 1	0.954	74-89	RRRSGRPNKKRKIVGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4W0	Apple domain-containing protein	0.622	450-457	PPKSDGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5I3	Uncharacterized protein	0.718	499-505	AKRSKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH42	mRNA export factor mex67	0.788	10-25	SRPGGPSRGGIRKRGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLE8	Glyco_hydro_63 domain-containing protein	0.827	932-947	NRPPKGNRRPGRFLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSD2	SNF2 family helicase/ATPase, putative	0.86	319-357	KPKGRRLMRGPRPGATSSEASPAPEAAPKPKGRLIQRKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSD2	SNF2 family helicase/ATPase, putative	0.783	442-450	KKSRRPRKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVB1	Helitron_like_N domain-containing protein	0.777	105-120	RRRREQDRRAHRAARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZD4	Uncharacterized protein	0.781	114-127	KTKHRGSSTKKPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8D1	Histidine kinase	0.88	78-89	KRPRRSRRLKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCZ2	Uncharacterized protein	0.656	418-424	SRRVRRM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHI7	HTH CENPB-type domain-containing protein	0.878	460-473	RAAHEKEKQKRKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIA9	Uncharacterized protein	0.649	19-23	KERRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJP8	Dimer_Tnp_hAT domain-containing protein	0.624	200-204	RALRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJR3	Uncharacterized protein	0.779	92-100	KEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKT9	Mitochondrial distribution and morphology protein 34	0.992	351-371	SGRHPRPHGKKRKKRVVDLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLG6	HLH transcription factor, putative	0.943	327-354	PRLKKARGVSGGKARRGSSENASKRPKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLG6	HLH transcription factor, putative	0.713	306-312	RPRKRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW3	60S ribosomal export protein NMD3	0.946	416-430	ARKKKPKSRNWKLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQF8	Chitin synthase activator (Chs3), putative	0.952	673-691	AKSKKKGDRRPSDGKKDKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRQ1	Fermentation associated protein (Csf1), putative	0.928	569-587	IRSASKLKKQKSKRQLRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVN9	HTH CENPB-type domain-containing protein	0.833	449-462	AHGKEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWD1	Formin binding protein, putative	0.889	277-286	KRRKNKASKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXR2	C6 transcription factor, putative	0.66	54-59	KRGGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M052	Uncharacterized protein	0.836	142-166	KQERAQIRQKKRDEREKQAAEKERQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGJ5	Fungal specific transcription factor, putative	0.944	571-580	PKRRSKRRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGP6	RING finger domain protein, putative	0.85	422-435	REERARRLRRYRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHE8	60S ribosomal protein L29	0.916	14-63	KKAHRNGIKKPKTYRYPSLKGTDPKFRRNHRHALHGTMKALKERKEGKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPS9	Transposase, putative	0.963	1137-1151	PRRRGRPRGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ92	Rho GTPase activator (Lrg11), putative	0.702	836-843	GKKVGKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRA4	Ubiquitin C-terminal hydrolase family protein	0.797	10-23	KRGERHRRSGKHEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRA4	Ubiquitin C-terminal hydrolase family protein	0.748	635-648	PRRSKESRSRSRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSP8	Cytokinesis protein SepA/Bni1	0.891	1598-1612	KDQRDRRRRARLKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSP8	Cytokinesis protein SepA/Bni1	0.753	1695-1712	RRRRESAEDERRARRLRM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT27	Uncharacterized protein	0.886	69-92	KVKKTFAERTIEKRKRAFGKGLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVP1	Calcium channel subunit Cch1	0.795	40-56	RRGRRRSSGARSGHGPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0A5	Uncharacterized protein	0.733	756-763	RLRGRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4R2	F-box domain protein	0.724	238-246	PKRRSREPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6H7	Uncharacterized protein	0.792	31-44	PGKRKRASTPEGKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M973	Uncharacterized protein	0.797	236-242	RRRRKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCX0	RAS small monomeric GTPase (Rsr1), putative	0.867	192-206	ASGNAKEARRRSRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNZ4	MFS transporter, putative	0.829	302-311	AARRKKRQAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQI2	Protein phosphatase PP2A regulatory subunit B	0.625	412-414	GKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRF1	C6 transcription factor, putative	0.928	120-132	RERKKRGKASKKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTG8	MYB DNA binding protein (Tbf1), putative	0.621	726-729	REKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVD6	U3 small nucleolar RNA-associated protein 25	0.946	4-28	PRKRGRGSFRGSSRGARKPGNARGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVD6	U3 small nucleolar RNA-associated protein 25	0.805	102-110	HARKRRKLD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVJ4	Aquaglyceroporin, putative	0.946	601-626	TKRSLKKSRAKWSRRLHLTPKEAKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVW3	Uncharacterized protein	0.75	26-32	RRRRKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW68	SIR2 family histone deacetylase (Hst4), putative	0.982	467-512	GKPVNQKRPVAKKPAAKNPAANASKKPGRPPREQSAKINKYTKVTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW68	SIR2 family histone deacetylase (Hst4), putative	0.921	60-78	RARASSEPAKKRRRVGPPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYE8	BRCT domain protein	0.761	646-656	GSRRRRPNLGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ95	DDE_3 domain-containing protein	0.881	73-86	RVSKKSDKRGRPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M154	Longevity assurance factor, putative	0.949	21-56	RQVDKKKPSTEIAKPPNEKSNIEKIRRRKYRPVWKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M301	Sister chromatid cohesion protein	0.955	1731-1758	KPMKRKSSVNGGTPAKRPRGRPVGSKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M301	Sister chromatid cohesion protein	0.655	560-565	KKSRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGR1	Peroxisomal ABC transporter (PXA1), putative	0.725	62-77	RSKERAQGRRMLRRNS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH98	Uncharacterized protein	0.854	109-121	RKRRARRAGNGAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH98	Uncharacterized protein	0.656	404-409	GRKTRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIH7	Uncharacterized protein	0.863	236-248	PAPKTRRNKRKAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIV1	Uncharacterized protein	0.876	412-437	RSRVKKQAKRRDMSDSMRKRWKQLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIV1	Uncharacterized protein	0.618	643-645	RKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIV4	Translation elongation factor eEF-3, putative	0.998	1032-1057	KKKAKLSAGELRKKRKERMARRKRGE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ31	Uncharacterized protein	0.951	22-42	RRRRQNRLHQRAWRRRKKLEH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK79	Amino acid transporter, putative	0.883	339-350	MKRRKHKERAPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW8	BZIP transcription factor HacA	0.925	49-103	KKPVKKRKSWGQELPTPKTNLPPRKRAKTEDEKEQRRIERVLRNRAAAQTSRERK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP48	Cell cycle control protein (Cwf26), putative	0.969	72-81	RPKKKRKKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP48	Cell cycle control protein (Cwf26), putative	0.652	136-139	KKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPG4	Pogo transposable element, putative	0.701	471-479	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT88	Uncharacterized protein	0.906	304-337	KRVAKPEPPRGPKLGGSRSARAAMREMQEKGAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVP7	Cell wall biogenesis protein phosphatase Ssd1, putative	0.837	471-481	KREKEEKKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZF3	SWIM-type domain-containing protein	0.891	55-81	ASRRRLSLRANRRHEGEGRWGRARRGN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M026	ULP_PROTEASE domain-containing protein	0.751	83-89	PSKRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1M7	CorA family metal ion transporter, putative	0.959	634-648	SRKHRQERKRERRNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1M7	CorA family metal ion transporter, putative	0.848	269-279	WSRKRDRKKVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6V0	Leucine Rich Repeat domain protein	0.822	14-31	RHRSPAKAPEHPFRKPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6V0	Leucine Rich Repeat domain protein	0.792	84-95	AKDAKRKRADFK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9H4	Uncharacterized protein	0.667	415-420	RSKRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Q1	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.82	78-88	RRSNKRGGKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEI7	Uncharacterized protein	0.999	49-83	REKKAKQLREREKRKLANKKKRAEKEAKQREERRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK85	Pyruvate carboxylase	0.697	979-987	ALRNRRKLD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKI0	DNA replication regulator SLD2	0.97	535-589	KKNTKKPVTKKDEDDKQKASPKKRKVNPDAHANYRSLKIRSKGQGRFGRGRFGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKI0	DNA replication regulator SLD2	0.855	402-426	VWKKKGQKRTTRLVKMKPVMQVKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKV0	Pogo transposable element, putative	0.701	463-471	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW9	PHD finger domain protein, putative	0.973	151-177	KRKAGLKPPKPPAKETKANNKNKAAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT40	Nucleolin protein Nsr1, putative	0.978	29-57	PSQSPKAKSKEIARKLKTKGEKAALKKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT40	Nucleolin protein Nsr1, putative	0.952	423-455	RGGRGGRGGFGGRGGGRGGQRGGRGGFGGRGRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT40	Nucleolin protein Nsr1, putative	0.765	89-101	KETKKPGKAAAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT40	Nucleolin protein Nsr1, putative	0.641	207-210	KKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWQ9	Transcription regulator BDF1, putative	0.999	613-651	KKKKTPPASKKSGKSKSGKKDSKKSKGDKKSKSSRPEKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWQ9	Transcription regulator BDF1, putative	0.828	427-449	RPKRAIHAPKRDLLYSAKPKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWQ9	Transcription regulator BDF1, putative	0.811	372-386	KKPKKAALPPKESAS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1K8	RED_N domain-containing protein	0.992	534-550	RGGNKRKRGPKKRKGDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1K8	RED_N domain-containing protein	0.711	219-226	KEKKVKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3W7	C2H2 finger domain protein, putative	0.959	19-32	SESKKRKRNRKAQP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M704	Autophagy-related protein 26	0.689	307-314	KRGRKNPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M790	Uncharacterized protein	0.975	951-967	AGKKSNVKARKKKRAAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9D1	C6 transcription factor, putative	0.703	52-57	RRRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAZ6	Uncharacterized protein	0.995	37-57	KKIGKPTPKKAVKKPPKKKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBA7	zf-LYAR domain-containing protein	0.995	241-273	PKKKEKKHKKKDIERSSPDLEPRKTSDKKRKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR51	Proteasome regulatory particle subunit Rpt2, putative	0.959	22-49	SKKDKPKYEPPPQPTTRLGRKKRKAAGP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRY0	Pheromone-regulated membrane protein, putative	0.911	287-298	GKSGKKAKKRLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSZ9	C6 transcription factor, putative	0.632	62-64	RRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU05	40S ribosomal protein S24	0.997	98-133	AAKIEKASRQQRKQRKNRSKKFRGTAKTKGPKKSKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVG0	Uncharacterized protein	0.969	647-668	NPGGKRQNPPKSKKAGNPKKGN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVG0	Uncharacterized protein	0.624	633-637	KKRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M043	UPF0023 family protein	0.966	228-249	PKEESKPSKGNNKKGQKGKGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M173	Lipase/esterase family protein	0.915	679-711	RTSRKRSISKPDRGKLAPPPADERSRSRPRNRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9C0	Uncharacterized protein	0.891	128-143	KRLKRKLRRYKERDPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC58	Uncharacterized protein	0.868	166-174	RRRRKRLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCK6	Nuclear protein (Sgd1), putative	0.985	26-55	GEKKRNQNRVVSRKERRKEERHEKKHHHRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCK6	Nuclear protein (Sgd1), putative	0.902	166-182	KKRKREEREWLQRKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFL9	U2 snRNP auxiliary factor large subunit	0.992	75-132	EREWDRDRGDRRRREHDERPPRRERGDRGDLFEDRPRRREREGRDRERRRSATPPKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFL9	U2 snRNP auxiliary factor large subunit	0.973	21-47	ERRDRGERDRGERRRSRSPHHGRGSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJN4	Uncharacterized protein	0.854	89-99	KRKAAKRTKRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKJ9	C6 finger domain protein, putative	0.664	114-117	PKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLA5	Velvet domain-containing protein	0.956	311-327	KPRDGKGKGVAKKGKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR60	GRAM domain protein	0.678	71-75	RRKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR60	GRAM domain protein	0.639	1218-1221	RKRN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR60	GRAM domain protein	0.632	1077-1082	SSKSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU48	U3 small nucleolar ribonucleoprotein protein Lcp5, putative	0.949	308-326	PKESKKERAKRRAAEGPRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU48	U3 small nucleolar ribonucleoprotein protein Lcp5, putative	0.901	384-395	EKRRKKVEGWKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU48	U3 small nucleolar ribonucleoprotein protein Lcp5, putative	0.773	346-366	RLTKRSAGSRAGALEKSRKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV54	Telomere-associated RecQ helicase, putative	0.636	366-371	PRGHKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW40	Cell cycle control protein (Cwf4), putative	0.799	624-631	RRVKKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW40	Cell cycle control protein (Cwf4), putative	0.678	572-577	KRRARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2V3	RNA helicase	0.999	774-833	KKEKRKLSGKEKKRLDDTRDRKEGRMWKKGKKERESNIAPPKKGSGKKGGNKMKGKKGRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2V3	RNA helicase	0.977	154-173	RRKQRKEEEIERKKRKAERK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2V3	RNA helicase	0.879	46-77	SKKRKREQNATSQPSKQTKKQKKQEQKQSKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Y9	Uncharacterized protein	0.903	171-187	NEGGPLRGRQKRKRNAS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Y9	Uncharacterized protein	0.604	193-194	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAX1	DNA mismatch repair protein	0.831	189-200	PPKGRQKKKSGS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGB4	C6 transcription factor, putative	0.741	21-26	RKRRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIG8	Cupin domain protein	0.998	411-427	EKKPGKKRKPKKSKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIG8	Cupin domain protein	0.984	611-630	AAPAGKGRGRGRGRGKAAAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIG8	Cupin domain protein	0.869	303-320	NDQRPAKKAKSSKAEPKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIG8	Cupin domain protein	0.653	284-288	KRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJX3	Uncharacterized protein	0.797	64-75	KRRKAGSKESGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLB0	Uncharacterized protein	0.602	38-38	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMV8	Proteasome regulatory particle subunit (RpnE), putative	0.683	205-211	FARKPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MND5	Uncharacterized protein	0.928	32-53	ERRRRQTRLALRALRKRKAAQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPI7	Cytochrome P450, putative	0.756	267-279	KKTERAKSLRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTA9	Pogo transposable element, putative	0.701	440-448	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTI6	37S ribosomal protein S5	0.865	39-55	RKPPGPRPTAKKPGQKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTS6	DNA-3-methyladenine glycosylase, putative	0.925	29-63	KSSKSKNKASKENGITKEQKESPTRKAQKKTKKEA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXZ9	Translation initiation factor 4B	0.97	361-392	KRERARKEAEEKAKAEKAEKQRQSKEKAKAEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0W1	Reverse transcriptase, putative	0.694	1064-1072	PRRGPRQRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2I3	Uncharacterized protein	0.819	20-35	KSKSLSGPGKKEKPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2N3	Siderochrome-iron transporter MirC	0.978	255-270	RKAKRLRLIKKKHRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDW7	C2H2 finger domain protein, putative	0.856	461-482	RKLLPKRSSSSLKDKKRHSRQP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDW7	C2H2 finger domain protein, putative	0.607	495-496	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIA6	Structural maintenance of chromosomes protein 4	0.98	55-86	RKPIPRRGGRRKALEAPSQPSKRSTRGGRRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIA6	Structural maintenance of chromosomes protein 4	0.754	142-151	KRKRAASSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ45	Reverse transcriptase family protein	0.922	964-990	PRRRIPSKRARSPEIATSKAERKRHRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKU9	Mediator of RNA polymerase II transcription subunit 20	0.99	273-293	AQRRQPGWQEREKRRRKKRRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNV7	Transcription initiation factor IIF subunit alpha	0.961	21-52	KIRRPRAADPLVRPKKRPLPGRPAANPAAAKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNV7	Transcription initiation factor IIF subunit alpha	0.95	410-431	EKKEREARKVLGKKVRKALQRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNV7	Transcription initiation factor IIF subunit alpha	0.711	477-513	EKEKEKESGASTKASTPSGRPKHTDALKKTSGIGRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNV7	Transcription initiation factor IIF subunit alpha	0.652	530-533	KKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSL8	Pogo transposable element, putative	0.954	421-431	EKEKKKRKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTT1	MULE domain-containing protein	0.773	517-528	PKAKRSDKKGGN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV19	Uncharacterized protein	0.872	183-199	IRHLSKKYHLKKKGRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV19	Uncharacterized protein	0.79	135-147	RRGKGGRRLRGIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUD2	Ribosome biogenesis (Nop4), putative	0.996	631-679	KRRKEFQERARNKQEEGAEKGGDNGKRGMKRKRPEGRPNNKGDKTKDKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUD2	Ribosome biogenesis (Nop4), putative	0.989	691-715	KNKIAKRNRIIARKRQQRRQRKGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUD2	Ribosome biogenesis (Nop4), putative	0.806	543-554	KRRREKGKGIVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVP3	60S ribosomal protein L6	0.742	36-47	KKVRKTARPAKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M244	Uncharacterized protein	0.958	7-22	KPGKSKGKPKPAKKQQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2H6	Nuclear RNA binding protein, putative	0.825	523-538	KRLRNKLKSGRDKRAS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M509	G domain-containing protein	0.842	366-375	RRIRPRGKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M509	G domain-containing protein	0.603	337-337	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6R9	Uncharacterized protein	0.678	614-625	RRRNRMGQRQRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFU7	Conserved serine-proline rich protein	0.792	264-289	KKRVRPTGDGGRLRQPGPRKNSSLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGZ7	40S ribosomal protein S11	0.861	25-38	TKAKSKRVGKGGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKP9	Uncharacterized protein	0.99	396-440	RGRGGRGRGRGDNFRGRGGRGDFRGRGRGGRGGERGEFKSGRGRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLW4	Uncharacterized protein	0.954	115-125	EKEKKKRKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN67	Pogo transposable element, putative	0.779	431-439	KEKQKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSU2	GATA transcription factor (Ams2), putative	0.973	759-778	WTKQPIKDKRKRSSRPRKGP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF6	Uncharacterized protein	0.904	189-212	RRKRREYSPPERGRKRDSSTRGSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWS1	Aminoacyl-tRNA hydrolase	0.983	520-533	KIRKPKKKKAKATR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWS1	Aminoacyl-tRNA hydrolase	0.766	351-364	KKLSKKIEKERARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWS1	Aminoacyl-tRNA hydrolase	0.762	306-320	RRKRQEKNAAIKRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWS1	Aminoacyl-tRNA hydrolase	0.722	599-605	AFKKRKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWS1	Aminoacyl-tRNA hydrolase	0.696	765-774	EKRARAQRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWS1	Aminoacyl-tRNA hydrolase	0.686	852-863	KMKTEKHLKKIE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0K4	Uncharacterized protein	0.661	875-878	GKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M206	Choline kinase, putative	0.967	134-150	HRRSKKHRSRPKGLRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M245	Cell wall proline rich protein, putative	0.999	301-322	EKHTSKKSKKKKQKKRKSGGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M245	Cell wall proline rich protein, putative	0.74	391-406	PLKNKRTHVKRPLSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M245	Cell wall proline rich protein, putative	0.606	380-381	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U6	Uncharacterized protein	0.938	14-28	RKPKTRKPRPRSAGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U6	Uncharacterized protein	0.913	521-529	KKGKKKVKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G5	Uncharacterized protein	0.909	157-173	LRSRWERFCRRKRKKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G5	Uncharacterized protein	0.854	51-64	KAPRGSRRQRRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCX6	Uncharacterized protein	0.993	332-388	TKRKRADNEEEQGHKRRSKRVASSPNMKARNDKPDKKRTRAGSMASPREERGKRKKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD48	ABC bile acid transporter, putative	0.624	377-379	HKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIQ6	Pogo transposable element, putative	0.833	539-553	PSRKAVMRPKKRLLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIQ6	Pogo transposable element, putative	0.771	152-164	KRIFSRRKYKKGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIQ6	Pogo transposable element, putative	0.654	486-490	RQKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLJ6	Lysophospholipase	0.793	808-823	RRKRDRLQREKLAKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRJ2	Conserved leucine-rich repeat protein	0.871	51-113	IPKPEAPSPRIRGRITPRGAKQSQMKRGGSTTPTSARASPSPRASPSPRASRTSKSPAKPSPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTL9	HAD_SAK_1 domain-containing protein	0.97	496-525	SHRGRGRGGRGSGFGRGRGSSRGGGRGRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYT6	Nuclear pore complex subunit Nup159, putative	0.902	1438-1459	RTRRRKEIARNLKRAIGERKVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYT6	Nuclear pore complex subunit Nup159, putative	0.729	1015-1031	AKSPRSPSPVRPGARRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0N9	Ribosome assembly protein Noc2, putative	0.916	86-106	NSKGNKKQKKDVTPKIGKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0N9	Ribosome assembly protein Noc2, putative	0.88	20-48	ERRKEFAKIRQRHQINDKRKVRNAERREK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0N9	Ribosome assembly protein Noc2, putative	0.835	194-201	AKKKKKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M374	Uncharacterized protein	0.944	174-186	RKSRARQEKKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.991	614-636	KPPKKQGRKAASKGKKPAASKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.99	481-501	KQKKQTKRKATAKKSKKGKAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.948	199-214	KTKKNARAKKPRASKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.925	248-266	KKTKGTRKTTKSRAKKTKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.903	365-378	PKKGRKGAKRGTST
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.875	289-300	ARPKRATRGKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.872	663-674	KPPRRESKRKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C7	Chromosome segregation protein BIR1, putative	0.752	729-739	KSKRGRPSKQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Z2	Non-specific serine/threonine protein kinase	0.737	1005-1013	GKKRFSKRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAN0	Sde2_N_Ubi domain-containing protein	0.985	889-925	RDKRKADRRKRFTSGSHKPRRGNISHKKRTLHGAKGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAN0	Sde2_N_Ubi domain-containing protein	0.639	161-166	KEERRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBI5	Uncharacterized protein	0.678	1062-1067	ARKRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCD3	Fungal specific transcription factor, putative	0.955	862-894	KRSSIRGRHSRRLRKVMKNLKRLGINRPPSGNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDD0	PHD transcription factor (Rum1), putative	0.694	970-979	RRKNEKAWRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMT8	DNA lyase Apn2	0.915	460-480	KRTRKESAPAPPPKRSKSRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ03	Protection of telomeres protein 1	0.971	372-394	SKKNAKKRRKDQQRQKRQQEQRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQT1	Pogo transposable element, putative	0.778	380-388	KEKQKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS15	Gag/polymerase/env polyprotein, putative	0.892	14-30	HNKKDPRKKDFKKPETK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTJ7	Transcriptional regulator, putative	0.952	104-133	PSPEPPKSKMKKAVKRESEENTSAKKKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTJ7	Transcriptional regulator, putative	0.92	191-209	PKKQRPKKAATAPKARNPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTJ7	Transcriptional regulator, putative	0.663	254-260	KIKRLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXG1	Zn(2)-C6 fungal-type domain-containing protein	0.794	84-92	KRGGPRKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ84	Transposon, putative	0.733	477-487	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3A7	DnaJ domain protein	0.785	525-540	RSRSKTSPARGRPGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3A7	DnaJ domain protein	0.67	328-339	SPRSPARDRHRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5G5	Uncharacterized protein	0.934	142-166	ARGGRKNKRNLKETAKEKLLRRTKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5G5	Uncharacterized protein	0.933	266-288	RREARRQRREREERRSRQNSPRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M870	TBP associated factor (Mot1), putative	0.895	714-724	AKGRRRKSEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGM9	Ubiquitin-protein ligase (Hul4), putative	0.878	426-446	RPRRQDIKVAGPKKREKSPLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGM9	Ubiquitin-protein ligase (Hul4), putative	0.682	533-540	RPRRPLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIM4	WD repeat protein	0.936	928-943	LKRKDSPHHRPKKKHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIM4	WD repeat protein	0.75	73-81	RRPRKQPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIP6	Origin recognition complex subunit Orc5, putative	0.664	405-410	KKGKRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIP6	Origin recognition complex subunit Orc5, putative	0.619	381-384	HHRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJU1	Uncharacterized protein	0.876	331-352	RSKHQKKYERKLAKANRKVDRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJU1	Uncharacterized protein	0.75	267-287	VKKQEKRFAKQQQKAEKKQMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPP7	Metalloprotease m41 ftsh, putative	0.686	459-465	RRKEAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSX0	DDE_3 domain-containing protein	0.834	145-164	KDKRRNWKGYRLKGKLSRVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTZ6	Uncharacterized protein	0.843	493-508	KSHVKGKKESKGPSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUE2	Uncharacterized protein	0.659	280-284	SNKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUE2	Uncharacterized protein	0.605	273-273	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUE2	Uncharacterized protein	0.602	276-276	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVS4	Uncharacterized protein	0.779	65-71	RRRRPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWK9	C2 domain protein	0.634	47-49	KRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYE9	ATP-dependent DNA helicase PIF1	0.625	387-391	RKNQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYZ7	Uncharacterized protein	0.995	324-357	RKLQRKKSKKRLKPVNKSEKDACKKLPKKQRQKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYZ7	Uncharacterized protein	0.835	263-270	KRRRIRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYZ7	Uncharacterized protein	0.66	388-393	SRKLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1I3	ATP-dependent RNA helicase Mrh4, putative	0.793	80-103	RLRGEAKARSQAAIKRSSRGREGE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1I3	ATP-dependent RNA helicase Mrh4, putative	0.774	58-69	LKKKDRARSEKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1I3	ATP-dependent RNA helicase Mrh4, putative	0.681	606-613	RMGKRGRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3J9	RNA helicase	0.842	5-21	KEKKRHGGDKEKTSRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3J9	RNA helicase	0.812	125-132	LKKTKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3J9	RNA helicase	0.739	148-153	KVKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3J9	RNA helicase	0.72	170-185	KHAKLLKKFEKSIKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4H2	Endonuclease III homolog	0.669	115-123	RRQPAKRIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA83	Pogo transposable element, putative	0.954	424-434	EKEKKKRKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAR7	Splicing factor YJU2	0.886	250-267	KARKPKKPFNAGLGIKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG2	Cactin, putative	0.725	12-31	KRGRSRSQSPPWKRSEKFAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG2	Cactin, putative	0.639	84-92	KKKAEIRVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF06	Uncharacterized protein	0.946	153-167	PRRRGRPRGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFU5	Uncharacterized protein	0.942	1080-1103	PRQPMGIKKTRKSAIAPKKPRGSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGX1	Uncharacterized protein	0.633	109-112	RKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI51	HTH CENPB-type domain-containing protein	0.675	412-417	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI51	HTH CENPB-type domain-containing protein	0.612	480-483	KVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLJ5	Phosphoinositide phosphatase Pten/Tep1, putative	0.795	253-260	LEKGKKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLJ5	Phosphoinositide phosphatase Pten/Tep1, putative	0.73	108-114	KKIKKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M381	DNA replication initiation factor Cdc45	0.997	738-771	KKNEARRVKKEAADKKKKDREERREKRAAEHARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4Q8	Signal sequence receptor alpha subunit, putative	0.896	234-246	RKGKSSKEKKARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4Q8	Signal sequence receptor alpha subunit, putative	0.704	210-218	GRVSRRARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6B3	SNRNP27 domain-containing protein	0.973	54-136	RRYRSRSRDRYPRKKDRSWSRDRDRDRDGGKRDSYKDGRGMRDRDRSTSRDRHYNRRGNAKSGRPDRSRSPRNGTRSRDYPAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M876	Cutinase transcription factor 1 alpha, putative	0.697	331-338	PKEKRVRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML18	Pre-rRNA processing protein Tsr1, putative	0.9	19-50	HKPFKSKHATKSALKERTRGKIETKERGVRKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNM5	Uncharacterized protein	0.881	94-106	RPKKSRQKLRKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPQ9	Integrase catalytic domain-containing protein	0.787	20-31	KAKKARGGLKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ65	Protein required for cell viability, putative	0.93	901-927	RGSKPQTQKARREQVAKEAREKERKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRH5	Protein BCP1	0.654	210-213	KKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTM3	Transposable element tc1 transposase, putative	0.66	127-131	KKRDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUN0	Zn(2)-C6 fungal-type domain-containing protein	0.929	42-61	RPKKRRGPPNKHAEALKKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWG5	DNA replication ATP-dependent helicase/nuclease	0.826	135-143	SRGKKRRHS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWG5	DNA replication ATP-dependent helicase/nuclease	0.724	1617-1633	KIFKRESKMRTPEKRGN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX98	HTH CENPB-type domain-containing protein	0.899	280-288	NSKKPKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZK6	Uncharacterized protein	0.984	676-705	TPKSRPPRQARLDHPPRPPKRKVQKPRIPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZK6	Uncharacterized protein	0.765	372-388	SQKRRKLFHDSHGKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZK6	Uncharacterized protein	0.681	353-360	RRRTPKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M037	APSES transcription factor Xbp1, putative	0.987	609-650	ERKVSLKLARRRRKRSVHRHHHHYRQQNHLKRQQKYGAKRKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S4	Uncharacterized protein	0.95	194-225	RRPVREEIVKERIIEKEKPYPRKGKTKMPKRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S4	Uncharacterized protein	0.807	40-62	PAPLRERSRSRPPPPPPEFDRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3S4	Uncharacterized protein	0.757	137-157	RIERVPPPPVRGFRGGPPRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7S5	Ubiquitinyl hydrolase 1	0.779	1145-1157	APKPKPKLKQSVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7S5	Ubiquitinyl hydrolase 1	0.72	24-38	RRKVVEEPRRHPKAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7S5	Ubiquitinyl hydrolase 1	0.706	654-662	RGRKKDGRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7S5	Ubiquitinyl hydrolase 1	0.681	1283-1290	QRANRRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFC0	T5orf172 domain-containing protein	0.699	98-106	RRPKNARNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFC0	T5orf172 domain-containing protein	0.638	147-152	RKPTPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGH8	Ubiquitin	0.822	121-128	LRPKKKLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN94	HTH CENPB-type domain-containing protein	0.733	411-421	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNH6	IFRD domain protein	0.607	466-467	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPN0	C2H2 finger domain protein, putative	0.804	180-195	KVKRGKNGRLMKGIKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M025	Uncharacterized protein	0.866	223-236	RRSPSKRRSPERKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M025	Uncharacterized protein	0.64	450-455	RRSPRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M096	CCR4-NOT core complex subunit Not4, putative	0.922	725-735	KQKKKGKKHRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M096	CCR4-NOT core complex subunit Not4, putative	0.918	87-103	KHRKAAAAKKKEAEKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M096	CCR4-NOT core complex subunit Not4, putative	0.802	1121-1128	RKRKTKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M096	CCR4-NOT core complex subunit Not4, putative	0.693	930-938	KGAHSKKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M096	CCR4-NOT core complex subunit Not4, putative	0.669	1087-1093	KKERRLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1C8	ATP dependent RNA helicase, putative	0.791	5-11	KRKKKPA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2N0	Beta-ketoacyl-[acyl-carrier-protein] synthase I	1	580-634	QKTAKKGAVKGMADDGPKKGKKRKAADGEDEKDGKEPKKKKKKEEPKPKVPKPKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2N0	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.925	541-556	AKQEKARKKKEARDAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2N0	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.89	461-478	KPGKIKLKKQAGKGAKTG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5N5	C2H2 transcription factor Swi5	0.948	527-543	RKTTKRGRPKKSRPDME
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M780	Uncharacterized protein	0.874	234-249	NREAREAREKRRERRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC59	Uncharacterized protein	0.868	157-173	KRGSSKKGHRRENTKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEN3	MULE domain-containing protein	0.667	454-459	RSKRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFJ5	SAP domain protein, putative	0.978	196-240	RARKRGRGDDQGGRGGKRRNNGGRNRHQNNNRKGNNPTGRSNAPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGE3	Protoheme IX farnesyltransferase, mitochondrial	0.798	113-120	RRRKRLKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIL8	Uncharacterized protein	0.628	191-193	KRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJI5	Small nucleolar ribonucleoprotein complex subunit, putative	0.623	312-315	GKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK61	Uncharacterized protein	0.844	109-120	RKMRRRRGSLRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML93	RING finger domain protein (Rnf10), putative	0.946	551-588	NKRRQRNRDKEAREEKDRIRAEKEEEEKRWEAARRKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML93	RING finger domain protein (Rnf10), putative	0.857	714-723	GGGRKKKNKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLF8	Uncharacterized protein	0.855	108-129	TRQLKFKAPIELKRVKFRRRMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLN2	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.986	15-44	SRGNRSRSRSRSRSRSPNPKSKKSAPKNKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW6	Protein SSH4	0.951	49-64	RSKRNKRDSRKKREAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWC4	Glutathione transferase, putative	0.945	110-126	TPKSDDPNKKKRKRVAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX17	Integrase catalytic domain-containing protein	0.943	340-354	LKRVKKGLEKKKKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZA0	Transposon, putative	0.695	471-479	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4L2	Zn(2)-C6 fungal-type domain-containing protein	0.82	8-18	GKKGKPRGIRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M861	Uncharacterized protein	0.62	104-106	KRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBY6	40S ribosomal protein S1	0.943	5-19	KNKRLSKGKKGLKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC22	RNA processing factor 1	0.979	7-38	QVRKLQHIKRKRNESAAKHKLRHERRKEETKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCR2	Gag/polymerase/env polyprotein, putative	0.997	21-63	TRKKSDHRGRKGHGRGRGAKEGSGKDKRQVKSKRKPYRGSARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCR2	Gag/polymerase/env polyprotein, putative	0.659	333-340	RRMRRLAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCY9	Uncharacterized protein	0.83	1187-1219	KKKGGLFSRLRSPTRGSGKDGKVRKSLIESPAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCY9	Uncharacterized protein	0.722	1322-1328	GKKKRFP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCY9	Uncharacterized protein	0.606	555-556	RK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHW8	BRCT domain-containing protein	0.952	250-294	TGKKATAATKSSGLKAKPVRKAGTATRGRPPKSQAAAVKPLSPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHW8	BRCT domain-containing protein	0.813	41-52	KVEPAKRGRKPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHW8	BRCT domain-containing protein	0.703	179-186	KKPRGRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUJ5	Integrase catalytic domain-containing protein	0.898	5-16	RFKRRKRKTVRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUJ5	Integrase catalytic domain-containing protein	0.673	502-510	KDDKARKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUS5	Uncharacterized protein	0.631	165-168	KRQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYF0	NAD(P)H-hydrate epimerase	0.862	202-215	KRSTKRGKRGSRNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYR4	RNA helicase	0.971	121-158	KKQKTKKKSEYAKQKNPADEKKPAAKKEQRQPNAKGGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYR4	RNA helicase	0.883	685-702	GGKAKGRGRGGGRLQKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYR4	RNA helicase	0.719	6-19	GRESRNLAKKASKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYR4	RNA helicase	0.605	258-258	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZK1	PAPA-1-like conserved region protein	0.822	320-332	RLLKKQAPKRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZK1	PAPA-1-like conserved region protein	0.76	298-310	MARRRKNLSEKRN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M046	Mediator of RNA polymerase II transcription subunit 4	0.81	155-163	KKSKKGRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M338	Uncharacterized protein	0.759	117-136	GKRKGSREPTVPDSQRKRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5U9	tRNA-specific adenosine deaminase, putative	0.935	552-562	LKKRRRPKVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Z3	Uncharacterized protein	0.841	104-113	AGRPKRRRTG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC02	DUF2431 domain-containing protein	0.971	197-216	GGKDIRKGIPHARNKKRKRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC02	DUF2431 domain-containing protein	0.897	422-435	SRDGGKGNKKRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC02	DUF2431 domain-containing protein	0.725	5-10	KKKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFR3	rRNA processing protein Pwp1, putative	0.967	250-259	SKKKKKKFKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MND8	Uncharacterized protein	0.918	147-161	RRPPGSRRRRRVSPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNI0	Transcription elongation factor Spt6	0.987	77-91	AERRRERKKRRREER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR19	Pre-mRNA-splicing factor CWC24	0.776	18-32	KKRSSKAKSNFRKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR19	Pre-mRNA-splicing factor CWC24	0.749	314-324	EKKRERVNRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR98	RSC complex subunit (Sth1), putative	0.972	1155-1178	RKDARVERRRSNKEKRARKASGME
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR98	RSC complex subunit (Sth1), putative	0.956	1190-1207	TPQVKRRRKGLQGKRKAD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR98	RSC complex subunit (Sth1), putative	0.894	1213-1225	TPAIKRKRGKPPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR98	RSC complex subunit (Sth1), putative	0.649	377-385	ARENRDKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR98	RSC complex subunit (Sth1), putative	0.604	357-358	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRJ5	Uncharacterized protein	0.939	415-424	VPRKRGRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRJ5	Uncharacterized protein	0.896	269-277	KKKKGRPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRJ5	Uncharacterized protein	0.75	348-355	SKKKIKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV74	Uncharacterized protein	0.775	65-82	AQIRKKEREQRQREAAEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXS8	Uncharacterized protein	0.846	92-100	RPRRRRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M061	Uncharacterized protein	0.882	10-26	RRKAVKSVKPRPKPPGQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5J8	Conserved proline-rich protein	0.955	541-559	KERSRKRKPSTIEKKKGGM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8I8	Uncharacterized protein	0.998	241-259	SKGKRKKRRSIRGKRAHKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAB7	Uncharacterized protein	0.605	817-818	GK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBU3	Uncharacterized protein	0.849	8-23	KKRKRDSDRHDRPSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCH3	Uncharacterized protein	0.858	30-42	KKDKARKNRAKSG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDH9	CID domain-containing protein	0.828	96-106	SNKKPSGKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDL5	Mitochondrial export translocase Oxa1, putative	0.971	509-527	KGKEVATSKKPVKKSKARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN66	Pogo transposable element, putative	0.701	471-479	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNL6	Uncharacterized protein	0.774	120-134	RWIRRKVKGEKNVWR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTH9	tRNA (guanine(9)-N1)-methyltransferase	0.996	157-189	KRLLRQQKWDEQKEERKKRRKEKNTQRKMRKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTG4	Uncharacterized protein	0.975	61-91	KEKPKPLTEKQKKRLRMKEKYRNMPKSKSHG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWG4	Uncharacterized protein	0.923	174-198	RSRRKRSRSSSPSARPETTRKRPRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWJ8	Drf_GBD domain-containing protein	0.826	84-112	KKEGLHKKTKSSVSLRSLIKDREKKEKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWJ8	Drf_GBD domain-containing protein	0.657	369-375	RGRKDAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWJ8	Drf_GBD domain-containing protein	0.606	406-407	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ41	Mismatch-specific thymine-DNA glycosylase, putative	0.611	93-95	KPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M293	Urb2 domain-containing protein	0.705	153-158	SKKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Q8	Ribosome biogenesis protein NOP53	0.987	281-312	KKRPERKTQAQRNKIRRRKEAERNAKWEAKMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Q8	Ribosome biogenesis protein NOP53	0.816	410-418	QSKKPKRKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Q8	Ribosome biogenesis protein NOP53	0.718	20-26	RKGKKAW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M795	Golgi matrix protein, putative	0.791	11-18	KSKKNKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8X1	HTH CENPB-type domain-containing protein	0.722	466-472	AQKKIKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9T0	Phospholipase/Carboxylesterase superfamily	0.838	64-74	RRQKKKKMPPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC16	RNA polymerase II transcription elongation factor (Ctr9), putative	0.991	1036-1052	RQKRKRKASSGRRRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC16	RNA polymerase II transcription elongation factor (Ctr9), putative	0.978	1078-1097	APKRRRRLERRGGAKEKLGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC16	RNA polymerase II transcription elongation factor (Ctr9), putative	0.659	1160-1166	GRARRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD20	Sister chromatid cohesion protein (Eso1), putative	0.806	628-645	RRMLDRKKTGPGRPRVFA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD60	Uncharacterized protein	0.987	8-41	RKRSSGSSSRRKRPLRLKINPPKPPRLILKPPKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD63	Uncharacterized protein	0.877	96-115	KTSPPPPLKKEKSKSIRRSI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD63	Uncharacterized protein	0.612	618-620	APK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGH4	mRNA splicing factor (Prp17), putative	0.738	154-160	RRKRQKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML15	PtaB protein, putative	0.793	728-741	RASPKVGGKRHKGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR12	Uncharacterized protein	0.97	383-395	GRRRGKRKIMKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRA2	BAR domain protein	0.959	390-415	KKGPPPPPPSRATKPKPPPPPPPVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU07	RNA polymerase I subunit Rpa43, putative	0.991	407-423	KKKEKKSKDKSKSKRKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU07	RNA polymerase I subunit Rpa43, putative	0.985	9-27	EKKRKHKNKEHSPSKKRKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU90	Integrase catalytic domain-containing protein	0.959	1084-1100	PPPRRRGRPRGSKNKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUW1	RNA helicase	0.99	37-141	EGRTHRRSRSPDRRYRDRDRDSYRRRDRNGYRDDHNYRPLKRDRSRDRDRDRRSDRDYRRRSRDRDKSRDRDNRNRRDDSRDRVRRHRDDSTDSRRRFRRESRDR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4M2	Beta-glucosidase, putative	0.969	69-88	RKNRDKKKQQLSKRRKYRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB09	Zn(2)-C6 fungal-type domain-containing protein	0.798	9-17	GKPKRRRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCZ7	Vacuole-associated enzyme activator complex component (Vac14), putative	0.662	277-283	RIKKGIA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHB5	ATP-dependent DNA helicase	0.977	822-835	PKKKGRAPKRPPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM27	Uncharacterized protein	0.983	128-149	RPPRRGQRLKAERKRKRTAAVE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM27	Uncharacterized protein	0.775	152-162	SEGPPSKRKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPE5	DUF1713 domain-containing protein	0.997	325-354	RRQRKLKMKKHKFKKLLRKTRTLRRKLDKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS84	Uncharacterized protein	0.892	506-520	KFKSKSKSKSKSKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUF9	BZIP domain-containing protein	0.759	71-80	RNYRKRLKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWS8	Calcium uniporter protein	0.75	420-435	RRQKERREEAERKQEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY77	Catabolite repressor protein (CreC), putative	0.669	133-137	KRRKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0D1	Uncharacterized protein	0.74	152-167	KPKPKPILKRILSMRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC80	Uncharacterized protein	0.717	214-226	RRGQRRKDLRSQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEG4	Ribosomal protein L34 protein, putative	0.741	112-120	KEKAASRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH56	PHD finger and BAH domain protein (Snt2), putative	0.779	983-997	SARNSAEPPPKKKAV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH56	PHD finger and BAH domain protein (Snt2), putative	0.719	968-977	KKKARTAAEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJR2	Zn(2)-C6 fungal-type domain-containing protein	0.872	60-70	VRKRRDKKAKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP16	Glutamine--tRNA ligase	0.987	27-62	LKKRLAKRAKKAKTAANKAAAPPKDTTEKESNAAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP43	Uncharacterized protein	0.781	144-154	RRKPSKWKKLG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPN3	Uncharacterized protein	0.652	90-94	RPRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTJ2	Uncharacterized protein	0.857	274-282	PKRRRRKSA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTJ2	Uncharacterized protein	0.809	232-240	RHKRGRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV81	ULP_PROTEASE domain-containing protein	0.896	78-92	PSPRLSSKRKRRPDP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF4	50S ribosomal protein L17	0.767	177-187	GKKKTEKREKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ15	HTH CENPB-type domain-containing protein	0.859	447-460	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M040	Uncharacterized protein	0.665	8-23	KKAFRRNSDKDKNNGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0L9	Uncharacterized protein	0.699	412-420	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1J0	Uncharacterized protein	0.89	77-92	PKPKSSPKKGKASTKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M345	Pseudouridine synthase	0.885	53-64	ANFRNRRKKRPE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M899	DNA mismatch repair protein	0.937	172-186	RPNKKKKKASAKLAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M899	DNA mismatch repair protein	0.614	132-134	KRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAD8	Bicyclomycin resistance protein, putative	0.881	540-557	RRAKKERDDRKAEAKRPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDY6	Nucleolar protein 12	0.994	499-536	KFKSKSRGGSKGKPKNRSSRRAAAYRASGGRAGRKAAE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDY6	Nucleolar protein 12	0.984	422-476	FPPLLPRKLRVTRARKMSKKRDANPPRRAPTDSAHSTLRGRVKKLLGRAGASKLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDY6	Nucleolar protein 12	0.684	146-152	EKARRKM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKI9	Pre-rRNA-processing protein IPI1	0.649	7-11	RKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ17	Polynucleotide adenylyltransferase	0.647	1041-1045	KKHKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR92	SAP domain protein	0.929	533-552	GGRNRGGGRRGGRGPWRGRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR92	SAP domain protein	0.704	208-212	KRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS30	C3H1-type domain-containing protein	0.945	331-348	PPKKRGRPRKYPLKSPST
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS30	C3H1-type domain-containing protein	0.882	734-747	REKRLRKEARRKLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY78	Mitochondrial Rho GTPase	0.978	408-420	TKPRKRRRRPGRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYH4	EF-hand superfamily Ca2+modulated protein	0.948	3-20	PKRRGGGAPKEKKGRQSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M012	Uncharacterized protein	0.849	945-965	RGRRRRRNLDSAGQEWRKKRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0E3	Protein priB, putative	0.818	43-60	RRGRKPGVKLARSRTSNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN6	AAA family ATPase, putative	0.998	31-51	PSRSARKSKKRSKPVKKRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN6	AAA family ATPase, putative	0.832	312-323	RGRSSRKRPPRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN6	AAA family ATPase, putative	0.801	87-98	RGLRRRKAVKNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN6	AAA family ATPase, putative	0.662	1087-1106	PAPKPAPPLSKEQLKAQKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHN6	AAA family ATPase, putative	0.649	1074-1077	KKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKL1	Nascent polypeptide-associated complex subunit beta	0.754	40-49	KGTPRRKTKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMS8	RNA-dependent RNA polymerase	0.864	48-63	PNKRKNSPRGSKKASP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRF2	Pyruvate formate lyase activating enzyme, putative	0.861	288-296	GKKKSRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVC0	Reverse transcriptase, putative	0.975	1013-1033	RARNKKKRLVKKSLRLGHRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVC0	Reverse transcriptase, putative	0.777	1799-1825	KRRIRQSTKDAWERRWDKQKAGKPTKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVC0	Reverse transcriptase, putative	0.732	549-559	KKQPRGRPPKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2L4	Terminal deoxynucleotidyl transferase, putative	0.804	115-126	PSPKRRRLGSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2M5	Eukaryotic translation initiation factor 5, putative	0.994	142-163	RKTPTKGGKKDKKSRRDKKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C8	C2H2 finger domain protein, putative	0.986	182-200	QEAREREEKRAKRREKRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C8	C2H2 finger domain protein, putative	0.646	156-159	KKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4M3	Methylisocitrate lyase	0.984	1673-1697	KFKARKKKKLTRAQQKEREVRRRLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6I0	LipA and NB-ARC domain protein	0.975	1057-1079	RKKKGSKSQDSPKKRPRFRGRLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD36	Amino acid transporter, putative	0.886	18-27	HRGRRKRGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJE7	GYF domain-containing protein	0.98	304-326	LGKGLRKKPKWQLKNKSKNKKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJE7	GYF domain-containing protein	0.78	252-273	KDIRRAKEAADKRENERRERDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJE7	GYF domain-containing protein	0.65	500-505	KSKQKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJE7	GYF domain-containing protein	0.611	479-483	KPPSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ1	Uncharacterized protein	0.999	276-333	KGIQGRQKKNRGHLRKIGRFTKGIVKMQNREKMKKRLKKNRKARRRSHKNKHRVARGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKP6	SPX domain protein	0.858	142-155	AAKKHDRKRGARYR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY59	Uncharacterized protein	0.962	142-192	RRETRIREREEKRRQKELEKEQLRVAREAQKEVKRAKERLAKQVNTKKRRY
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY59	Uncharacterized protein	0.694	72-79	KKRQKRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZD6	Protein required for cell viability Rrp17, putative	0.997	155-213	EKKEEVPQKPKATKKFGSKSGVTKKKKKQFRYESKEERKVTRRKERIGSRKKASSRRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZD6	Protein required for cell viability Rrp17, putative	0.943	33-63	KRKVQRIKLAQEHAEKRAREERREERRKIRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M232	Uncharacterized protein	0.859	239-260	RRRRARDEEQNFKMRRRRLRTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4R4	Transposon, putative	0.603	464-464	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7J5	Ribonuclease H2 subunit B	0.977	368-401	AAAKRKKEEEKKAKAAESRGVRELKKVNTSGMKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9W7	Oligomycin resistance ATP-dependent permease yor1, putative	0.985	491-516	HKKGALGKEAKNKNKKNKKGVGKTEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9W7	Oligomycin resistance ATP-dependent permease yor1, putative	0.723	22-29	NPLKRRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEP0	Double-strand break repair protein	0.809	589-600	GRGRGRGRGGRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEP0	Double-strand break repair protein	0.779	531-543	VKRTRGQKKFKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM38	Transposon, putative	0.718	477-486	KEKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMX8	MFS amine transporter, putative	0.736	466-473	RKRRIKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNF1	Histone H1	0.996	85-162	KGPSGPVKLAKKEAAAKPVPKKPAAKPAAAAAAPKKAAAKKATSTTPAKPAKKATTTKKTATKPKANTAKPRKTSTAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNF1	Histone H1	0.991	169-205	PKVETKTKSGRVTKTTAKPAAKKAAPKKKATTKKAAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNH5	HUN domain-containing protein	0.999	87-196	RRTRRKKDDPDQDKEKDTSKEKPKEKEKEKEKEKDIPKEKKSKKSSSKSKTKEKDEKEKEKDKPEPTEKEKEKEPAKEKPAKESKSNARRAREKSNASTNPPQTSRKKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNH5	HUN domain-containing protein	0.905	735-742	GKKKRRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNH5	HUN domain-containing protein	0.865	795-810	KRGRGGGRGRGGARTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNH5	HUN domain-containing protein	0.604	845-845	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNW0	N2,N2-dimethylguanosine tRNA methyltransferase	0.991	481-494	NRRKKGKEGKKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQS8	Uncharacterized protein	0.847	59-82	EPRKSRRPTFKFTAKNGKLERKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUF4	Serine-rich adhesin for platelets, putative	0.932	2105-2146	RVKKRHKAISRTARNPKILHSRQNHRLRLKALRDRHNRYRKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUF4	Serine-rich adhesin for platelets, putative	0.638	749-752	RKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUQ3	Uncharacterized protein	0.945	723-748	KNRRNPLKSVSPNKKRKRETRILDKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUQ3	Uncharacterized protein	0.896	225-248	RRSRRLAAKKSGGKHSATPPERSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUL9	60S ribosome biogenesis protein Rrp14, putative	0.998	102-162	KRGDLKSKKQKQIDAAEKDNKDRNAEAEERRKLKAEKKAEKKAAQREKKKAKEAAKADKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUL9	60S ribosome biogenesis protein Rrp14, putative	0.996	451-540	SLLKKALKRKESAKKKSEREWKERLEGVAKGKEMRQQRREENIRKRKEDRGNAGGKKAGGGNNNKGKSKARPGFEGSFRAKNGDGSGKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUL9	60S ribosome biogenesis protein Rrp14, putative	0.994	288-330	AARRADGLNGKPARTRQELIEARRRKAEERKQHKKELRRKAKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUL9	60S ribosome biogenesis protein Rrp14, putative	0.639	439-447	KRAHGERVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUQ2	Forkhead domain protein	0.948	677-729	PKRRGPGRPPKDGIMSKRERAEIAREQKLAAKREANGGVTPPPPVNRPKLPTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUQ2	Forkhead domain protein	0.891	799-810	KPPPPKKRKPSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUQ2	Forkhead domain protein	0.828	902-912	EKEKKRRPSPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW28	Uncharacterized protein	0.858	119-141	PKHQLRLERKYRRRAALKYARPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0F4	Poly(A) polymerase	0.783	552-560	VRPKKKLPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1Y4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	0.859	111-121	GKPPRRKRIRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M309	Uncharacterized protein	0.857	26-37	KKIRVNRRRKRT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M322	ATP pyrophosphate-lyase	0.837	509-532	KKDGRGLGIRSHGVKKVRKHTANK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M322	ATP pyrophosphate-lyase	0.605	357-357	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M638	Cir_N domain-containing protein	0.968	272-286	RAQRSEHRRRRRRRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M638	Cir_N domain-containing protein	0.655	329-336	RHRHHHRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M638	Cir_N domain-containing protein	0.644	90-93	KKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDI2	DNA helicase	0.833	800-831	KEKAQHHPLFKKIARDQQKRKEAMKDMGPRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDI2	DNA helicase	0.607	766-767	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEP6	Nonsense-mediated mRNA decay protein Upf3, putative	0.983	199-238	EKKASKAKDSASGKSSKRGAKEKDTKVEKAESKKLLKRPD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEP6	Nonsense-mediated mRNA decay protein Upf3, putative	0.977	543-562	PKRSRGPRSRGGRGKKAAGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV12	Uncharacterized protein	0.778	53-61	KEKQKRRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV99	Integrase catalytic domain-containing protein	0.837	296-314	RRHGHPRAKMLQRIKKKLE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV99	Integrase catalytic domain-containing protein	0.804	1069-1077	SRKKHKKLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW70	GTP binding protein, putative	0.997	5-49	GKKSKRTPVRLRHKIEKAGAAKQRKLRKQAKKDPTWRSKIKKDPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW70	GTP binding protein, putative	0.892	67-92	KKRQKQEEQLRIREEARERRKAEKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M306	FNIP_N domain-containing protein	0.61	314-315	RK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Y5	Transcription factor TFIIIB complex subunit Brf1, putative	0.95	592-601	KKPRKRRKGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7Y5	Transcription factor TFIIIB complex subunit Brf1, putative	0.945	370-381	PKKKEGRKRKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9E7	SNF2 family helicase/ATPase, putative	0.901	1070-1093	AKKKSKNGAAVNKKLKGVKAGSKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9E7	SNF2 family helicase/ATPase, putative	0.777	1112-1118	KSKSKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9E7	SNF2 family helicase/ATPase, putative	0.757	137-152	KGSSRKGGASGDRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHP2	Carboxylic ester hydrolase	0.767	48-56	KPKPSKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK77	Mevalonate kinase	0.723	5-14	KGRKKHGSVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMD1	Purine nucleoside permease, putative	0.895	390-410	KRGSSVKKMRSMRKKGVVLRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNH9	Oxysterol binding protein (Osh3), putative	0.792	235-241	KRRRKRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRG2	Zn(2)-C6 fungal-type domain-containing protein	0.8	74-83	SRKRRRMSSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRY8	SAS4 domain-containing protein	0.88	701-711	RKRRRLKRESR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRY8	SAS4 domain-containing protein	0.803	117-133	PLSHAPRPSPRRTPKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSE8	HTH CENPB-type domain-containing protein	0.665	39-46	RKKLSRRW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSY2	HET domain-containing protein	0.628	619-622	RRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT07	Helitron_like_N domain-containing protein	0.822	107-122	RRQRERDRRAHRAAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW41	Pre-mRNA splicing factor (Prp31), putative	0.992	300-326	KGPRALPAPDDKPARKRGGRRARKAKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXX3	Uncharacterized protein	0.712	196-207	RRRKSQSLKRVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1L7	Uncharacterized protein	0.887	39-54	RAFGKKTRKQRKAIPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1L7	Uncharacterized protein	0.687	173-181	KVDKARAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M347	rRNA processing protein (Ebp2), putative	0.996	337-367	ADLRGFSAKKMKAGAGGAKKRPGKSRRNAMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M347	rRNA processing protein (Ebp2), putative	0.994	19-40	YEKERQKKLAKAAEKKKKAKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M347	rRNA processing protein (Ebp2), putative	0.948	298-334	FGKRGGKDTGVSAKRQKKNEKYGFGGKKRFAKSGDAM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M347	rRNA processing protein (Ebp2), putative	0.844	220-269	AASKKAAADARRQRDLKKFGKQVQVAKLQQRQKEKKETLEKINSLKRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4P6	Uncharacterized protein	0.963	34-66	KKRRPGRPLLSFAQLAARRAARKSARRSRRNWK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5G6	Uncharacterized protein	0.808	109-123	KESRKEKGKQREEKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6H0	Uncharacterized protein	0.821	88-98	KPKKRERGRPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7C8	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.752	1009-1015	KKRKKPV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7C8	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.682	183-190	PGTKDKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7C8	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.676	654-658	IRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8H3	DNA repair helicase rad5,16, putative	0.949	160-176	KRIARNIPRTKKKRLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9U0	RNA binding protein, putative	0.98	199-225	GGRRRRGGRGRAAGAPGRRSDTSKPAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9U0	RNA binding protein, putative	0.962	233-273	PGRQQSPSRRNATGRRPGERRDDRRNNRRNANGGSGPRPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHA3	Cell cycle inhibitor Nif1, putative	0.936	510-541	KRSRQPRRRDTGASDKNPRSKSRTRSIFARKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHS1	Pre-mRNA splicing factor, putative	0.636	42-45	KRKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTR6	Nucleolus protein required for cell viability, putative	0.858	217-224	RLRAKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXG2	EH domain-containing protein	0.925	428-455	EDNKSRGRRHLIRHHPHKHHEGDRKRWR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXG2	EH domain-containing protein	0.724	250-263	KTIKSKPERPAAKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXG2	EH domain-containing protein	0.6	424-424	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXX7	Zn(2)-C6 fungal-type domain-containing protein	0.65	294-298	KRRPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ66	Transmembrane 9 superfamily member	0.956	332-347	KLKKRRSKSPNKEPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M177	DUF2433 domain-containing protein	0.942	621-647	RGRGGFGRGRGGRGSDRGGRGRGGRGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.998	3140-3155	KSKRKKDKKKDKKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.996	3315-3328	PKPKKKKDKKKKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.995	2415-2428	SKKQKRKDKKKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.995	4734-4751	ARKLSKKEKRKMKKGKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.992	2971-2983	AKSKKKKGKKGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.992	3961-3976	KSSKSKKKKGKKNKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.991	3507-3519	KSKKKKDKKKKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.99	4228-4240	AKEKRKEKKKKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.983	2773-2785	PSSKKKNKKKKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.98	1061-1077	RRRERKERKREERRRLE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.975	3692-3704	KSNKKKDKKKKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.975	4477-4489	KSSKKNKKKKKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.966	3411-3423	KSKKKKDNKKKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.96	4139-4148	GKKSKKKKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.953	4985-4998	SKKQKGKRNKKDKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.948	3870-3880	KSRKKKEKKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.945	1685-1694	RRRRRKHKRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.933	1547-1558	GKKSKRPKRRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.932	697-730	ERSRRRGRSSPRGFRSFFTAPSANRRKKSSKKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.929	2579-2588	SNKKKKNKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.894	4838-4851	RKLSKKEKSKNKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.855	4565-4574	GASKKKGKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.834	1615-1624	KEPRRRKSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.823	293-309	KPPKPSKPSKPSSRPPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.816	1827-1836	RRKRREQRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.743	1777-1782	RRRKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.651	673-686	KRSPDRSTQRSRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D7	Involucrin repeat protein	0.609	1093-1094	RR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2C0	Pogo transposable element, putative	0.733	469-479	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2C6	60S ribosomal protein L5, putative	0.814	264-290	KKSKEEWKAESKKYRTAKLTKEQKRQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3I2	NOL1/NOP2/sun domain protein, putative	0.935	438-466	KIAKKRGWRIMRRDEQPRGLRKWRHRGIR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3I2	NOL1/NOP2/sun domain protein, putative	0.606	366-367	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDW0	40S ribosomal protein S15, putative	0.99	48-78	RARRRFNRGLKRKPMGLIKKLRKAKQEAKPN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEF0	Uncharacterized protein	0.841	397-409	KIRKRIRNRARSP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEF0	Uncharacterized protein	0.758	519-540	RSRKRARVQGPLPERWRTALRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGJ9	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.991	446-480	RKRRDLLFREEVRAKRIKKIKSKSYRRVHRKEREK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGJ9	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.77	18-27	KPKQKRKASK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGJ9	Small nucleolar ribonucleoprotein complex subunit Utp14, putative	0.706	873-884	KQQKRQKKFLTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKG9	Endoplasmic reticulum DnaJ domain protein Erj5, putative	0.95	397-407	TRKRGKRGQKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKG9	Endoplasmic reticulum DnaJ domain protein Erj5, putative	0.909	77-98	KRSFIANSARKGDGKKKGTKPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKG9	Endoplasmic reticulum DnaJ domain protein Erj5, putative	0.748	248-263	QKRMMERENRKESKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLK7	Pre-rRNA processing protein Rrp12, putative	0.99	1009-1022	IRKERERKKRKKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLK7	Pre-rRNA processing protein Rrp12, putative	0.98	1208-1262	RKAGGIAAGRRGLGVPKSHGASTATNKTKGRIEKRRSGSGSGRGFVARSRGRGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNQ2	RSC complex subunit (RSC1), putative	0.984	235-248	RRRRRRGPRKKDDS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNQ2	RSC complex subunit (RSC1), putative	0.91	254-266	EVRKKRGRPPRVD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNQ2	RSC complex subunit (RSC1), putative	0.807	813-823	KAAKEEKRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNQ2	RSC complex subunit (RSC1), putative	0.783	321-328	KRKSKRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP69	Vesicle-mediated transport protein (Imh1), putative	0.984	525-537	SKKKKNKKKKTGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT98	Ftsj, putative	0.987	357-372	RKAKKRPKASPKGKKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU66	Uncharacterized protein	0.922	49-62	RRSAPKRKRKQNPN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF9	Uncharacterized protein	0.989	351-369	KKRKAGFGETGRGKKKKKI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF9	Uncharacterized protein	0.726	45-51	ARKHRKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF9	Uncharacterized protein	0.673	325-330	KRGKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVF9	Uncharacterized protein	0.669	91-98	KKDIKEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYM7	Uncharacterized protein	0.735	28-34	RKKRKVK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0A4	Transposable element tc3 transposase, putative	0.66	127-131	KKRDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M176	Protein BFR2	0.656	269-273	KKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAI5	Transcription initiation factor IIE subunit beta	0.974	243-264	NKVVKPRPKVEQKKTKKPRRTG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAY3	DNA repair protein Rhp26/Rad26, putative	0.959	357-371	LKRWIRRRRAARKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAY3	DNA repair protein Rhp26/Rad26, putative	0.927	274-295	RSRKKRRVTYDRRQGRAKRTKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBL4	ATP-dependent bile acid permease, putative	0.64	242-244	RKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF19	Pogo transposable element, putative	0.921	467-480	AHKKEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW6	Uncharacterized protein	0.959	14-57	KGQDKKRKREDGHRTAQNSKMQKRWSKDKKFNKNNNKEKDKKGN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ07	rRNA biogenesis protein RRP5, putative	0.989	119-144	KKPATTKKSRKSKNKKSRDSEKKTKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ07	rRNA biogenesis protein RRP5, putative	0.762	1761-1769	KKLKPKKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ07	rRNA biogenesis protein RRP5, putative	0.711	1493-1499	KKKRIRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQJ4	Ribosome biogenesis protein Noc4, putative	0.612	8-10	KRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSJ5	Uncharacterized protein	0.953	143-157	PRRRGRPRGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT92	Ornithine decarboxylase antizyme	0.915	530-542	ARRRRNRKLSRKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW16	C6 transcription factor, putative	0.921	53-76	RRKRLPRGRHITKSTASSRRRRSS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW16	C6 transcription factor, putative	0.889	595-611	RSKKAMLKKLMKRARRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWI7	HMG box protein, putative	0.933	206-218	KAQMRPRKKRRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWI7	HMG box protein, putative	0.917	70-85	VLKAPRLRRRPKATKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWI7	HMG box protein, putative	0.671	123-131	RRREAAKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWR3	AKAP7_NLS domain-containing protein	0.689	291-298	RIKRGHKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY01	PHD and RING finger domain protein, putative	0.814	352-363	EPERKLKRPRTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY01	PHD and RING finger domain protein, putative	0.627	338-340	KRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M305	Pre-rRNA processing protein Esf1, putative	0.993	484-501	RKQRERKKQRKEKLKKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M305	Pre-rRNA processing protein Esf1, putative	0.992	587-602	KAEKKARKKGKKGKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M305	Pre-rRNA processing protein Esf1, putative	0.951	535-553	AKNSQRKEERRRKREEKAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M305	Pre-rRNA processing protein Esf1, putative	0.722	654-659	RKRRRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4L0	Uncharacterized protein	0.993	77-148	RAARRESRKGNEKEDRNQRPARRPTGPRDRPPSTVEKSRAARRESKAKTKDKHQRPVSRLAGPKDPPPSKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4L0	Uncharacterized protein	0.66	163-169	KRIWRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8J6	Epimerase domain-containing protein	0.873	672-682	AKTRKRRYKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBQ7	Ribosome biogenesis GTPase Lsg1, putative	0.916	669-688	SKKHFKGGKRTHNKSGKGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME28	Uncharacterized protein	0.98	254-266	RRHSRKDKKKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG71	Uncharacterized protein	0.964	292-306	RLARRGRRHRRRSRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK9	Exocyst complex component Sec3, putative	0.664	655-659	RRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK9	Exocyst complex component Sec3, putative	0.604	522-523	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH50	Eukaryotic translation initiation factor 3 subunit A	0.996	804-926	EKRRKAAERELEAKKKQRIKEVMERRRREKAEREEEERRRKEEEERIKREEEERTAREEEQRRIMAERKAQREEERRKLDEIAVKQKQREEEAEARRAARKAGGVPEPTRAEPVAERGERGPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH50	Eukaryotic translation initiation factor 3 subunit A	0.697	655-661	REKKRLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHI2	Uncharacterized protein	0.975	338-358	RARNKKKRLVKKSLRLGHRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHI2	Uncharacterized protein	0.936	159-181	KFRSKSPYRNRRTRKFRDPRRNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKE2	Serine/threonine protein kinase, putative	0.993	351-373	ERKEKRRERRRKEKEAEARSLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKE2	Serine/threonine protein kinase, putative	0.763	516-542	KRAKSPHPRTPKSTGGQSSKARSEKSS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQN0	Methionyl-tRNA synthetase	0.997	613-646	KALEAEKAAAKKLAKEKEKEKKRLKKEAAAAAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MU66	HTH CENPB-type domain-containing protein	0.833	467-480	AHGKEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2W7	cAMP-specific phosphodiesterase, putative	0.971	365-379	KGQKRRGRSSKRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M4	OB-fold nucleic acid binding domain protein	0.957	248-278	KVIRDRRHKQERQKRHDEKEEKYRRRILKKW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3N8	Arginyltransferase	0.793	167-178	PKSREEKRQRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCB6	Peptidyl-prolyl cis-trans isomerase, putative	0.864	48-54	PKKKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCT9	Reverse transcriptase Ty1/copia-type domain-containing protein	0.834	324-335	SRKKHKKLSQPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF73	Uncharacterized protein	0.73	37-47	RRDKRQHGRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIK0	Uncharacterized protein	0.998	85-108	KLRGKGRPKKKRTAAESRSAKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK90	Uncharacterized protein	0.781	30-47	QRERKRQMNRASQSRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMS7	Uncharacterized protein	0.703	790-800	KRAAAGPKAKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN78	Gag/polymerase/env polyprotein, putative	0.982	562-570	KKSRKRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQA4	Uncharacterized protein	0.868	37-51	VKVPRKRGRPVGSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS24	Translation factor guf1, mitochondrial	0.785	631-645	RRRKLLEKQKEGRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSC1	Uncharacterized protein	0.901	285-295	KRKKVKKLRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTI7	Translation repressor/antiviral protein Ski3, putative	0.632	633-638	APGSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU25	CBS and PB1 domain protein	0.866	69-93	RRKMEADLNKKRHHVQRPRHNRKAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX24	Uncharacterized protein	0.718	53-62	KEKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH0	Uncharacterized protein	0.892	907-920	KKREKKKSSWKLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1A0	Ankyrin repeat-containing protein, putative	0.953	8-25	KGRFARAGKPAKKERRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M388	Homeobox and C2H2 transcription factor, putative	0.912	366-375	RKERRRRRKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3C6	CDP-diacylglycerol synthase	0.614	500-501	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDB8	Uncharacterized protein	0.747	106-116	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEB8	Nucleolar protein Jip5, putative	0.994	408-423	KEKKIRKKRKKDKGKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNB9	BZIP domain-containing protein	0.642	100-106	KNAQRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS87	Florfenicol exporter, putative	0.675	459-464	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS87	Florfenicol exporter, putative	0.648	523-531	REAEKVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSB4	Integrase catalytic domain-containing protein	0.81	1136-1151	RRGPGRPRGSRNYKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSM6	rRNA biogenesis protein rrp36	0.998	262-338	NKKREREVLREHKQREKQLIKEGKKSQPYFLKKSELKKEVLKKKYESMGSRQRTKALERRRKKIAAKGKKDLPWARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWC8	Cell cycle control protein (Cwf19), putative	0.933	22-70	HKDRSRSRRHHHHHHRHHHRNSSRTRDRHSDRGEDKDDDRIHRHKRSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWC8	Cell cycle control protein (Cwf19), putative	0.775	662-682	KQGRWNKGGDRRVEPFRKRWR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL0	WD repeat protein	0.981	471-517	AKRVKEKIDQERESRIRGKKKVAVKVNRKLAEKLLEKQEKAERRNAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0B7	Uncharacterized protein	0.798	69-83	RRRNRSAIKNKHRRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M654	Zn(2)-C6 fungal-type domain-containing protein	0.794	17-24	PKKRKIRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6G1	WD repeat protein	0.683	1119-1126	KKKEARKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6P9	Uncharacterized protein	0.828	182-202	KKYRLKRGSRLKLLRRTLRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEJ5	RNase H domain-containing protein	0.822	191-201	ARKRRASRPPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG85	Cell cycle checkpoint protein Rad17, putative	0.893	96-125	SEKTKSRASSRKQPKDSKVPTSPSPKKKTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ89	Uncharacterized protein	0.996	331-375	KPDKRKKSKEESRDDSQESSKTRSSRKKAHEKRSKKVRFKGKARN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ89	Uncharacterized protein	0.818	571-586	RFGHPGKPRMKRLVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ89	Uncharacterized protein	0.66	1254-1259	RKLKKF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMT0	60S ribosomal protein L37	0.676	113-118	KAKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPT6	Transposon, putative	0.734	408-418	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR67	RNP domain protein	0.994	133-158	GGEGRKRGIKRGRGRGRGGRFVRGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVJ0	Pogo transposable element, putative	0.728	380-390	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV94	Zn(2)-C6 fungal-type domain-containing protein	0.68	62-67	KKRKSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWC0	Uncharacterized protein	0.868	58-72	ARHKSRKIWKRFRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWC0	Uncharacterized protein	0.7	532-536	PKRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXE1	Uncharacterized protein	0.916	85-100	RRGNKSTKRKRNHARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3K5	Pre-mRNA-splicing factor 18	0.993	55-104	EEKAALKRKHEEEEVERRRERDEKKRKLAEESRRKREAEEEAAERARRNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5J6	Uncharacterized protein	0.623	207-213	RKHHNRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA82	HTH CENPB-type domain-containing protein	0.733	411-421	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBX3	Class V myosin (Myo4), putative	0.817	1108-1116	KKSKPKRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBX3	Class V myosin (Myo4), putative	0.811	914-925	RGKKARRDYKKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCA5	Universal stress protein family domain protein	0.975	269-280	TKREKKKKKRLA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDZ2	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.973	722-736	KGHKKKKSTKRKGPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFG4	Uncharacterized protein	0.936	360-369	AYSRRKKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFN2	Separase	0.76	1744-1752	SRRRSKDKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFN2	Separase	0.747	1461-1471	PVRRKGKSTTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ90	Pogo transposable element, putative	0.954	476-486	EKEKKKRKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKY5	F-box domain-containing protein	0.603	50-50	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW91	CCAAT-box-binding transcription factor	0.869	585-597	KSWKADNKKKGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW91	CCAAT-box-binding transcription factor	0.788	1101-1108	KKSKKRKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW91	CCAAT-box-binding transcription factor	0.634	941-946	KKAQRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW91	CCAAT-box-binding transcription factor	0.607	84-86	REK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW91	CCAAT-box-binding transcription factor	0.601	77-77	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW91	CCAAT-box-binding transcription factor	0.6	81-81	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWU8	MYB DNA-binding domain protein	0.92	1045-1065	KAKLNKRWRSQRRARKSTTRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWU8	MYB DNA-binding domain protein	0.911	1117-1143	KDNEHGEKPASRRGRTGAGSRGGRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWU8	MYB DNA-binding domain protein	0.803	197-219	GGLGRGRGRGDWEGGRGRGRGHF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWU8	MYB DNA-binding domain protein	0.791	223-265	RDNFRRRSRSRDGWWDRERERERERDFRDRDREFDRRDRFDRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWU8	MYB DNA-binding domain protein	0.611	135-136	RR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX77	Uncharacterized protein	0.937	1250-1274	RRKPRPKGILKNVKSAKARSGSAIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX77	Uncharacterized protein	0.855	936-958	ERERGRKEAEEKAAAEAAKRKRM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX77	Uncharacterized protein	0.835	976-1003	ERAADKHRLRKEEERAIAAERERERGRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX77	Uncharacterized protein	0.781	766-780	RERERERGRKEAEEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX77	Uncharacterized protein	0.722	875-888	RERERGRKESEEKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY43	Pre-mRNA splicing factor RNA helicase (Prp43), putative	0.751	749-759	LARKEKMRGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY43	Pre-mRNA splicing factor RNA helicase (Prp43), putative	0.69	363-372	PRRPGGRPGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYZ8	Uncharacterized protein	0.962	423-447	KSKSKPKPKGIQKVRKSAQATRKPA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D8	Uncharacterized protein	0.987	467-485	RSHRRRHRRREKKERSSSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D8	Uncharacterized protein	0.976	295-352	DRRSRSRHRRRSQSRSGDARSKSRNRHIAAAGLAGAAAAGIIEKVRSRSRPRSKSRIR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D8	Uncharacterized protein	0.834	250-266	HHRRRHSRSRSRSSSHS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D8	Uncharacterized protein	0.79	508-523	GNKKEKSHRSRERESR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D8	Uncharacterized protein	0.766	381-396	SAKGERRHSRSRSLSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2M7	DNA ligase	0.99	103-134	KRRKKNSKSPRPKKTAKEVLAERPSSPKIAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4H9	Uncharacterized protein	0.61	306-307	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4V6	DNA replication licensing factor MCM2	0.664	872-878	KPQSKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8X7	PHD finger and SET domain protein, putative	0.972	98-118	DSGDRKAKRSGSKSHKKKHHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8X7	PHD finger and SET domain protein, putative	0.946	432-450	RRHPSSKQVNGKRKKAKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8X7	PHD finger and SET domain protein, putative	0.67	537-541	RKKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8X7	PHD finger and SET domain protein, putative	0.602	92-92	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB14	C6 finger domain protein, putative	0.842	3-18	RPKRPGAPAPKPRSRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBN6	Methionyl-and glutamyl-tRNA synthetase cofactor, putative	0.997	297-322	SKREKEKKEKKEKKEKQPRQPKAPAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBN6	Methionyl-and glutamyl-tRNA synthetase cofactor, putative	0.877	251-262	PKEEKERKKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK7	40S ribosomal protein S8	0.976	8-44	RHKRSATGAKRATYRKKRAFEKGRQPANTRIGPKRVH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKB7	Uncharacterized protein	0.624	392-395	DRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW5	Mitochondrial thiamine pyrophosphate carrier 1	0.746	293-302	RKSGKRQGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQI8	CCCH zinc finger protein	0.94	212-234	KKGNLHRLGAVVAKRKPSKIKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQI8	CCCH zinc finger protein	0.63	126-130	KRERR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUI4	Uncharacterized protein	0.989	121-153	KKRVRPTGDGGRLRQPGPRKKPPLKKSSEAKHA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZA9	Uncharacterized protein	0.836	74-96	ASRKRKEAPETPSKTPSSRKQKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y9	Fibronectin type III domain protein	0.741	323-331	KEAERKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4G6	Tafazzin	0.747	899-914	RKARRVEKHIHRVRRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4G6	Tafazzin	0.606	466-467	RR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G1	Triadin, putative	1	97-118	KAKGKKKGKKGKKGKKGAKKVA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G1	Triadin, putative	1	153-175	KAKKGKKKGKKGKKGKKGAKKAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G1	Triadin, putative	1	218-240	RAKKGKKKGKKGKKGKKGAKKAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G1	Triadin, putative	1	280-302	KAKKGKKKGKKGKKGKKGAKKVA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G1	Triadin, putative	1	370-391	RAKKGKKKGKKGKKGKKGAKKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8G1	Triadin, putative	0.726	65-74	KKAAKAKGSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCC4	C2H2-type domain-containing protein	0.708	891-896	RRRRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIJ7	Uncharacterized protein	0.996	332-375	PDKRKKLKEESRDDSQESSKTRSSRKKAHEKRSKKVRFKGKARN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIJ7	Uncharacterized protein	0.818	551-566	RFGHPGKPRMKRLVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT51	Uncharacterized protein	0.966	152-202	RRETRIREREEKRRQKELEKERLRVAREAQNEVKRGKERLAKQVNTKKRRY
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUA6	BTB/POZ domain protein	0.961	4-14	KKKKKDRKRNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUH2	Methionine aminopeptidase 2-1	1	57-77	AKKKKKRKPKKKKKGGAKKQS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYM4	G1/S regulator NimO, putative	0.702	380-388	RMKEEKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M111	mRNA splicing factor RNA helicase (Cdc28), putative	0.984	145-184	ERSRRDKDSSDGKSRKRDRSRGAEGESRDRNRRSRKLRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M111	mRNA splicing factor RNA helicase (Cdc28), putative	0.82	258-280	KRLAEKEDSKSKKKIVEDRTRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M111	mRNA splicing factor RNA helicase (Cdc28), putative	0.611	120-122	KGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5M4	rRNA processing protein Nop9, putative	0.899	577-598	REKQKRGRRAQEKEKSEENKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5M4	rRNA processing protein Nop9, putative	0.657	1214-1222	RRRGEWKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAH1	Autophagy-related protein 2	0.702	1709-1719	RGKRLRLSRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAJ0	Probable E3 ubiquitin ligase complex SCF subunit sconB	0.952	597-621	PRRSKRKATNKTPTRKIARRKLLSS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC85	Protein kinase (NpkA), putative	0.957	21-36	RKREKEAKKRAKAERQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC85	Protein kinase (NpkA), putative	0.742	416-422	QEKRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MER1	ABC transporter, putative (Fragment)	0.664	792-798	RKSRSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH63	RNA cytidine acetyltransferase	0.971	1050-1064	IQKKIKKGTEGRKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH63	RNA cytidine acetyltransferase	0.965	69-85	HRKKREAKIKKEIKRGI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHB8	Uncharacterized protein	0.985	34-49	GKKKKKGKDKNGSKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR6	AAA family ATPase, putative	0.999	200-222	RHRRRRNKAKKAKKLKKKRRHRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR6	AAA family ATPase, putative	0.996	298-325	GNRRRLKIKESKGEKSKKGKSRRASKVA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR6	AAA family ATPase, putative	0.994	122-156	KAKADSKKSKCKPHKHRAAVKKCASKKSKKKKHAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR6	AAA family ATPase, putative	0.973	247-266	KEKLARMAKKQRKAKKLAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR6	AAA family ATPase, putative	0.956	426-441	KKTVKTEKKKKARKLA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM08	Uncharacterized protein	0.911	22-43	KKRIKPQERARKDDKKLQQKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMK5	Annexin ANXC4	0.986	938-973	RRRKYKYSRSRDERKEKEREKERETEKEKDRRRHSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTV2	MBOAT family protein, putative	0.969	215-233	PPTRKKRKIPRSGRPAFKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVP5	Uncharacterized protein	0.657	25-29	RQRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYX3	ATP-dependent RNA helicase (Hrh1), putative	0.872	31-57	KNKSKPLKPDKSLEVSNKRRKRDESGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0W3	RNase H domain-containing protein	0.9	3-17	KSSGKARKRGHKGSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M649	DIL and Ankyrin domain protein	0.97	516-539	KSKPKPKVEPPEKRFRPPSPKRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI62	Uncharacterized protein	0.96	28-57	AKKANSHRKRPAPSGRKSTTRSPSKTPSAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNG9	Anaphase-promoting complex subunit 1	0.967	334-351	ESKKRKKPLASGARSKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNG9	Anaphase-promoting complex subunit 1	0.732	606-611	DKKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNG9	Anaphase-promoting complex subunit 1	0.716	815-820	KKRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNM0	RNA binding protein Rnp24, putative	0.995	280-301	TGKKTKKRISADKKKKPRTKKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNM0	RNA binding protein Rnp24, putative	0.905	43-54	PSKKALRKAKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNM0	RNA binding protein Rnp24, putative	0.603	326-326	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPQ2	Myb-like domain-containing protein	0.988	465-492	RKLRKQRNSHSNAREAGSGRKHKRRKKW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPQ2	Myb-like domain-containing protein	0.956	311-328	PKPRTRRSAKRPHRSRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQN4	UV-endonuclease UVE-1	0.993	586-622	AKKSSSRAKSKVSKTKESPKPKTKVTKKATSKTRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQN4	UV-endonuclease UVE-1	0.732	507-516	PWKPPKKTKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRN2	Mediator of RNA polymerase II transcription subunit 21	0.769	189-200	EKKAKELKKLGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSE6	Uncharacterized protein	0.779	191-211	GRGARQRGRGSHGGGQAGRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSE6	Uncharacterized protein	0.674	257-262	RSKRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUS1	Uncharacterized protein	0.983	84-98	RGNKRVKRRRKHARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL9	SNF2 family helicase/ATPase, putative	0.999	686-717	DKKKKSKKPKSKKHKESKPASQEPDTRKVRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL9	SNF2 family helicase/ATPase, putative	0.706	211-218	RTRARKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M004	Uncharacterized protein	0.737	608-617	VRRRQRKQER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2T8	Protein SDA1	0.989	261-288	NKKTKKKARQIEKAITMVKKKERKKKAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2T8	Protein SDA1	0.985	664-744	KIAHAKESKTDRDEFKSKTARKKERKVADGKSTTNKEKARKKNFLMTLGKARSKNKRSLVETRAVLKAHHDRKKRGGRRGN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M596	Glycerol-3-phosphate O-acyltransferase, putative	0.685	643-651	RSRSRSRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K2	AT DNA binding protein, putative	0.996	138-186	PPSAKKRRGRPRKSNVREKSLSPVKGSPGRTPKPQPPDSISRPRGRPRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K2	AT DNA binding protein, putative	0.811	544-559	RGKMRSRRLRRQEEKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6N8	PHD finger domain protein, putative	0.991	186-210	KRQTPKSSPGKTSVKNRKRRNKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6N8	PHD finger domain protein, putative	0.808	277-286	AKRRRKVYRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M786	Spindle-pole body protein (Pcp1), putative	0.664	1207-1218	AKKIGESLRRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M786	Spindle-pole body protein (Pcp1), putative	0.656	1107-1118	RKNRHEKEIRGL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M929	Uncharacterized protein	0.702	304-310	RGRRRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M929	Uncharacterized protein	0.64	556-563	KERKADAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBH3	Uncharacterized protein	0.982	408-436	RRRRHKERRREKERETGTASPEDKIRIRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBH3	Uncharacterized protein	0.964	484-497	KSSLGKKPRKRKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBH3	Uncharacterized protein	0.65	234-239	SRRRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBW0	Uncharacterized protein	0.601	250-250	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIW1	Uncharacterized protein	0.991	65-86	AAEKKQKKRLRRKRTENGNNKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP17	DUF1212 domain membrane protein	0.746	317-325	KRRKQGGKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP17	DUF1212 domain membrane protein	0.66	192-197	PRPRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ96	C2H2 finger domain protein, putative	0.803	241-259	KKMSPKTKKSLRDRDGSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSW1	gag_pre-integrs domain-containing protein	0.841	265-275	KKGLEKKKKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVM0	Uncharacterized protein	0.996	331-375	KPDKRKKSKEESRDDSQESSKTRSSRKKAHEKRSKKVRFKGKARN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVM0	Uncharacterized protein	0.818	571-586	RFGHPGKPRMKRLVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVM0	Uncharacterized protein	0.656	1226-1231	RKLKKF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX10	Uncharacterized protein	0.74	46-52	KKGRRKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX71	MADS-box domain-containing protein	0.618	23-25	KRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYI3	Uncharacterized protein	0.871	326-357	PSKRELILRKVRSIGSHLRPRSPTRRARNLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL6	Exo-beta-1,3-glucanase, putative	0.943	137-182	RTRDKTPKAKESPATSPKKKLDREGYRRNTGRAPQGSPVRERRHRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL6	Exo-beta-1,3-glucanase, putative	0.851	292-302	VEKRRERRRPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ11	Uncharacterized protein	0.73	1238-1246	RKAGKKTKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M038	DNA topoisomerase 2	0.978	23-57	PKPKAKAKAAAKPKKLTQTTLKTKPAAKATKKKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M038	DNA topoisomerase 2	0.978	1554-1604	KPAAKAKPAAKPKPAATTTGVKSRGGPKKDPAAVPATKKAQPAAKGRGKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M038	DNA topoisomerase 2	0.933	84-99	NKPKPKKAPTKKAGSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M038	DNA topoisomerase 2	0.808	1431-1451	SKPAAKSAAAKETKGRPTAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M038	DNA topoisomerase 2	0.805	1274-1300	RKVAGMGRRQSSKLMTAASKGPGRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M038	DNA topoisomerase 2	0.677	1365-1373	KSRAAAKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Z3	Uncharacterized protein	0.974	327-363	RRPQRSRKKGLSNATFGKTNAKPSKPNRGGRKNKRGN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0Z3	Uncharacterized protein	0.608	193-194	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5N6	Ubiquitin (UbiC), putative	0.995	73-99	LRGGGKKRKKKVYTTPKKIKHKRKKTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M792	Meiotic recombination protein Ski8/Rec14, putative	0.886	66-83	PKKKTSHMKKRHRQMAGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7K3	Transcription factor TFIIIC complex subunit Tfc6, putative	0.748	311-319	KKGKGRPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7K3	Transcription factor TFIIIC complex subunit Tfc6, putative	0.704	44-49	KSRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDN9	Calcium/calmodulin dependent protein kinase, putative	0.703	114-129	RLRKRQQSHMLRRPRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKS8	Uncharacterized protein	0.943	367-436	RNAREEEIRKLRRADEEEKAEERKYAAEKLKKEERERLLRGMTAEEQRKFLEREKEKEQRKMMKKSTRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRI8	Uncharacterized protein	0.812	489-501	SPGKGRRREALKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSY7	Uncharacterized protein	0.922	277-302	KKARKEPRKREVTSTGGRVLRKRVRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVV7	Uncharacterized protein	0.974	38-69	EKVEPIPQAAKPKKQKARKQAEPAASKKPEEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVV7	Uncharacterized protein	0.881	327-336	KKGRSKKKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVV7	Uncharacterized protein	0.778	188-216	AKKPKAQQAFKPVETKKQRQNRQKNEARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0M2	UDP-glucose,sterol transferase, putative	0.953	940-959	KRNARRNRKKSNGTGKRARS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1F0	Uncharacterized protein	0.861	177-193	KKSGWFKSKARKPEKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M2	DnaJ domain protein	0.942	281-296	GARKSSNRGKGKRSKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M2	DnaJ domain protein	0.884	212-224	EKGTAKKGKKSKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M2	DnaJ domain protein	0.763	258-267	KSAGKGKKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M2	DnaJ domain protein	0.672	189-195	RQKRLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M859	Serine/threonine protein kinase, putative	0.721	719-728	RKKEKRLSGS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M890	Polynucleotide adenylyltransferase	0.792	373-382	VRPKKKVAKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIT9	Pogo transposable element, putative	0.701	471-479	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKH2	Uncharacterized protein	0.958	94-112	GPRSERGTRKRVSRKPKKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRH7	WD repeat-containing protein	0.691	285-294	GRKVRSIRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTU1	MFS monosaccharide transporter, putative	0.837	824-840	RRRRRSTLRGQPSRRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTX7	Uncharacterized protein	0.98	490-509	RAAKRREKKRSGGKLGKFRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTX7	Uncharacterized protein	0.638	84-90	RKGSPTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVN6	Non-specific serine/threonine protein kinase	0.669	821-839	RAKSLGHARRESIQARRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH5	Checkpoint protein kinase (SldA), putative	0.623	405-408	KPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH5	Checkpoint protein kinase (SldA), putative	0.612	1220-1223	RRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZH5	Checkpoint protein kinase (SldA), putative	0.611	462-465	KVKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7D0	Ubiquitin-like domain-containing protein	0.616	64-66	SKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M993	Autophagy-related protein 9	0.757	163-175	SRKRWESPRNRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC97	Serine/threonine protein kinase	0.772	78-86	RPGPGRRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDY7	Uncharacterized protein	0.994	239-255	RGKRGVKKGKRKGRKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME13	Actin cytoskeleton-regulatory complex protein SLA1	0.664	546-555	HKREKSDKSS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHS0	C6 transcription factor, putative	0.844	74-85	ERRKRGRIPRNN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKF4	Fungal_trans domain-containing protein	0.729	21-31	KRKKPDVRRPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMG4	SD08430p	0.947	1584-1600	RRKQMKRRSREKSSKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ24	Uncharacterized protein	0.648	260-266	PPKRNSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTF3	Ribosome biogenesis protein NSA2 homolog	0.803	23-66	RTRKREAREGHLASQKAQSLRGLRAKMYAQKRHAEKIQMKKRIR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTF6	Siderophore iron transporter, putative	0.83	241-249	KRKGKKLRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUP0	Peroxin/Ferlin domain-containing protein	0.833	222-237	RRRRWVRLRVKKKYAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M330	WD repeat protein	0.629	183-186	KEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5V1	Dimer_Tnp_hAT domain-containing protein	0.927	69-81	GKSKDKRKKKNEE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBF1	Catabolite degradation protein, putative	0.949	119-127	PRRRRRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD08	AAA family ATPase, putative	0.941	480-493	TRKPKPPAPRRKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD08	AAA family ATPase, putative	0.906	233-255	LRQKKDPKKSKNRNSSSSRSGTR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD08	AAA family ATPase, putative	0.696	118-127	RPPKLEKGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDM6	Mitochondrial ribosomal protein DAP3, putative	0.988	54-96	SRSMEGSPKFRESKSARMRKPKKATTDRGRPPLVGERKALRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFQ2	Molecular chaperone and allergen Mod-E/Hsp90/Hsp1	0.851	246-254	KKKKTKKIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ76	Integrase catalytic domain-containing protein	0.956	199-218	KTHPKAKKLRWVKKRIERKM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ76	Integrase catalytic domain-containing protein	0.902	9-43	LAPKENREKALLIKRERELTIPKRGTKPKELAKKW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK23	C6 finger domain protein, putative	0.712	13-19	PRKKMRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML68	FAD-binding monooxygenase, putative	0.645	105-110	RSKRVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQR9	Reverse transcriptase Ty1/copia-type domain-containing protein	0.931	6-23	RHRGRPRGSKNKPKAYAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRZ2	Uncharacterized protein	0.975	62-95	SSPTKRGKPSKAATASSIKAPTKAKAKGRPSKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRZ2	Uncharacterized protein	0.883	16-38	RIWRLRRRREVVRQRAPRLWRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTR1	Uncharacterized protein	0.925	180-191	KVRKSKSKKKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTZ2	Ribosomal small subunit assembly protein, putative	0.915	292-320	KRKERQNELLRRFDEDKRKIEKLKKSRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUJ9	Elongator complex protein 1	0.948	1177-1195	RRTSKTRRREERKRAAGRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M586	Zn(2)-C6 fungal-type domain-containing protein	0.849	50-57	PPRRRKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5G3	Rho GTPase activator (Sac7), putative	0.795	482-492	PRQPNRLKKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M616	Myb-like domain-containing protein	0.788	269-288	RLPPTPNRRRATSIRSRKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME58	DUF3835 domain-containing protein	0.875	416-426	KKDEPKKPKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME58	DUF3835 domain-containing protein	0.633	648-656	RKVSKFKAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF61	Cell agglutination protein mam3, putative	0.987	180-204	KKGHKGGKKNGQGNEAAKKKKKHSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF61	Cell agglutination protein mam3, putative	0.756	251-269	KGHKNGQGNKAGQEKKKHH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF61	Cell agglutination protein mam3, putative	0.61	118-119	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF61	Cell agglutination protein mam3, putative	0.607	126-126	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI46	Ankyrin repeat-containing protein, putative	0.779	267-275	KEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKD4	CTP synthase	0.899	578-612	KKKPNFSKLSREYGVSRKKLSRRWRGLPSRSTRPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMH6	Phosphatidylinositol:UDP-GlcNAc transferase PIG-C	0.992	90-112	PRKNDIRKFRDGRRKKRKGVWKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRK3	XAP5 domain protein	0.937	91-101	RPKKKKKALAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS38	Mitochondrial mRNA processing protein PET127, putative	0.997	162-221	KSDKNPPKKKTTQKKKKSGEKNPPVTGKSARKKTALTPRQAGKKSKKVKEPEPKKAPSPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVE9	NIF domain protein	0.776	165-193	RPKKTASSHRLKGESEKSGSRRNGASARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXC0	HTH myb-type domain-containing protein	0.993	239-260	ARPPKPHAKRSAKRPYRRRPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXC0	HTH myb-type domain-containing protein	0.886	415-425	PGCGGKRRRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXD7	Uncharacterized protein	0.732	116-126	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXS0	DDE-1 domain-containing protein	0.738	506-514	RKAAKKTKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYQ4	Transcription factor BYE1	0.999	130-160	EAARRRQQEIEEKKAAKRKKGKKGKKGGARP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYQ4	Transcription factor BYE1	0.856	27-41	AKKGKKGQSKEKSAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZA6	Uncharacterized protein	0.775	138-152	TKRKRTPVQSPRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2C5	Cell wall biogenesis protein Mhp1, putative	0.994	320-346	KEPPTKKQEKKKRSEEERKERKERKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6A2	Protein MAK16	0.997	286-310	KKKPAAGNKRKRAAPPPKPRKKGAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6A2	Protein MAK16	0.934	127-162	KLAKEEERLGERIVPKLAPKIRRREETRERKAEAAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M807	Uncharacterized protein	0.955	78-97	RKRSKVSKEKRRAVKIEKQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME15	Sulfonate biosynthesis enzyme, putative	0.703	85-90	RPKKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFF2	Uncharacterized protein	0.961	594-610	RKASEQGKPAKRRRRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFF2	Uncharacterized protein	0.948	428-447	APPSPGPRARGGKKRGGASK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFF2	Uncharacterized protein	0.93	183-195	ANKKAKGRKRNRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFF2	Uncharacterized protein	0.758	545-557	RREKIAKSKNPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHD8	UDENN domain-containing protein	0.981	153-163	SPKRRRRRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK41	Arginine rich protein	0.996	531-600	REREQARKRSTERERDRSRDKDKGRDRPRSRSRCRRSPSRADRSLTRHRRDRSGSRTSTRRRSTSRRKSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK41	Arginine rich protein	0.994	357-506	ARPKSTAEPRFAASGTRDSSRDRRRRSRTRSRTRRSSRYENEGRNRSREGSTRLRDREDDRYSVRSHRDERRDRTARQSRSRSKARNDRERDRDERGHRSSRRSRTRSRTRDRDRDRVDSRERRERDRDQDRDRDRANRDRERDRDRDRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK41	Arginine rich protein	0.989	195-258	AERARIEAEREKARQEEARKRREIERKREEEQREREEKRRAEQRALDEQREKERQERYERRRRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK41	Arginine rich protein	0.802	618-633	SRSPRRRVRSPERDRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKR4	Large-conductance mechanosensitive channel, putative	0.61	232-233	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLR1	Uncharacterized protein	0.905	381-389	RRRRARKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMK7	Septin	0.634	74-79	GKVSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP65	Integrase catalytic domain-containing protein	0.837	315-333	RRHGHPRAKMLQRIKKKLE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP65	Integrase catalytic domain-containing protein	0.804	1088-1096	SRKKHKKLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP71	Zn(2)-C6 fungal-type domain-containing protein	0.67	495-499	SRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRC3	RNA annealing protein Yra1, putative	0.991	180-204	KNAAAGGRRGRARPRKPKNPTQRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRC3	RNA annealing protein Yra1, putative	0.944	15-59	SRRQARGNNRRRSSTAKATTTKAPVGGIKKNTKPAKGPARGPVKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LV71	Uncharacterized protein	0.961	332-363	ARKERRRKAEEEERRTRKLLEAEQRAQRKKQA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0X8	AP-3 complex subunit delta	0.993	935-946	KKKAVKKKKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D6	CorA family metal ion transporter, putative	0.992	29-44	AKPKKKNRNRKRRNRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1D6	CorA family metal ion transporter, putative	0.764	334-340	RRRRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2E3	Adenylyl cyclase-associated protein	0.985	354-377	RGKSPAPGKKPKPESMRAKKPPRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2G4	Membrane-tethered transcription factor (SPT23), putative	0.94	433-445	ERKRASRKKQRKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3I1	Uncharacterized protein	0.794	445-454	TAVKGKHRPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAH8	Pogo transposable element, putative	0.699	471-479	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDQ3	Chromosome segregation protein (Pcs1), putative	0.789	129-136	KKRRGRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDQ3	Chromosome segregation protein (Pcs1), putative	0.73	39-46	KKARGRPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJB7	Maltase	0.663	676-680	RSRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML26	NADPH:adrenodoxin oxidoreductase, mitochondrial	0.888	513-525	KERGKAKGKPREK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMI9	MFS transporter, putative	0.878	286-295	PRRKPKSKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNA4	Reverse transcriptase	0.971	1778-1787	AKRKRKKKIH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNA4	Reverse transcriptase	0.819	194-202	RARRRRRES
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNA4	Reverse transcriptase	0.638	1594-1597	KRAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPX0	Curved DNA-binding protein (42 kDa protein)	0.998	386-401	GSKGKKNKKKKKPAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUK2	Transposable element tc3 transposase, putative	0.886	115-126	IHKRKWKQRKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUV6	Integrase catalytic domain-containing protein	0.955	1350-1364	PRRRGRPRGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU38	Patatin-like serine hydrolase, putative	0.852	938-955	RGRRRRRNSNLTAEHRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUP3	Phospholipid:diacylglycerol acyltransferase, putative	0.862	39-74	RKAHKHGTNAERDKKQSLSPIVRLKRYITKPRGKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M361	Calpain-like protein	0.941	622-641	HIREKKIRARRERMMRRERL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3F2	C2H2 type conidiation transcription factor BrlA	0.605	354-355	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U9	Eukaryotic translation initiation factor 4C	0.935	3-16	KNKGKGGKNRRRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6I4	FHA domain protein SNIP1, putative	0.996	16-138	RSRSPRTSGSRRRRDYSQERSRDYDKEHTRRRRSPERDSEKRDDYRRRRRDHPVSFGKDSDRPRSREKRDHETRRRRHDSSELDERSTRRDKRHRSRSKETRGRRRSGDRRDRSRSPAAPVRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME80	Uncharacterized protein	0.704	182-189	ARAGRRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGW2	C2H2-type domain-containing protein	0.895	244-263	KKPHRDSLRPRKVREKAKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHU2	Uncharacterized protein	0.873	250-259	NRRKAAKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJE9	Adventurous-gliding motility protein Z, putative	0.931	804-819	PPRKKNKRKFTKFSGP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJE9	Adventurous-gliding motility protein Z, putative	0.602	826-826	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNX3	Chromatin remodeling complex subunit (Arp9), putative	0.714	370-383	EKEKAVSGPGKKGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTK4	RING-type domain-containing protein	0.865	632-649	KKQREKDAERRKQAEKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTK4	RING-type domain-containing protein	0.715	410-417	SKHKPKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX39	Reverse transcriptase Ty1/copia-type domain-containing protein	0.976	23-44	PKKEGSKKRGSFRAEKGKRRGE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXH9	RING and UBP finger domain protein, putative	0.972	745-754	SKKKGKGRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYC2	AAA domain-containing protein	0.941	144-166	NRKAEERRKSSRKRNDTKRIVIK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYC2	AAA domain-containing protein	0.921	453-466	KKKSSGGHKSKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZ72	Uncharacterized protein	0.941	3-21	KKGGKKHNKNKNKGAGGAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0B4	Uncharacterized protein	0.65	472-476	PLKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0B4	Uncharacterized protein	0.611	450-452	PKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD79	Serine/threonine protein kinase, putative	0.923	642-658	MARKKAHRHLPPEKKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFR5	rRNA processing protein, putative	0.998	242-279	RDRTAKKAKAPNPLSMKKPKRREKQKPEEQGKKKDKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFR5	rRNA processing protein, putative	0.989	301-313	GKKKRKRKHKSSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP58	Zn(2)-C6 fungal-type domain-containing protein	0.689	60-65	PKRRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVE9	Integrase catalytic domain-containing protein	0.939	1123-1140	PPAPRRRGRPPGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU11	Nulp1-pending protein	0.992	85-96	AKKNKKKKKKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWZ8	Histone H3	0.805	8-30	ARKIAKKGATKTLPGGSKHPTRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M021	Uncharacterized protein	0.975	277-305	KGRKKRYRKDHTGARQRKKQRATAAEKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2V5	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.856	92-110	KKRKQKNRGQNVGRKFGRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M566	C2H2 finger domain protein, putative	0.763	438-449	KKDPAGVRKRKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8W4	Uncharacterized protein	0.614	297-299	KRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9A8	C6 transcription factor, putative	0.682	29-37	RSGKKLWKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9A8	C6 transcription factor, putative	0.609	48-49	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH17	Patatin-like phospholipase domain-containing protein	0.693	70-89	VRRPFRSRTVSSTPKKTPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MID7	T5orf172 domain-containing protein	0.904	33-74	IKKTVRKKLYKRTIRRSSSSSSSPRRSSTRKSSPPFTNRRHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIZ6	60S ribosomal protein L3	0.947	24-45	PRKRAARHRGKVKSFPKDDPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIZ6	60S ribosomal protein L3	0.675	243-251	KKLPRKTHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM13	HTH CENPB-type domain-containing protein	0.694	460-468	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR20	Nuclear migration protein (ApsA), putative	0.663	440-447	TKRQRIKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR20	Nuclear migration protein (ApsA), putative	0.602	451-451	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT75	Uncharacterized protein	0.819	167-176	RQERERKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTB5	Translational initiation factor 2 beta	0.874	63-72	SKKKKTKKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTB5	Translational initiation factor 2 beta	0.857	95-102	KKKKKVKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTB5	Translational initiation factor 2 beta	0.651	303-306	RRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M262	SAGA complex component (Sgf29), putative	0.998	66-81	NKKKKRKAKKAKKNKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M484	Uncharacterized protein	0.999	857-917	KRPMVKKMKEKREERKKRKEEVKEEKAEKKKQEIEKKKEESKKRPAGKTLKDKPTTKPGRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M484	Uncharacterized protein	0.997	403-468	GKKTEKKSREEKVDKPSNSGKGSKGGTSSKGDKDRGRRGEKDRSPRRDKDKGLKGGRGYSKGGKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M484	Uncharacterized protein	0.797	195-204	KHRKKGKTRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Q1	Nuclear localization protein NPL6, putative	0.957	126-140	YPRKRRPGRPPKNPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Q1	Nuclear localization protein NPL6, putative	0.886	161-177	KRRRGRPAASGGRWGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6Z8	Uncharacterized protein	0.999	252-330	SKEKEEKERKRKTDGKQNGTEEKAKKSKKEKQQPSSQVEAESGGRRDKEKKSSKHRDETSQERRARKEEKKKRKAEKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBH6	Zinc knuckle domain protein	0.983	543-591	RQRRRSRSPASSHRPQPGSYSRESSGPRGRGGRGRGRGRGSDQYRPGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFZ8	Pogo transposable element, putative	0.836	470-494	KQERAQIRQKKRDEREKQAAEKERQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFZ8	Pogo transposable element, putative	0.636	402-408	KRRQIRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGL0	Ribosome assembly and transport protein Srp40, putative	0.894	391-404	KGFTKEKNKKKRGS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGL0	Ribosome assembly and transport protein Srp40, putative	0.772	196-203	KKAKKAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH68	DNA topoisomerase I	0.958	126-200	RKLKKQKANIEKKAEQEAKAIRKAEATSLKKTSTEKAAANGKKPKANGVKTENGVGTKKIKAEPSTPVKKGKGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMF4	Pogo transposable element, putative	0.734	412-422	KEKQKRQKSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPW2	ATPase synthesis protein 25, mitochondrial	0.883	197-208	KIKLRRKARRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSN4	Enhancer of polycomb-like protein	0.667	239-246	IRKTRGRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSN4	Enhancer of polycomb-like protein	0.623	251-255	EKLRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVK1	Nitrogen permease regulator 3	0.999	196-215	RKKSRRRKRKKPKSAEKRHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVP4	Sterol desaturase family	0.758	73-81	HKRRKISRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW60	PUM-HD domain-containing protein	0.997	17-76	KRTKTKTNAAPTAAGSKKKYLPPAFQKKGITRGARKMNRDKKLRKQGEKQKSSKKGHRKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW60	PUM-HD domain-containing protein	0.813	161-186	RRAAKPNADIIARSKKLWERLRRKSH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW60	PUM-HD domain-containing protein	0.65	678-685	KNKKVLEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYH2	Uncharacterized protein	0.902	73-88	KKKAKNKKLTRSQRLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1P7	Sec1 family superfamily	0.918	678-688	GKIKKEKKKHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5C3	COPII-coated vesicle protein (Erv41), putative	0.698	171-179	RNPRRKFPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M672	Uncharacterized protein	0.654	76-80	RKKNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M772	Sec23/Sec24 family protein	0.635	105-107	KKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF56	Uncharacterized protein	0.636	13-17	KMPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFV5	Uncharacterized protein	0.693	82-86	KRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK6	Integral membrane protein, putative	0.776	53-61	RRKARGRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MM24	Pogo transposable element, putative	0.699	479-487	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN11	HTH CENPB-type domain-containing protein	0.675	304-309	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN11	HTH CENPB-type domain-containing protein	0.623	372-375	KVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQZ0	RHOMBOID-like protein	0.963	125-137	ARKKRRRTRRGGF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQZ7	Uncharacterized protein	0.968	182-203	RLKQERRKKLSAEPEKKRKRDS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQZ7	Uncharacterized protein	0.777	144-152	RKRPRTKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQZ7	Uncharacterized protein	0.613	86-90	KTPRI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY93	Fungal specific transcription factor, putative	0.706	14-20	KGKKAPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2T1	Uncharacterized protein	0.972	1064-1086	KKKTIDGKASPGLKRAKAKRRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2T1	Uncharacterized protein	0.871	271-291	RRRRRGPALRETLRDARKPKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDE8	Protein kinase, putative	0.986	130-168	RRGRSPRGPRRDRNRKNRNAGNHQRGQSSQQRRPSRRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDE8	Protein kinase, putative	0.979	952-979	ALRKERDREAREARKDREREREKEKRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDE8	Protein kinase, putative	0.973	517-620	PPRGPAMRPPEQPSRNRMSGPPPPPKFKQDHRRDRDRDTHRGRGRDDRRDLHPRNPRDSRREDHRFDPRDARHRDDQRPDFRHDRRRDRSPEPKRQKRTVQRVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDE8	Protein kinase, putative	0.964	34-55	HERGKNRHRVRRRPSGPDRRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF87	LEA domain protein	0.772	44-55	KDNKTPRKLKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF87	LEA domain protein	0.764	79-91	RPAAGKKNVSKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJK3	MICOS complex subunit MIC60	0.854	232-247	KAKEERAEKKAPAKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJK3	MICOS complex subunit MIC60	0.745	103-110	PPKRKGRF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJZ2	Acyl CoA binding protein, putative	0.742	260-265	RKRRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN33	Uncharacterized protein	0.721	10-19	RLRKRHVRQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR28	Uncharacterized protein	0.815	47-57	LKEAKRRSRKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV9	FAM192A_Fyv6_N domain-containing protein	0.898	164-173	RKRKRNRKDF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXM9	Pheromone processing endoprotease KexB	0.796	777-783	RRGRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXV9	Exonuclease, putative	0.68	65-69	KKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Y5	WD repeat protein	0.844	364-379	ARARDKKKYKDEKRFR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8U8	Uncharacterized protein	0.617	9-11	RRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9J9	3-methylorcinaldehyde synthase tropA	0.915	1641-1655	KAAAPKKEKKRPGNP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG87	Dynamin-like GTPase Dnm1, putative	0.877	543-552	RKRREKRRLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH02	DNA excision repair protein Rad2	0.968	1115-1126	RKRRKKKEKSQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MH02	DNA excision repair protein Rad2	0.91	89-99	AARKKRREGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIC6	Uncharacterized protein	0.766	22-35	GSPRHSRRASGRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ7	Uncharacterized protein	0.96	631-647	KTKSKASKSKKKDKGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ7	Uncharacterized protein	0.924	4-23	KRKLPARERREPAAKRRVSE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJJ7	Uncharacterized protein	0.629	31-33	RRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS6	C2H2 finger domain protein, putative	0.949	517-526	KQKKGKKSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS6	C2H2 finger domain protein, putative	0.866	458-470	AKLGKAKQKRAKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW75	Nuclear localization protein, putative	0.886	83-93	RRKRGRPPKSS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LX14	Uncharacterized protein	0.669	85-88	KRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYL8	Uncharacterized protein	0.689	218-228	KKAAQKLKHKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYQ5	Uncharacterized protein	0.625	90-92	KRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYQ6	FF domain protein	0.814	504-530	ERDRRENALAERERRVEEEKRRLKGGL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYQ6	FF domain protein	0.752	355-365	KARKEKEEKKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1U0	Uncharacterized protein	0.721	23-41	KTGKRLWKTKQDHRASKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2J9	Guanyl-nucleotide exchange factor, putative	0.812	729-738	RKDPRKKRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M346	Uncharacterized protein	0.915	138-149	RNQRPRRKRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M346	Uncharacterized protein	0.833	372-398	ARRHRMRMSVLRPSTTKAGKKTRGGKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M471	RING-type domain-containing protein	0.986	173-194	HRWKEERDRWKKKKNEWKKKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAK3	Uncharacterized protein	0.822	203-214	PPAKLKKPRSRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAM3	Uncharacterized protein	0.747	14-21	KRRKIRKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET7	RNA helicase	0.992	715-730	KQKKREKKEKRKAKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET7	RNA helicase	0.786	10-27	ANKPKKSIENPRILKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET7	RNA helicase	0.667	641-651	RREKLLQSKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MET7	RNA helicase	0.652	784-788	KRSKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFI5	Spo7-like protein	0.612	365-367	RKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR2	Uncharacterized protein	0.658	261-267	RKKLFSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIR2	Uncharacterized protein	0.638	344-351	KEKDKEKI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNU9	DUF652 domain protein	0.68	5-16	KKVRKFAQVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR85	THO complex subunit 2	0.925	2167-2193	EATKSGRRDERRDRGRDRDRDRERNRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR85	THO complex subunit 2	0.69	2280-2298	GSGRGENRDRDRNRDRGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR85	THO complex subunit 2	0.618	1881-1884	RRAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR85	THO complex subunit 2	0.61	2132-2134	GRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR85	THO complex subunit 2	0.607	2146-2147	RR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MR85	THO complex subunit 2	0.602	2320-2321	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSM7	NIF domain protein	0.993	543-564	KQRAKSQKARRKTMKKHKKKHA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVG6	Uncharacterized protein	0.698	283-296	KARKQLKAQASRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZM0	Pogo transposable element, putative	0.675	377-382	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZM0	Pogo transposable element, putative	0.648	441-449	REAEKVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M030	SANT domain-containing protein	0.928	568-584	DKRHKSQTKGRRKPRTS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M230	Ribonucloprotein	0.997	5-36	KSEKKEKKEKKEKKRSETDGVHKQKKEKKEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M230	Ribonucloprotein	0.744	193-202	SGKKSKKSDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M230	Ribonucloprotein	0.723	98-115	KTVKKAAVNKSLKRGVKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4K0	Uncharacterized protein	0.76	185-196	IERRRQKMEKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7M5	Uncharacterized protein	0.824	198-210	SEKRRSNKKSLKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDE4	Uncharacterized protein	0.996	203-247	RKRFNRAEAAFKKAKDAASREIRRQREKKQREKQQKRREKQRIIQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MF48	Transcription initiation factor TFIID subunit 2	0.747	673-682	KRLKRNKRQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK46	Uncharacterized protein	0.787	179-185	EKRKKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTL5	Uncharacterized protein	0.861	10-22	QKKLSKKRGKLNA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTL5	Uncharacterized protein	0.697	105-112	RKGRPPSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVD1	HTH_Tnp_Tc3_2 domain-containing protein	0.842	277-299	RPRRGRKPVFKFTTKNGKLVRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXA2	Uncharacterized protein	0.711	1254-1259	GRKRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXM8	Uncharacterized protein	0.859	1345-1359	RKGWKKWLGRGKPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXM8	Uncharacterized protein	0.606	221-223	RLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXS6	Uncharacterized protein	0.996	197-241	KPDKRKKSKEESRDDSQESSKTRSSRKKAHEKRSKKVRFKGKARN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXS6	Uncharacterized protein	0.818	437-452	RFGHPGKPRMKRLVKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXS6	Uncharacterized protein	0.656	1120-1125	RKLKKF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBY5	Transcription elongation factor 1 homolog	0.892	3-17	KRKKSSRGPQGPKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJX2	GNAT family acetyltransferase, putative	0.746	199-211	KSKRWRRGVMARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK64	SH3 domain protein, putative	0.956	382-405	KGKRKDKKPGMLSGLFKRKDKKGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK64	SH3 domain protein, putative	0.685	214-222	PLKKAMRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMK9	Uncharacterized protein	0.992	159-207	SSRSHRRRDDDRRSKRSRHRSSRHHRDDRSESPRRSLSRSRSPDSRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMK9	Uncharacterized protein	0.975	80-145	RERMRKLRGERSPPSHRDRCSDKDRRYRDRSPHRRDKERSSRREHVDASSGREHKSRSERHRRRYK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP60	Nuclear envelope protein Brr6, putative	0.831	150-162	HARRIHKRKIRDR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPG1	HTH CENPB-type domain-containing protein	0.739	422-434	AKRKNQKSTRRHV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPG1	HTH CENPB-type domain-containing protein	0.688	39-45	RKKLSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRY4	Serine palmitoyltransferase 1, putative	0.747	606-615	KKGVKREKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVD6	CCHC-type domain-containing protein	0.99	42-83	KQKKSKEQSRDDSRASLKARSSGKKAHNRQKQKHKHKGRASK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT26	Uncharacterized protein	0.724	71-88	RAKRLAALAKKYRGEGHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.991	2288-2407	QEAEERRARRERQREQRERELREEMEREAQRREEKRARRAAREERRAREVQEAREAEARDVQMRPERRERRRTREAVEMSGGLSRHASKADRRRSERRSDDEYARHHRSGDERPRVSRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.979	2172-2238	PKERRSRKSTPAPIAKKPETGGLMGLFGSLRKPSKPEPQRRKSRSRRDEMTETEREEKRVKRERRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.968	223-242	GKKKKKSKKEEEEEEERRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.944	2077-2096	MGIKPSPSKREGGERRKRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.938	524-535	GKKDKKKAGKKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.903	1730-1745	ERSKREKAKEKAREKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.884	1459-1471	KERKKKEKEAKMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.883	1841-1864	PPEPSKKSKKSSSTKKSSTPAKTS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.883	2470-2482	RRKIRRQARRRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.839	1516-1528	KERKKKEKEANAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.818	2271-2286	RRARRRAAEQKARELE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.815	1948-1974	PPPKKSSKKTDEPAPVKEERSKASRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.813	936-942	KRKKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.81	645-657	RKKKEKEAVKKGI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.805	760-770	RKKKEKEALRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.802	1007-1020	KKKEKEAKTKGIPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.791	156-168	GKKQKAKLAAKKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.78	873-883	RKKKEKEASRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.736	814-820	KRKKKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.73	1208-1216	KKKEKEAKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.71	1337-1342	RKKKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.71	1399-1404	RKKKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.709	1070-1077	KKKEKEAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.687	1137-1144	KKKEKEAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.686	2125-2133	KSRRSKSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.671	1582-1589	KQKEAKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.668	2497-2504	RRRESRRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.659	280-284	KDKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.632	1926-1929	KKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.606	1781-1781	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUV1	Uncharacterized protein	0.602	707-708	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXU3	Uncharacterized protein	0.602	149-149	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M738	Uncharacterized protein	0.658	265-268	RRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M738	Uncharacterized protein	0.641	820-823	KKRI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA17	60S ribosomal protein L13	0.957	195-226	RRLREARAEARYRGAREKRAKDKAEAEEASKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA17	60S ribosomal protein L13	0.903	30-48	GRKHRRRQARLSKAAAVAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCI8	Telomerase reverse transcriptase	0.696	3-8	KKRKRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFV9	Integrase catalytic domain-containing protein	0.964	1000-1033	RRLRKRGIHVPDAPVMPPAPRRRGRPPGSKNKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGP4	Nitrogen permease regulator Npr2, putative	0.836	352-359	QRPRKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN13	Dimer_Tnp_hAT domain-containing protein	0.778	271-279	KSKDRRRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTG5	Peroxisome biosynthesis protein (PAS8/Peroxin-6), putative	0.897	12-23	HKRRRALRKRIR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUJ2	Reverse transcriptase	0.792	1233-1244	LKGAPYKGRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUJ2	Reverse transcriptase	0.741	531-552	KPERQKDKETEKDTKKGIPSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUX1	Integrase catalytic domain-containing protein	0.666	69-76	KARRIIRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUE2	MYND-type zinc finger protein samB	0.673	23-33	RAEVKEGARRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWD9	DNA-(apurinic or apyrimidinic site) lyase	0.886	339-355	PKRRASRKTRPTTKRST
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXN7	Ubiquitin carboxyl-terminal hydrolase	0.995	572-615	KSEGQSRKERVKEEKGRKAAEKEKEKADKQKRKEQEAKRREDLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXN7	Ubiquitin carboxyl-terminal hydrolase	0.803	736-756	KADKPDKDKGNKWKGFGIRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1F9	Uncharacterized protein	0.972	35-58	VKKGKERKIVRKQREKRVGLKDVR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U0	Uncharacterized protein	0.615	161-162	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U5	tRNA-splicing endonuclease, putative	0.979	1358-1391	RGPKGARPDNLPPRPPMPMRKKKEADPFIRPKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U5	tRNA-splicing endonuclease, putative	0.915	237-251	REKREKEREAKRKRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4U5	tRNA-splicing endonuclease, putative	0.699	1291-1306	KRKLPPSGPFAKNSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9N0	WW domain protein	0.994	250-283	LKAERSHKKLTKAEVKAFREKRRERKEEKRRAWL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME19	Sulfatase, putative	0.632	608-611	KKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFB9	MULE domain-containing protein	0.764	644-654	RGRRGRGRGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFG2	DDE-1 domain-containing protein	0.665	39-46	RKKLSRRW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFL1	PHD finger domain protein, putative	0.854	201-211	PKRRPGRPPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFL1	PHD finger domain protein, putative	0.78	1130-1142	KVRRTRRRYRGFR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGM8	Ribosomal protein L15	0.965	40-78	SRPSRPDKARRLGYKAKQGYVIYRVRVRRGGRKRPAPKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGM8	Ribosomal protein L15	0.792	153-178	KPVHKHREARGLTATGKKSRGINKGH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHK2	Uncharacterized protein	0.653	34-42	KPDIKGKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJ04	Uncharacterized protein	0.996	81-100	GRRKKNKAGKKKRAVKSRIP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLX3	Retrovirus polyprotein, putative	0.873	52-74	KRDTEKKKPSVRIIKIASRKKGH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVG6	Cytochrome P450 monooxygenase, putative	0.68	26-32	RQGRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTI7	tRNA(M5U54)methyltransferase	0.674	62-65	KKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVZ8	Glycerol-3-phosphate acyltransferase Sct1, putative	0.722	696-709	RIRGAMRERGKERR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWI1	Uncharacterized protein	0.95	269-352	ERKAAEEEEARRLAKIKRLEEMERKAAEEEEAKRLAQEKHLKEIEKREKIKAERDRIIKEIKDEEARKALEEEQRKKELAELKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWI1	Uncharacterized protein	0.654	32-37	SVKRRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXM5	Uncharacterized protein	0.843	85-99	KRKAYKSRSGHRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M094	Cellular morphogenesis protein (Bud22), putative	0.85	348-395	PQRKNRMGQQARRALWEKKYGARAKHLQEQEKNSKKSKNKDSGWDARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M094	Cellular morphogenesis protein (Bud22), putative	0.622	404-413	PKWAAGAGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2F1	Associated with spindles and kinetochores protein 1	0.841	322-358	RKAYRRSPQKRTPKPGISVLTPAKPRLSLLSKDKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M545	RNAPII degradation factor Def1, putative	0.981	141-175	RGSRGRGGFEGRGGRARGDRGRGGRGGRAGGARDE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M545	RNAPII degradation factor Def1, putative	0.75	11-30	PRGRGSARGGRGGYSSRGGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M545	RNAPII degradation factor Def1, putative	0.607	242-243	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6G8	tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase	0.649	336-340	KERKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAR3	MFS multidrug transporter, putative	0.751	280-287	KKRAKKLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBM8	WD repeat protein	0.838	38-47	RRKPKRPPPV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED8	Structure-specific endonuclease subunit slx4	0.952	606-640	TRKKKTTPSRLEPKTTSRAGKKKVSEKPLAGKADK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED8	Structure-specific endonuclease subunit slx4	0.86	133-166	SKAKATAASKSKDTSVVKAKAGTKKSKPASQNKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED8	Structure-specific endonuclease subunit slx4	0.814	280-291	VKTRKTKSKPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED8	Structure-specific endonuclease subunit slx4	0.724	94-120	KRGRPGSSEAKTAGSRKNSKSQETRNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MED8	Structure-specific endonuclease subunit slx4	0.603	128-128	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHF3	UDP-galactose 4-epimerase, putative	0.615	173-174	KR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLK6	U6 snRNA-associated Sm-like protein LSm1	0.852	134-147	AKEEEERKRKDKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLY5	Reverse transcriptase, putative	0.839	307-325	NRKKRLISKSLRLGHRRRV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ01	Signal sequence receptor subunit alpha	0.84	240-254	PEARKVKGARSKSRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ01	Signal sequence receptor subunit alpha	0.707	196-204	KRRGRESKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQA1	Zn(2)-C6 fungal-type domain-containing protein	0.75	61-72	RGPKKGHLKALK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT93	Uncharacterized protein	0.835	101-112	RRHRRNGKRRDP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUZ8	HTH CENPB-type domain-containing protein	0.936	470-491	NRAIKKRATAEEKKAERKRLKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVA4	HTH CENPB-type domain-containing protein	0.859	447-460	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWD7	Acetyltransferase catalytic subunit (NAT1), putative	0.942	595-620	RKKAIKKAKKEQQRLEKAEAEKQELK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWJ1	BZIP transcription factor CpcA	0.886	186-202	KRARNTMAARKSRRRKL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Z4	U3 small nucleolar RNA-associated protein Utp11, putative	0.988	216-243	QRKAVAHARAARKIKRRAAEGRRNKLAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Z4	U3 small nucleolar RNA-associated protein Utp11, putative	0.905	274-286	KKGVKFKIRERKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M380	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.83	133-143	KKSTKKRKTKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M380	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.77	536-550	AKKKQKQLEKGQKGL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M380	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.624	467-470	KKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M380	DNA (Apurinic or apyrimidinic site) lyase, endon uclease	0.624	555-557	KKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4F6	SH3 domain protein	0.718	800-806	KRKKAGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9Q3	SGT1 and CS domain protein	0.937	390-400	KKKKKDEKKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFP6	DDE-1 domain-containing protein	0.632	292-294	RKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLF7	Required for respiratory growth protein 9, mitochondrial	0.995	94-135	KKNSKSTSEKSKDRKNKPKEAKKIGIKKSTLPPLNPEKKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNA3	Uncharacterized protein	0.985	48-60	SKRRKKHKKKSAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSP2	Transcription factor TFIIIB component, putative	0.976	248-259	KPKKPRGKRKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSP2	Transcription factor TFIIIB component, putative	0.86	12-31	SGKKFAPKAAPRRAPAAAAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUI3	Integrase catalytic domain-containing protein	0.837	285-303	RRHGHPRAKMLQRIKKKLE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUI3	Integrase catalytic domain-containing protein	0.804	1058-1066	SRKKHKKLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUR9	Uncharacterized protein (Fragment)	0.69	21-29	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU95	HTH CENPB-type domain-containing protein	0.702	106-115	RKKLSRRWHG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY56	General transcription and DNA repair factor IIH subunit TFB4	0.984	353-363	LGKKKKKKKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZI9	HEAT repeat protein (DRIM), putative	0.998	2569-2619	RARREERRVKRRIDAVADPERFGREKRRKNDRKHVKRKERGHEFRERRRGF
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1P5	Oxidoreductase, short chain dehydrogenase/reductase family	0.885	232-244	KSKAGAKKKPKQK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1P5	Oxidoreductase, short chain dehydrogenase/reductase family	0.812	425-436	KARAAGTKKSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1P5	Oxidoreductase, short chain dehydrogenase/reductase family	0.702	394-404	AKRRALEKAKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4C9	DNA damage response protein RcaA	0.902	599-616	GRKNFKKFRRKGDRSAAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4C9	DNA damage response protein RcaA	0.843	738-744	KFRRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4C9	DNA damage response protein RcaA	0.621	520-523	KPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5C0	Nucleolar protein 16	0.996	7-29	KRKNRAKVPKLKKKRKLLRNGDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5C0	Nucleolar protein 16	0.643	192-196	KRRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5H4	Serine/threonine-protein kinase RIO1	0.998	539-587	KKPPRGKKHEDKEAKRQHKQKVKEEKREQRAKKMPKHVKKKIINATKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8E4	DNA excision repair protein (Rad26L), putative	0.996	89-146	NRKSIQRKRASLNERRARKGKAKETEKDGGISRRRRSAPARDSLVGRVPSEPSRKPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDK8	Mitochondrial large ribosomal subunit protein L1, putative	0.963	50-67	AKGKKNKQKESKKKVKGA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MII9	Uncharacterized protein	0.786	332-362	RAPKNRENKGGNGSGASKDDKKNKSGSDKLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML27	Peptidase family M20/M25/M40 protein	0.773	240-253	KNGKAARDKKPVRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP32	Dienelactone hydrolase	0.808	153-161	RKKRISKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MP32	Dienelactone hydrolase	0.807	475-487	RKPKKLGTPRKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ30	Uncharacterized protein	0.665	300-305	LKPRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQI7	Transcription initiation factor IIF subunit beta	0.891	156-168	KREARKKATKRKW
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRI9	Asparagine-linked glycosylation protein 2	0.997	813-861	KTKRKLKVDAEEKVAKAQEREAAREQRKREKEAEKERKRLEKEKKAKEK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRI9	Asparagine-linked glycosylation protein 2	0.924	1036-1048	KQRGRKTKKAKKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTA0	Aconitate hydratase, putative	0.97	204-223	RIKEKTKRRRRHVQRIKSKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV58	HTH CENPB-type domain-containing protein	0.857	467-480	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	H9CNM2	Ribosomal protein S5	0.906	75-88	EKKLRKEKLRRRSI
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTC5	Uncharacterized protein	0.746	7-17	RRKALQKRNRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LU52	Uncharacterized protein	0.811	267-282	KKRKRDATNSSRPRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVV2	Mediator of RNA polymerase II transcription subunit 19	0.919	416-426	SGKKKRKKVFK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWK5	MFS transporter, putative	0.876	546-560	QKRWKKAAEKAKRER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Q9	Cell division control protein (Cdc5), putative	0.946	174-192	GKKAKRKARERQLEESRRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2Q9	Cell division control protein (Cdc5), putative	0.6	274-274	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6E3	Uncharacterized protein	0.938	87-103	RESKEKSERGEKKKKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M752	Uncharacterized protein	0.813	406-429	RAPSPKRRDAGEGGSGSPPARKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8R6	Transcriptional adapter 2	0.896	157-174	RKKRRIEERKEAAKTAPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD85	RRM domain-containing protein	0.997	206-285	KSREKKSSSRRKDSRERSHKHRHHHHHHHHRRRRSDERSRERSHRELDDGSRRERHRRERSESPHRRQERSRERSRRERD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGW9	Uncharacterized protein	0.942	289-322	KSGRKRKNQPENGQDKGKEPTQQAPRGRRKRTRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGW9	Uncharacterized protein	0.713	339-345	RKERKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGW9	Uncharacterized protein	0.698	410-415	KRRRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHU8	Transcription elongation factor SPT5	0.916	97-105	RPKKRRRRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLA2	Pre-mRNA-splicing factor SYF2	0.752	237-245	RLKKRRDRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMU2	SMP-LTD domain-containing protein	0.776	834-864	RKPVPPAPGQSSEEKKEDKRPVPSPPLPKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNF0	Multicopy suppressor of stt4 mutation	0.918	353-362	KQKRARKKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M284	Uncharacterized protein	0.939	883-896	RATRGRGRPRKNKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M284	Uncharacterized protein	0.763	25-33	RRRLPRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2X0	Uncharacterized protein	0.722	7-15	RRRTRPRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4R7	Ribonuclease P complex subunit Pop1, putative	0.986	135-181	RRRKPTKILRIRLETARRLQSLNKKTKEKRAALKEKREKEAQSKSAL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4R7	Ribonuclease P complex subunit Pop1, putative	0.965	87-114	KVPRALRRRTASHNVKRVPKRLRARAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4R7	Ribonuclease P complex subunit Pop1, putative	0.959	188-218	TIAPRVPKVKKNKLSRPSPPVSKYRKRQRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4R7	Ribonuclease P complex subunit Pop1, putative	0.843	634-646	RKKEWEKRPKGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6T4	ATP-dependent DNA helicase II subunit 2	0.883	553-566	KKVPPKTKGRKRNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7R6	Uncharacterized protein	0.728	53-72	RRKRMQDERKANDGKGRTRP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFH0	mRNA splicing factor RNA helicase (Prp16), putative	0.644	848-859	REKERNDPVRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT97	Cell cycle regulatory protein (Srw1), putative	0.615	89-92	PSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT97	Cell cycle regulatory protein (Srw1), putative	0.61	81-86	RERTPG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVB4	Reverse transcriptase Ty1/copia-type domain-containing protein	0.872	279-302	DKKRKERDPDTPNEKKRNAPKPGV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVB4	Reverse transcriptase Ty1/copia-type domain-containing protein	0.65	309-313	KKLRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVF8	Uncharacterized protein	0.716	50-59	RKYKLRKMKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUF6	Casein kinase II subunit beta	0.784	337-346	RRKAPMRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUY2	DDE_3 domain-containing protein	0.834	171-182	KRRKWSRKQLKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVL1	Uncharacterized protein	0.903	178-199	RAMKEKEIKRRNKEKEEEAKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXW7	Chromate ion transporter, putative	0.839	225-235	RKLKSKLKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYS5	Protein kinase, putative	0.989	868-882	NKKRKHKEKKRARDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZY5	BHLH domain-containing protein	0.67	124-127	KRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG14	Uncharacterized protein	0.978	120-133	EAAAKKKGKKPKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG14	Uncharacterized protein	0.974	68-81	EAAAKKKGKKPKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG14	Uncharacterized protein	0.969	160-176	AKKAAAGKKNGKKPKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG14	Uncharacterized protein	0.964	255-270	AKKAAAGKKNGKKPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG14	Uncharacterized protein	0.862	214-228	KKAAAAKKNGKNPKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MG14	Uncharacterized protein	0.693	309-316	KKAAAKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIJ9	Pogo transposable element, putative	0.857	474-487	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKH8	C6 transcription factor, putative	0.778	43-50	RPRKRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNL9	Uncharacterized protein	0.967	319-361	SKAKRKRDEDTGYRPKGGRSGSNKKKKQETDSSHSGRRASKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPV7	ATP-dependent DNA helicase	0.745	150-165	RRRREQDRRAHRAARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ06	Urease accessory protein UreD	0.999	553-571	KKKKKKTQSKKKKKGKKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ06	Urease accessory protein UreD	0.846	368-384	QTKPAKKGDNRKAGKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQ06	Urease accessory protein UreD	0.64	424-427	KKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS01	Uncharacterized protein	0.69	197-202	PKRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSR6	SNF2 family helicase/ATPase (Swr1), putative	0.996	1647-1663	KAKKKSKRGKEHRIRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSR6	SNF2 family helicase/ATPase (Swr1), putative	0.909	61-83	SKKRKLAEGKRSTPRPISPPWKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MT46	PWI domain mRNA processing protein, putative	0.993	129-415	EARRRKEQERERERELETIRQKERSDRNRGFRDNRGGRGFDRRGSRSPRRYSPDRRGAPSRREFDSYVPRGNRRSRQSPRSYARSVSRSPSLSRSPPRRSYRSDERNRRRPRSASRSPSPDGRGYKRNRRRSPPYGDERDRSVARNESSSRSPSPRRTRRRYSSVSSRNPSRSPTPPRTRRGRDRSPSRTRVRRNTSSVSVSRSRSRQPSYKNRRRRSSSRRSEDRSVRGSKTDIAAKSRSFRDDRRLSRSTSSRRDRSVSRSPSPRGDRKRRRSLERYAPAARRRH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVB0	Integrase catalytic domain-containing protein	0.904	130-165	KEKFAPKPNREKALLIRRHRELMNPKRGMKPKEFSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVB0	Integrase catalytic domain-containing protein	0.865	1109-1131	KTSKRDRSPEPSPISRKRQRKLS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVB0	Integrase catalytic domain-containing protein	0.818	327-346	GKALRSVKEELQKKNKDKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXV8	Uncharacterized protein	0.769	400-407	RKRRGRPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LXV8	Uncharacterized protein	0.744	461-470	RKPGNRRSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY19	Rho guanyl nucleotide exchange factor, putative	0.804	1184-1190	ARRKKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0W9	Uncharacterized protein	0.954	21-31	EKEKKKRKRSR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4C2	DnaJ domain protein	0.976	449-465	KKSKDDKKKKKEHKASK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4C2	DnaJ domain protein	0.887	210-219	LRKKEKKKGG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHK9	RING finger domain protein, putative	0.802	90-99	RPHRRRREKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIN2	RNA binding protein Nrd1, putative	0.968	426-454	PGRRGGRRNDYRQRSPPGRRRRSPSPPHK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIN2	RNA binding protein Nrd1, putative	0.815	393-413	RRRSGSPGWDRRREASPPRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIP5	Uncharacterized protein	0.792	9-21	RETKNNRKKHHRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJK4	Uncharacterized protein	0.831	491-503	GRARRISRKAKMK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJK4	Uncharacterized protein	0.738	1088-1096	RRRNRRLRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKA3	Uncharacterized protein	0.996	253-271	ERKRRKKERRQAEKKARKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNU5	HTH CENPB-type domain-containing protein	0.811	326-335	EKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQG9	Uncharacterized protein	0.927	47-60	KAKIRKKKRISCKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV57	Pogo transposable element, putative	0.684	520-532	KQAKEAEKVKRAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV57	Pogo transposable element, putative	0.675	459-464	KKPKNK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVG9	Pogo transposable element, putative	0.912	475-507	RAKKEDKKLQQQLAKKAKEKEKQERAQIRQQKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVG9	Pogo transposable element, putative	0.833	428-435	KRRRIRKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW47	Chromodomain helicase (Chd1), putative	0.799	1046-1055	EERKAKRRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW47	Chromodomain helicase (Chd1), putative	0.791	1328-1341	SRKARRESEKPRQR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW47	Chromodomain helicase (Chd1), putative	0.714	155-162	APRSKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LW72	Homeobox transcription factor, putative	0.703	412-417	RRKRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M054	Pogo transposable element, putative	0.857	474-487	RAAHEKEKQKRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M4F2	Integrase catalytic domain-containing protein	0.867	150-161	KGTSRKRKSRRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M598	Uncharacterized protein	0.995	325-357	EKEREERRRRKAERDRVKEERRAKIRELRGKRQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y8	Ribosome biogenesis protein Kri1	0.992	608-620	GGSRKKRKRSKKH
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y8	Ribosome biogenesis protein Kri1	0.991	311-341	SRKKKREAEREKKEAERRERENQKNRLRKLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y8	Ribosome biogenesis protein Kri1	0.976	552-572	PERKRRDLKKMGKKARLRQWR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y8	Ribosome biogenesis protein Kri1	0.947	463-484	ATKKSRTKEKHDQKRAARKEKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5Y8	Ribosome biogenesis protein Kri1	0.938	410-417	KKKRKPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8Q6	DEAD/DEAH box helicase, putative	0.859	37-46	SKRARKPKRN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9F1	Chromatin remodeling complex subunit (Chd3), putative	0.615	238-240	SRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MAT4	High affinity methionine permease	0.666	447-451	RRRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBR7	Non-specific serine/threonine protein kinase	0.751	218-230	RERTKARDSRRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBS9	SNF2 family helicase/ATPase, putative	0.735	911-917	NKRRRRL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBS9	SNF2 family helicase/ATPase, putative	0.622	551-554	AKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC44	Protein SIP5	0.997	561-589	RRRKEEKELRKEAKKKEKEAKKAEKMMRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC44	Protein SIP5	0.755	71-86	EARRQEKERAARLKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGN8	Uncharacterized protein	0.959	226-270	ARFKPKLKASRESKAKEKISRKELEATVGRRLEDHEVKRLKKARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGN8	Uncharacterized protein	0.887	9-19	GDKKTKKRKHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLW0	EGF-like domain-containing protein	0.696	187-195	GKRGKPSLR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLW0	EGF-like domain-containing protein	0.62	171-174	KRGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVL0	Pogo transposable element, putative	0.772	441-448	AKKPKGKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LSX3	Uncharacterized protein	0.641	284-286	KKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWN9	40S ribosomal protein S6	0.982	131-205	KRLGPKRATKIRKFFGLDKKDDVRKFVIRRTVTKEGKKDYTKAPKIQRLVTPQRLQRKRHRIAIKRRRAEAAREA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWN9	40S ribosomal protein S6	0.952	215-237	SRVHEEKAKRTELRKRRASSLRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LWN9	40S ribosomal protein S6	0.74	87-96	RRTGERKRKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M693	MYND-type zinc finger protein samB	0.721	384-390	RKLRKKE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K9	Uncharacterized protein	0.964	340-384	KQKGKKRARDINDVSNNAPKRRRRPMASSVAQKKARAGRTLRNRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K9	Uncharacterized protein	0.901	25-56	RRRRKTTVESPTKPSADTKKATEPKTKRGRKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6K9	Uncharacterized protein	0.69	166-182	KKRSVKRAFLAVKEKLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M9V8	Origin recognition complex subunit 2, putative	0.958	164-179	VKRRAGRPKGAKNKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB68	Pescadillo homolog	0.976	607-673	KSSSKTKKYEAERRKEEEELERQKMMMSRKKRKLLDKMLYSNKKKEEEAQKLRSKRRKLENAAKTKA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MB68	Pescadillo homolog	0.666	48-52	RNKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MC21	Diadenosine tetraphosphate synthetase	0.936	180-189	KKKKKKVKDV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MCK4	Inheritance of peroxisomes protein 1	0.923	192-205	PKKKRAWRPKYRRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD19	Conserved glutamic acid rich protein	0.873	417-429	RKKHGRRKSVPRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD19	Conserved glutamic acid rich protein	0.803	453-471	HSPPRSPRRSVSRPKGGDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD19	Conserved glutamic acid rich protein	0.777	258-265	PRRRRRHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD19	Conserved glutamic acid rich protein	0.745	723-735	RERIRGIRRERER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MD19	Conserved glutamic acid rich protein	0.691	318-326	RRRGRSIPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEL8	Zn(2)-C6 fungal-type domain-containing protein	0.938	129-141	IKKSELKKKRKRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ML16	GPI anchored protein, putative	0.676	245-252	KRKQYRKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW8	RNA binding protein	0.999	130-172	LAEKEKEKKRREARERRGRNDKRKETKQKEESKKRKERKEREL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW8	RNA binding protein	0.978	4-41	RKRKREEATGGGAEQQKPKRVKNKVKYLPKGNKGRKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW8	RNA binding protein	0.943	331-371	KSETRRTKLKEKNQKLAEERAKNAQEEKKKKQQNKGGEEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW8	RNA binding protein	0.769	220-230	EKKAERKKDAP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MMW8	RNA binding protein	0.738	105-120	KKKSKGQLKREHQAAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MN34	Uncharacterized protein	0.684	66-78	GRKPPSFFIKRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQQ5	GATA-type domain-containing protein	0.741	94-99	PRRRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQQ5	GATA-type domain-containing protein	0.693	155-170	KENKRLKLERDEWKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTY7	Peptidyl-prolyl cis-trans isomerase	0.977	381-442	RRPPPSRDEKPLRRSHSRSRSPKIRGPAPRRFDDQHRDDRYRDGRNRDRDRDRDRDRNRNRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTJ3	Uncharacterized protein	0.717	24-35	PIRSRILRRARR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUQ7	AMPK1_CBM domain-containing protein	0.936	445-465	KEKKKKHRASGFFQKLKEKLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2G0	RNA-binding La domain protein	0.997	296-338	KIKAGNRNSGRGGRGGRGGRGRGRGRGGRGDNDRRDWRERRDE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2G0	RNA-binding La domain protein	0.6	341-341	K
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6S2	Fungal specific transcription factor, putative	0.631	714-717	KRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MA79	Uncharacterized protein	0.747	166-174	RRRGNKKRN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBH9	Calponin homology domain protein	0.908	408-425	RAKEAARKARSRSRSRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MEN8	F-box and WD domain protein	0.862	898-906	KRRRRRSHR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MGK8	Dedicator of cytokinesis domain protein, putative	0.625	1951-1954	EKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHU5	Uncharacterized protein	0.75	85-96	PPKKKISLRAAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MND9	Complex I intermediate associated protein (Cia30), putative	0.632	338-342	KAEKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRS7	Transcription initiation factor TFIID subunit 7, putative	0.989	55-76	APKPKKKRASKPKTEAGSSKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRS7	Transcription initiation factor TFIID subunit 7, putative	0.777	274-281	RKRRFRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MSA2	Pogo transposable element, putative	0.699	426-434	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVI9	HLH transcription factor (GlcD gamma), putative	0.851	265-275	KRRRRRASHNM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVI9	HLH transcription factor (GlcD gamma), putative	0.607	278-279	RR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LZG5	Condensin complex subunit 2	0.81	213-220	RRKAKKKT
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2R1	Uncharacterized protein	0.682	644-653	AARRERIRLK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2R1	Uncharacterized protein	0.616	1292-1296	KSAKP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5L8	THUMP domain protein	0.873	7-24	NRVSKPKKGGGNYKKSKG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M898	Histone h1.3., putative	0.655	99-103	SGKKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M965	Uncharacterized protein	0.699	537-542	RRKPRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBR6	Cell cycle control protein (Cwf2), putative	0.988	60-73	KKKKIIRRKKRPAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBV1	Sodium/hydrogen exchanger	0.685	532-544	PPSRSRSSARKTK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDW5	C2H2 finger domain protein, putative	0.934	653-679	KRWVPAKGHTEKGAQKKRDKSRTKESK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MI99	Uncharacterized protein	0.651	263-266	KRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKM1	PHD-type domain-containing protein	0.765	44-56	RGKKPRLAASKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MPV8	HTH CENPB-type domain-containing protein	0.694	465-473	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQR1	Uncharacterized protein	0.627	36-40	PPRPP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQR1	Uncharacterized protein	0.601	33-33	R
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MVL3	Transposon, putative	0.705	417-425	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY72	Smr domain protein	0.941	207-219	GKRKGKNKRSKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M266	Phosphoinositide phospholipase C	0.762	799-807	EKKRRQRSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M266	Phosphoinositide phospholipase C	0.619	170-172	RRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3E6	Elongation of fatty acids protein	0.817	522-530	PPKRRAKRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3M5	Uncharacterized protein	0.807	413-424	RSKSPPRKSKPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6S0	Ribosome biogenesis protein RLP24	0.811	41-57	KMKRQPRKVKWTKTHRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6S0	Ribosome biogenesis protein RLP24	0.775	106-123	RERVFTKKRLAGKLARER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7U7	RING-type domain-containing protein	0.995	735-792	KGSSSSRHEKESRKRDRHESDRGTDRERDRRRERDKPRDRDHERDRGKDRKRSRRERS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M7U7	RING-type domain-containing protein	0.975	664-708	RSPSQTARRSSHRSGKDGVHKSSHRSSRLRRRGSRSESRHRDRNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBV0	Chromatin-remodeling ATPase INO80	0.991	460-487	KEKSPSAKKRPSRPTPSARPKKSKEKKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBV0	Chromatin-remodeling ATPase INO80	0.97	369-428	KERKKDMQRKRRRENTVRIETAKKLEAERRAKRTVDPIEKEKLLREAEKAQKKIKGVKRA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBV0	Chromatin-remodeling ATPase INO80	0.949	1629-1649	GKKRSKTAKGPSKRAKTTKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MBV0	Chromatin-remodeling ATPase INO80	0.909	1575-1588	AAKKGKKAQYKKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFR8	Small nucleolar ribonucleoprotein complex subunit Dip2, putative	0.951	314-324	IARKRRRKKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKB5	Small nucleolar ribonucleoprotein complex subunit, putative	0.993	198-226	ERKRPDHPGKKKPIKLKFVKGLKKIRGSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKB5	Small nucleolar ribonucleoprotein complex subunit, putative	0.945	12-37	RKRKRDDRVAAPGSKKRGIAAKGNAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MKB5	Small nucleolar ribonucleoprotein complex subunit, putative	0.74	562-568	KSKKKKS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH2	Replication factor C subunit 1	0.992	1016-1028	KPKKGRKGKAKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH2	Replication factor C subunit 1	0.981	204-242	KAKPGRKRKTDAAFEPDEADKKPKKKAEPAVKKQKSAPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH2	Replication factor C subunit 1	0.976	984-1004	KYVKVPKAKKGTAKAKKAKAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH2	Replication factor C subunit 1	0.942	16-39	TAAPPAKPAPKEDPSAARKKRSRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH2	Replication factor C subunit 1	0.66	55-62	PKSKPVKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLH2	Replication factor C subunit 1	0.616	84-87	KRGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS5	Protein SQS1	0.994	315-349	DRNKKKAKKREREQLRAEGLLGKNKKKLDRRGKDK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS5	Protein SQS1	0.975	130-144	KRQARNKRKGRKNKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNS5	Protein SQS1	0.941	284-293	RKNKKKKGRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS34	Mitochondrial outer membrane translocase receptor (TOM70), putative	0.995	71-94	QPKKSKNQRRKEKKKAEEEKKKAQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS34	Mitochondrial outer membrane translocase receptor (TOM70), putative	0.774	246-263	KKVAEKKGKAIMEAKGKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUT6	Ribosome biogenesis protein ERB1	0.636	249-256	PSKHEAKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUT6	Ribosome biogenesis protein ERB1	0.605	245-246	RR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LYY2	Transcription factor RfeD, putative	0.885	58-86	RPRKSSITQNARKPKHDRTRSKEFARRPS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M0V3	Protein FYV4, mitochondrial	0.964	186-212	RGHKVDGGERRRAEVRAKKRSAERRAA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3E9	SWR1-complex protein 5	0.965	57-75	PTKKRKIDTSHRRGPKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M3E9	SWR1-complex protein 5	0.843	94-103	KAKSKKQKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5K8	Uncharacterized protein	0.996	14-43	ELKPKKKEEKRRLKESKKKSVDDTKSKKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5K8	Uncharacterized protein	0.992	118-136	RERRKKEKREKREQRRKHD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5K8	Uncharacterized protein	0.975	359-375	KKENKQKAPARKKRKNR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M5K8	Uncharacterized protein	0.799	70-77	KRSRKKRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M8X8	Uncharacterized protein	0.925	11-32	RARKLERAQQEKKGASAKRKKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDC6	DUF2013 domain-containing protein	0.744	459-469	KSKPPPPKSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFF3	C2H2 finger domain protein, putative	0.824	403-413	KKGKKEKDKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFF3	C2H2 finger domain protein, putative	0.638	134-137	KKPK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFF3	C2H2 finger domain protein, putative	0.613	144-146	KKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK11	Transcriptional elongation factor Iws1, putative	0.998	84-136	GRHKRKRRDDEEGEPKRKREGRREKRKRAQRDSDVESGDAKAGRRKAAKSRRE
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK11	Transcriptional elongation factor Iws1, putative	0.856	150-172	RRRRALDRAMDAAMKQKTRRRRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MK11	Transcriptional elongation factor Iws1, putative	0.705	402-417	RRMKARQLNAGKPSRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLU1	Integrase catalytic domain-containing protein	0.969	126-167	KKLKEKLAPKENREKISLLKRHRELTIPKKGMKPKELAKKWR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLU1	Integrase catalytic domain-containing protein	0.964	319-346	KDRSHPKARKLRWIKKQLEQKNKGKKEN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLU1	Integrase catalytic domain-containing protein	0.796	1093-1103	LPLSNKRRRKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MLU1	Integrase catalytic domain-containing protein	0.68	1081-1090	RKASKRALSP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRX6	Transcriptional activator HAP2	0.639	274-278	MRRPR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRX6	Transcriptional activator HAP2	0.62	260-262	GRK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MS02	Pogo transposable element, putative	0.699	407-415	EKQKRQKSK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M115	Nuclear migration protein, putative	0.719	1090-1099	RVAKGKPRPQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M1M8	Mitochondrial DNA polymerase catalytic subunit	0.96	481-502	VKGRKKGDPPRPAARQKKPGMP
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M2V8	Serine/threonine protein kinase (Kin4), putative	0.638	1072-1077	RRGKAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8M6S9	F-box domain protein	0.882	645-653	ARRRRRRAR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDV6	Topoisomerase 1-associated factor 1	0.973	943-958	ALKELKEKRRKRSKRD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDV6	Topoisomerase 1-associated factor 1	0.822	1042-1052	KSKKTTRRKRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MDV6	Topoisomerase 1-associated factor 1	0.684	570-576	KRRARAK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME68	RNA helicase	0.85	92-125	LRKKREADAAASKPKFLSKAERERLALEKRAKEV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME68	RNA helicase	0.809	232-237	KKKRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8ME68	RNA helicase	0.68	71-76	KKKKAG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFP5	Uncharacterized protein	0.799	15-23	KSKSKKKGR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MHM9	Uncharacterized protein	0.967	108-147	RLRRGTLARGRPGAGGARKTGKSRTANAAAANKRTQRRKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MQX2	Uncharacterized protein	0.755	106-116	RRQRRKSAHER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRT4	Uncharacterized protein	0.912	153-162	KKNKKNRKKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MRV3	Type I phosphodiesterase / nucleotide pyrophosphatase family protein	0.984	89-108	RIGKRDRSRRRERKRSIHGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LT35	DUF221 domain protein, putative	0.961	277-298	KAQMKKARAEARKAGKKATKED
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LTR3	Translation initiation regulator (Gcn20), putative	0.925	136-156	RVDRKKLEKAERKIRAKQDKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUW6	Uncharacterized protein	0.951	347-395	RERRDRENQEKRESRIREREAKKQQKELEKEQRHIARETKKQAKHDQKM
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LUW6	Uncharacterized protein	0.793	399-409	QIHLKRRRSKR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LVY8	Uncharacterized protein	0.688	30-34	RKRRR
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY80	Telomere silencing protein Zds1, putative	0.964	548-591	RSDSKKHKDKKESEGSRKSSWPWSRGSDDKDKKKESEGKKSKKQ
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY80	Telomere silencing protein Zds1, putative	0.687	237-242	LRRKRS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8LY80	Telomere silencing protein Zds1, putative	0.609	341-342	KK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFI6	Eukaryotic translation initiation factor 5B	0.999	111-204	KPKKGKAAPAPPKLEPAEEAEEGGKVKSKKEKEKEKKEREKQRKKEQAAKKKAATPAAPVKEEPVKAAPEVKAEPTPAPAAKIEPAGKKKKIPA
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFI6	Eukaryotic translation initiation factor 5B	0.998	237-283	RIRKLEEEEKKKEEARQRKKEKEREKKEQLRKEGKLLTKAQKEAKER
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFI6	Eukaryotic translation initiation factor 5B	0.939	55-66	KKNRSKKAKKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MFI6	Eukaryotic translation initiation factor 5B	0.924	310-326	EKKKMVVTNRKKKGPKK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIC3	Conserved serine-rich protein	0.801	583-590	PSKKRRKV
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MIC3	Conserved serine-rich protein	0.763	705-717	RVKAPEARKSKGK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJW4	Nucleosome-binding protein, putative	0.768	131-147	AREERRRTSKGGAGSKD
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MJW4	Nucleosome-binding protein, putative	0.761	165-174	KNKRAGPRKN
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNP6	Phospholipase D	0.951	268-285	LRLRRRRKTQRPRPTKEL
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MNP6	Phospholipase D	0.881	610-619	RRKMKKRRSS
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MTW3	Clr5 domain-containing protein	0.935	190-204	AERYATKKRRRRTRG
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MUY1	RNase H domain-containing protein	0.749	562-577	KGRPQAPRRGIKFARK
UP000001745	Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006)	B8MV87	Integrase catalytic domain-containing protein	0.92	1142-1167	PRRRIPSKRARSPEIATSKAERKRHR