ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS52	Uncharacterized protein	0.6	398-398	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT05	Uncharacterized protein	0.987	90-123	VKKPITPCKRKSKGDAAGERDGTPTKRGRKKKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY58	Forkhead domain containing protein	0.998	564-681	KPRQKTSLKLKIKNLPPVAPAKESKKAHKRKHHHRELTPEEPAPKKVKLKVKEAAKSKEAAARVSTKEPKAHKERKEPKEAKEPKDKDAVPSKEPKEPKEPKEPKDKGKAPAKTPAKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY58	Forkhead domain containing protein	0.991	307-324	GREDKKDKKKRRDRRPAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY58	Forkhead domain containing protein	0.844	755-772	KRKGPGRPPKDGIMSKRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2F0	High affinity glucose transporter	0.695	87-94	KPRRHQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3D4	C2H2-type domain-containing protein	0.651	376-381	KDRKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Y6	Uncharacterized protein	0.934	305-317	KTQKKRRKRGADK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Y6	Uncharacterized protein	0.623	270-272	KRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4G8	Ribosome biogenesis protein SLX9	0.985	107-125	ESMKKSKGAKKRKEKLEKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4G8	Ribosome biogenesis protein SLX9	0.918	43-71	KLKIKHSSFVSKIEKSSAKTQKRRRPNKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA09	Zds_C domain-containing protein	0.952	673-732	RSEDKKSDRKSKDKKDAEGPRKTSWGWFSGDKDKEKEKDKNHKDEKEKEGGTKKVKNKLS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA09	Zds_C domain-containing protein	0.859	776-816	RKKESARKTSSEGKKEKEPGLLSSIFGGKKKGEKESSYKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKR2	Poly [ADP-ribose] polymerase	0.612	125-127	KKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL63	Cel61b	0.717	518-523	KKRRRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPR9	ANK_REP_REGION domain-containing protein	0.631	344-347	KRHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQY8	Double-strand break repair protein	0.956	655-680	KKAPAKKAAAKTTKAPARAKSPAKKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQY8	Double-strand break repair protein	0.904	601-617	ATKKAAPAARGGRGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQY8	Double-strand break repair protein	0.724	582-591	KAAPRGRGKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQY8	Double-strand break repair protein	0.706	532-540	KVRKSKTKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXC9	WLM domain containing protein	0.954	190-237	AERKQRRILKKFGAGGKALGADDDTKVKLEKGVPKKGKPRVAGSARGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXC9	WLM domain containing protein	0.925	172-184	RRAGKRKRGGKDT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYL3	Uncharacterized protein	0.792	10-20	TKGRPGRRRLP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZS1	Rho-GAP domain-containing protein	0.672	251-263	KPKKQGLLPRSKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZS1	Rho-GAP domain-containing protein	0.65	74-79	RKRLRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2U7	Zn(2)-C6 fungal-type domain-containing protein	0.665	10-18	PRQRAWKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3T1	Uncharacterized protein	0.988	355-370	ARKGKKEKKGGKRAKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5U8	C2HC5 finger protein	0.958	84-99	RARPKKKKPGLNKLPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8I3	PDCD2_C domain-containing protein	0.967	96-133	RRKEGSVRGIRGVRIAKGAAKSAPAKKVEKKEVKQEEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAB9	ATPase family AAA domain-containing protein 2	0.996	28-53	KRAAPQRRRHKGTPGAKKKPSKRQRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAB9	ATPase family AAA domain-containing protein 2	0.873	352-383	KGKRSASESASGSGRRSNRLRGKTRQSGRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAB9	ATPase family AAA domain-containing protein 2	0.76	313-325	NLRNRAASAKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAB9	ATPase family AAA domain-containing protein 2	0.719	1274-1282	RKAREKREK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBA4	DNA mismatch repair protein	0.93	178-191	KKRKRPSASKARAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBA4	DNA mismatch repair protein	0.83	391-406	DKGKTPKKAAGGKENK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEF6	Pre-mRNA-splicing factor	0.905	766-780	PKASKKRRRGQVEVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGE7	Uncharacterized protein	0.938	140-150	GRKGKRKRKVN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKC9	Uncharacterized protein	0.888	164-194	RVERERLREVREKEKAEKMAERAREKAARDS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKC9	Uncharacterized protein	0.737	90-96	KKKQKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR77	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.992	10-122	RRRYSPRRDRSRDRRDRGDRYGGPGGGRYSDDRRGDRRDDRRDVRRDERRDERRDERRDERRDERREYRPRSRSPARRDRSRDRTYRRDDDRDRRSNSYRPGSRSSGRPGSRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR77	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.755	142-171	ERKKDPETLAKEKLADRAAKLAEWKKRNAE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR77	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.64	942-950	KARALEKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRF0	Cryptochrome-2	0.608	620-621	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS19	Mitochondrial distribution and morphology protein 34	0.953	358-376	RSRAGGMRKRKKRVVDLRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS46	SUN domain-containing protein	0.976	939-957	PRPKARDRGKKQKRSPLRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUS4	Decapping nuclease	0.822	29-39	RSPPRKRPRTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUY2	Uncharacterized protein	0.982	87-137	NSRKNKDKSQSRKQLRRKPQNKVSFPASRGKGALKPFTGGRSGGRIGKRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUY2	Uncharacterized protein	0.654	9-16	SKKANRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWQ3	DNA repair protein rad5	0.998	803-830	HKKKERKHRKHEHKHGKSKDKKHRKPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWQ3	DNA repair protein rad5	0.822	326-335	PRTRLRKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX85	Chloride channel protein	0.959	123-157	RRKARRRARDSIGVRRDGSSARVFLGRGRGKWRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXU4	Phosphatidylinositol-4-phosphate 5-kinase 1 (PtdIns(4)P-5-kinase 1)	0.893	257-267	RQKRASKRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZN9	PINc domain-containing protein	0.639	36-38	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZN9	PINc domain-containing protein	0.6	25-25	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W188	Uncharacterized protein	0.797	30-41	PIRRRPRPTRSP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2X4	Chromatin modification-related protein	0.904	208-226	PRKRKDRDRHSRPAGGRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2X4	Chromatin modification-related protein	0.901	749-761	KRAQGSKNKKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2X4	Chromatin modification-related protein	0.826	440-453	KKRPTARPSQKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2X4	Chromatin modification-related protein	0.614	727-729	RKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDQ4	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.603	541-541	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF36	Uncharacterized protein	0.683	190-197	PKDKKNKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHJ2	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.918	80-90	RGKSKKRKRDG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHJ2	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.868	426-451	KAEARKRGEAVGVDGEKNAKGEKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHJ2	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.86	202-209	PKKRKRKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB4	Uncharacterized protein	0.907	78-95	GPPSGPPRDARPRRPRRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB4	Uncharacterized protein	0.832	107-119	PPPRRRHRQERPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB4	Uncharacterized protein	0.827	169-184	ERDRRDKPRGDRERRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB4	Uncharacterized protein	0.795	50-59	DHRRPRKDRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB4	Uncharacterized protein	0.758	228-240	RRKSGRDAGKPGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB4	Uncharacterized protein	0.751	155-164	KSDRRRRDKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKH8	GlcNAc-PI synthesis protein	0.939	494-506	PRKRSSRHRKPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNG6	Response regulatory domain-containing protein	0.92	433-441	QPKKKRKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPY7	Uncharacterized protein	0.975	37-54	RLKKALINEKKRRKRGKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPY7	Uncharacterized protein	0.881	129-179	QEKKAREAADRASRQAARKAQQQLRQAQKTAQRGKRRCLKIATKAGSKKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQU6	HMG box protein	0.99	131-160	PRKTEGSPRPKATPKSKKAKAAKSDKHKTP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT06	Uncharacterized protein	0.911	72-91	PKKAIPTSTPRKRKAKAADA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT06	Uncharacterized protein	0.817	97-108	TTPSKRGRKNKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYL8	Uncharacterized protein	0.929	38-49	EPSKKRGRKPKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYL8	Uncharacterized protein	0.609	545-546	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYU0	PARP-type domain-containing protein	0.887	327-342	PEPKPVAKKTRTKKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYU0	PARP-type domain-containing protein	0.831	238-254	KSKKARTKTTKAKEAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYU0	PARP-type domain-containing protein	0.745	308-317	EKKSQAKKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W190	U3 small nucleolar ribonucleoprotein protein Mpp10	0.999	645-683	EKMSRRRRAKERAKKAGLNKPKEKKVEGKEKKRGEKKQL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W190	U3 small nucleolar ribonucleoprotein protein Mpp10	0.86	341-354	KAGKNKNTKKRGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W190	U3 small nucleolar ribonucleoprotein protein Mpp10	0.719	85-90	RKKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W264	Reverse transcriptase Ty1/copia-type domain-containing protein	0.902	1077-1091	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3H5	Elongation factor 3	0.993	1030-1055	QKKKAKLTSSEMRKKKKDRMARRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3T5	GTP binding protein Bms1	0.994	1081-1141	KVEKRRQKQQERKDPYKRKVKENEEKRAEREKREKQEYWAREGKKRKGDAGEGGGSAKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3T5	GTP binding protein Bms1	0.972	8-42	RPHRPKKEKKPHSGDKNPKAFAYAAPGKLKRQAAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3T5	GTP binding protein Bms1	0.772	316-324	ASGKKKRTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W562	Multiple RNA-binding domain containing protein 1	0.644	399-407	KKQKEIRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6L1	Kinetochore protein Mis13	0.977	121-163	KRRRSARISGDREQLEVRPKVPHPPPAKPRTKKVAPVEKEKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6L1	Kinetochore protein Mis13	0.682	216-226	RKGNKDGPRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W889	Uncharacterized protein	0.794	202-210	VKPKRKARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W889	Uncharacterized protein	0.719	105-112	KKASGRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W929	Thyroid hormone receptor interactor 12	0.935	65-93	RNKRSKVDEKDAPAQPPGRSKRAKGKAAM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W929	Thyroid hormone receptor interactor 12	0.856	106-125	KPTPQPSKRTKSARKSRGDS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB27	Uncharacterized protein	0.694	60-70	SRDSEKKAPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDM6	Uncharacterized protein	0.718	96-100	KKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHT9	Uncharacterized protein	0.979	80-157	RRKLTSQEKEAQRLEKEAKAKAREEKRAQKEADERLKAEQKAQRDEEKRRKNGEQDEKKRLKEEKQQRLEEQKAKKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLB8	Signal recognition particle subunit SRP72	0.993	633-652	QEKKAGVDKGKGKKKGKGKW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLB8	Signal recognition particle subunit SRP72	0.977	560-614	RSAPTKEAPSRAKRLRKARMPKDYEEGKKVDPERWLPMRDRSYYRPKGRKGKKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLF7	Uncharacterized protein	0.928	225-252	ARKSKRSTMKKSALRHKDTPRSRSSRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLF7	Uncharacterized protein	0.771	149-154	KKKKKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMV8	Zn(2)-C6 fungal-type domain-containing protein	0.638	73-79	RRPAKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMY7	Integrase catalytic domain-containing protein	0.963	1005-1021	QRRGRGRPKGSKNKPKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPR8	Uncharacterized protein	0.941	92-110	RRQRARRHQRGAGKRGGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR26	Uncharacterized protein	0.998	233-299	TRESKEVKDPKKEAKAKEMRARERMRKAKAAEKETARKEAAEAKARKEEQKAEAKRAKEEQKKSKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR26	Uncharacterized protein	0.955	160-173	RGGDGRKHKKKHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR26	Uncharacterized protein	0.839	424-477	RSRSARPSQDKDRARSSQDRARSSRPSSQSQSRPRPSGSRSRPSESPRKQQHRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWF6	Uncharacterized protein	0.991	134-192	EKRAAREAAKEVRMKEKAEKEAERARKKLNNNTKKPIRQSQNGKRKASKVNNNRNKGQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W160	SUZ domain-containing protein	0.887	410-421	SSAAGKKKPKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Z2	Integrase catalytic domain-containing protein	0.968	1167-1184	QPRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Z2	Integrase catalytic domain-containing protein	0.667	549-557	RGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Z2	Integrase catalytic domain-containing protein	0.642	524-536	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCR1	Uncharacterized protein	0.876	162-176	KSKKQRRLAAKRLRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WED6	Leucine rich repeat protein	0.611	244-246	KGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG31	Exocyst complex component EXO84	0.904	8-21	ISLRKKRGDKSKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI62	Mitochondrial GTPase 1	0.963	345-362	KKMERERRRERNKARGEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI98	Uncharacterized protein	0.981	492-519	PLPPVEKPKPAKANKRTQNKKGGKKNKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNW2	Condensin complex subunit 1	0.877	951-962	PTPIKKGRKRGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNW2	Condensin complex subunit 1	0.861	927-942	KRRKAEKEKKTAPTPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNW2	Condensin complex subunit 1	0.635	182-186	GRGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW1	Mitochondrial import inner membrane translocase subunit TIM54	0.876	260-273	KPKEEQNKPKKKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW1	Mitochondrial import inner membrane translocase subunit TIM54	0.862	146-155	ERIRKLRKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW1	Mitochondrial import inner membrane translocase subunit TIM54	0.641	67-71	KKRIQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV02	Neuronal-specific septin-3	0.647	9-12	RRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXM4	RRM domain-containing protein	0.947	435-493	RDRDRRFRDRDDYRPMRSPSPRALPRGVRSRDRSRDRFDTRYRSRSRTPPRRHRSPSPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXM4	RRM domain-containing protein	0.843	387-409	KPQRNTKKIEPQNPPPRRRSRSP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYB5	Uncharacterized protein	0.763	24-38	KKSRKATFRRRIFRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2P8	Armadillo repeat-containing protein 8	0.841	59-68	EARKGGKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3J9	Uncharacterized protein	0.989	545-581	KDWKWKGKAHTLAAHEKPGADKNKGKAKSRIRRGKHR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3J9	Uncharacterized protein	0.785	345-352	ARRKRRWG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3J9	Uncharacterized protein	0.771	2199-2216	KKYLRRLRHTKSKISSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W622	BHLH domain-containing protein	0.927	154-168	PKRPTRKRGRPKMDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBC3	Uncharacterized protein	0.852	365-372	KKKKKQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD70	Nuclear localization sequence-binding protein	0.982	410-457	RGGGFGGGRGGGRGGRGGFGDRGGRGGGRGFGGGRGGGRGGARGGRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD70	Nuclear localization sequence-binding protein	0.945	9-58	KSSKKDKKSELASVKAGRVTKPAATPKSKSKDIAKSVASNVKDKKKSKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEF5	RNA helicase involved in mRNA catabolism	0.953	496-546	RGGGGRGGPPARGGQNQRGRGQQGGGRGGAPRGGGAPAARGRGNIARTGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEF5	RNA helicase involved in mRNA catabolism	0.795	33-44	RPPKRQRKTKHV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN10	Protein kinase domain-containing protein	0.955	889-910	VRRGKIRRSKMSRSSRRTRPPH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNR8	Uncharacterized protein	0.697	36-42	SKRNRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPT9	U3 snoRNP-associated protein Utp7	0.979	477-554	KARRGEREPDKVDLLKKRGKGRNSALRRYLRKSGSRNVIDEEKERAREAMRSLQKRQVEKRERLKKEYGPALERFARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPT9	U3 snoRNP-associated protein Utp7	0.78	47-61	RIRPKSVKDKKLRSN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRC8	UDP-glucose,sterol transferase	0.99	778-802	KSIRKREKLKAKKRIVQKRNEHKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRC8	UDP-glucose,sterol transferase	0.823	100-109	RTQRPRKKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV80	Integrase catalytic domain-containing protein	0.958	659-675	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV80	Integrase catalytic domain-containing protein	0.658	48-55	RGFKPRWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV80	Integrase catalytic domain-containing protein	0.639	23-35	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ93	Condensin complex subunit 2	0.828	211-217	KKRKKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ93	Condensin complex subunit 2	0.826	571-588	KPKARMGSRREGRRAQAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ93	Condensin complex subunit 2	0.712	497-508	KHVEKAPAAKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7T1	Uncharacterized protein	0.841	38-52	KPASKPRPQRRSPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W954	Uncharacterized protein	0.779	440-448	EAARKARRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W954	Uncharacterized protein	0.688	473-478	KERRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA32	Uncharacterized protein	0.759	215-227	RRKVKRIRQLAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA32	Uncharacterized protein	0.678	25-30	RKRARS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCR8	Fe II 2-oxoglutarate-dependent dioxygenase	0.832	94-106	KSKKSSKKNGKAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDC7	Splicing factor 3B subunit 1	0.858	188-197	PIKKTRKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFQ6	R3H domain-containing protein	0.854	99-114	RGGRGGGRGGRPRPGP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFQ6	R3H domain-containing protein	0.693	580-588	RASNRRKPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFQ6	R3H domain-containing protein	0.672	21-26	RRRRNP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFQ6	R3H domain-containing protein	0.623	167-171	KSRPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLF5	Anucleate primary sterigmata protein A	0.758	446-460	KRRKSDKEMFKKPAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMP3	DNA damage-inducible protein 1	0.677	444-451	RRQRQRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMX7	Uncharacterized protein	0.83	292-305	GKKGKTRLPKRLVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMX7	Uncharacterized protein	0.691	158-167	RRTPRPPKPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMX7	Uncharacterized protein	0.626	260-264	SRVRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQS4	NAD-dependent histone deacetylase SIR2	0.991	484-510	ANKGLPKRPKAQPKKAAASRKSKKESK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQS4	NAD-dependent histone deacetylase SIR2	0.706	78-84	PSKRRKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRK4	Ark1/Prk1 family protein kinase Ppk30	0.877	722-737	HKHRRSSSPRKHGKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRL2	BAG domain containing protein	0.998	254-272	GKKKSRKRGGRKSKKKGPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUA9	Mago-bind domain-containing protein	0.952	132-156	KEKEAKKLTKKLRQARELKEKKDRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUA9	Mago-bind domain-containing protein	0.927	85-101	SPAANKNAKRREARKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYA1	Uncharacterized protein	0.622	645-648	RHKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Q7	Uncharacterized protein	0.845	278-287	AKRFNRKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3F9	Chitin synthase	0.945	822-834	KKRKRLSKQKPSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7K6	Uncharacterized protein	0.901	98-114	KSQSRRRQSRGRGRRGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7K6	Uncharacterized protein	0.894	34-49	SKKTERKTPKKLGGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7K6	Uncharacterized protein	0.875	130-144	GGRRNRQRQKKGGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W886	Uncharacterized protein	0.842	248-273	RRRDRDGRRHRTQHVRAPRQPVPRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCS7	Transcription initiation factor TFIID subunit 2	0.96	1238-1290	RPSVAPPARPAATATPAPTPKHIIKQKRSKIVKLRLPPHHLARIRDRDSKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLM0	60S ribosomal protein L2, mitochondrial	0.998	239-272	WRKRAVRIKANEEKKRLRNAGKKSSKPKARKARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMR1	Uncharacterized protein	0.916	35-77	RGRLKRRRQSSQHSPRRASSPSRGHDRHSGSRYRVHHRKHHRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMR1	Uncharacterized protein	0.663	143-151	RKRSAPPSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQY7	Uncharacterized protein	0.632	723-727	RRSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWQ8	Uncharacterized protein	0.91	192-214	EKARKVVSNVKLQRILGRKWKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWQ8	Uncharacterized protein	0.783	170-178	KTPKRRKGL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2P2	Uncharacterized protein	0.997	254-273	PYKPKAPKKSKSKPKKKKSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5I2	Uncharacterized protein	0.793	35-49	KDRDKLKERVKKARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX6	Patatin-like phospholipase domain-containing protein	0.99	79-94	RVKRRKKSKAPPRRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD03	Cell cycle checkpoint protein RAD17	0.957	63-89	PKPSKAATTKKSPTKKAPAKSPAKSKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD03	Cell cycle checkpoint protein RAD17	0.702	842-846	RKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD38	C3H1-type domain-containing protein	0.791	305-329	KDRRRHFPTEKSKIEKAEEAARKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD38	C3H1-type domain-containing protein	0.65	65-74	RGRGDGRGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDC4	rRNA-processing protein	0.996	22-119	KKNGKQWHDNKAPFRPKAGQSSWEKRSAERAALAAVKAKEKELKEEKESERQRRVEAIKTKRAAKEERERFAKMEEKMHKRRVERLKRREKRNKMLKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDJ4	Nucleolar protein 12	0.998	525-562	SERQGKSGLKFKGSGGKKKGPNGRKSRSAGWKKSGGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDJ4	Nucleolar protein 12	0.974	451-484	RKLRITRCKAEKKKDKPRGPPPSSSKSQRGNGKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDJ4	Nucleolar protein 12	0.934	143-157	KGAQEKSKKRKRGDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDJ4	Nucleolar protein 12	0.719	5-20	KDKRSAKTESPKKSEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKG6	Cytochrome b5 heme-binding domain-containing protein	0.977	199-254	KARKRKKLTKGELKNRHAQELKSARKQVAAGLESWHKLFRGDKGKKYRRVGTVKRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP15	Uncharacterized protein	0.941	14-32	RRQRARRHQRGAGKRGGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPM8	SAS4 domain-containing protein	0.873	512-521	RQRRRRKRES
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPM8	SAS4 domain-containing protein	0.681	434-439	KPRRPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPP8	Uncharacterized protein	0.826	191-209	RSKEEERRVRKMREKIEAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPS2	Uncharacterized protein	0.781	129-139	KRKDAKRRFKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTX1	Uncharacterized protein	0.864	401-416	RKRKPKPVRWNEKRQE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M2	SAE2 domain-containing protein	0.863	327-347	LKRKRRPSNVPEEPPTKRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M2	SAE2 domain-containing protein	0.812	397-416	TKAWPKTSKLGPPKIKKEQV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M2	SAE2 domain-containing protein	0.675	430-440	PVRAAAKSRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M2	SAE2 domain-containing protein	0.611	425-427	RAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7Y3	Protection of telomeres protein 1	0.856	344-359	PKAKTAKEKRQAKKEI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9L2	Uncharacterized protein	0.99	650-703	RRSARERSQRHAQDAERRAPEKKADNKVTKRRPERGARGELERYDPRKRFGRGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9L2	Uncharacterized protein	0.892	545-585	LEKKRQLEEAEIKRARDAKDLQKLEREEKKQAREAERRRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9L2	Uncharacterized protein	0.805	295-310	KGPRKRTPNHREGARG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9L2	Uncharacterized protein	0.798	408-432	SRSPVDRHGSSRYKSRSRARNASRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9L2	Uncharacterized protein	0.637	531-541	RHRREQDKIKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA34	Uncharacterized protein	0.951	131-160	RKAERDAKTAVKRQTLPSRKPSQHKRKKPS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAI7	Transcriptional repressor rco-1	0.823	36-44	GSKKRKREG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCR0	Uncharacterized protein	0.98	916-943	KELEKKAQEKEKKGGKLSWWKKKKADKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCW5	Uncharacterized protein	0.732	703-720	RKNSPAPKSLVKRKSFPS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD36	Phosphoinositide phospholipase C	0.97	184-208	RKEKKKSKSGLSIRKRLAAKFSKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD36	Phosphoinositide phospholipase C	0.622	382-387	PPAPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDF5	Rho-GTPase-activating protein LRG1	0.695	790-798	KADKTKPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDM9	Uncharacterized protein	0.728	84-100	RKGKKLASTPTTPKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDM9	Uncharacterized protein	0.661	120-124	KKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJH0	Zn(2)-C6 fungal-type domain-containing protein	0.677	72-78	APRKSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPE1	Uncharacterized protein	0.975	251-292	RRKRVGEEKVEKVERGGDGGRVKEKRVLRERSRSKEAKAKVV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPE1	Uncharacterized protein	0.794	207-233	KRRKRTSSSPKPISTRTSSNSPRRLRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPP9	Vps8 domain-containing protein	0.645	1495-1498	RRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK5	Uncharacterized protein	0.999	119-139	LKKRDKKKAKKTKKKKKVETK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVI0	Cir_N domain-containing protein	0.994	300-382	EERQSRHHKRKRRDRDDTEDRARHAERPRSRHVRRSRSPSRSRDRHAHIFSHRSEKRNHRSRSRERDRGHDRERHRGRRHGEH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVI0	Cir_N domain-containing protein	0.98	74-109	RGRTPPPLPEKVPKHEDGSGRVKEKHEGGREKKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVI0	Cir_N domain-containing protein	0.742	274-294	RSKQDKKRWAEERDRELRELR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVI0	Cir_N domain-containing protein	0.647	184-187	KRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN1	Protein SQS1	0.923	3-26	RGKKQGKNKAKASPGKNTPHRAPY
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN1	Protein SQS1	0.91	544-553	LKPKKKGRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN1	Protein SQS1	0.821	577-590	VKKRLKKAEREELR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN1	Protein SQS1	0.604	597-598	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYE1	MRC1 domain-containing protein	0.993	1258-1289	REAERRALLEKKEGKRKEALRKKVEGGRKKGV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH4	Involucrin repeat protein	0.893	155-170	SLGRLASKKGKGHKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH4	Involucrin repeat protein	0.679	493-498	RKRERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W107	RING finger domain containing protein (Znf1)	0.898	60-71	RAPPKKRGKRDT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W107	RING finger domain containing protein (Znf1)	0.606	41-41	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W180	ABC1 kinase family protein	0.864	62-74	AGRSAKSSKRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Q0	Chromosome_seg domain-containing protein	0.98	258-273	LRRKEKKKRRSTSPKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Q0	Chromosome_seg domain-containing protein	0.727	223-228	GKRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAC9	Spc7 domain-containing protein	0.942	87-101	KKRREARRKSLARRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAC9	Spc7 domain-containing protein	0.922	26-47	SPKKAALSPKKSSRKTRSKSIG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAC9	Spc7 domain-containing protein	0.915	678-711	PKKSQTPQKQQTPKQKTPTPKKATPRKSMSPKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAC9	Spc7 domain-containing protein	0.877	1219-1230	RLKKTGRKGERK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAC9	Spc7 domain-containing protein	0.637	375-380	RKSLKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAW8	26S proteasome regulatory subunit RPN2	0.694	934-944	RRRMVKERQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCE5	Metallophos domain-containing protein	0.942	630-651	RARVKFYGQPGAGGKKRKMRKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCW4	Uncharacterized protein	0.901	1067-1084	KEAQRSREKKHKHGHRHH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCW4	Uncharacterized protein	0.845	549-564	GTKSRSKSRSRRTKSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WII9	F-box domain-containing protein	0.929	17-37	MRSGKEPKEPGTRKKLSKKGS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJC2	Sphingosine N-acyltransferase lac1	0.755	10-19	RRSKRRTTRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS03	Autophagy-related protein 17	0.915	391-402	RRRRHEKAKRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0R6	Uncharacterized protein	0.841	173-183	RSRKTRRPKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W479	Uncharacterized protein	0.999	8-74	KEKKRVEERQKAEREKVEKERRKGEKREKEKTRGAVAGKQAKGVVPVKTAGKKVVVMPKTGGGGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4V3	Uncharacterized protein	0.925	120-145	KKNRAPRERDRDKAGEDRDRKHKLKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4V3	Uncharacterized protein	0.905	581-599	KRNRNIGKGKKQNKRPGGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W939	Uncharacterized protein	0.931	284-311	AKEKGKKREASPGDGPSEKRKTQTRKGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA40	Uncharacterized protein	0.699	341-346	GRKKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA40	Uncharacterized protein	0.606	54-54	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA40	Uncharacterized protein	0.602	52-52	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBQ6	MICOS complex subunit MIC60	0.958	113-125	KPLPKKKRRRFRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC75	Uncharacterized protein	0.954	299-327	KPKRKASPPIAGAHSSNKDRRAIKKARKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGQ4	ISWI chromatin-remodeling complex ATPase ISW2	0.861	170-187	PKRRRAPPKLDTARARLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGQ4	ISWI chromatin-remodeling complex ATPase ISW2	0.678	365-372	DRKASRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHD1	DDT domain containing protein	0.998	791-837	RTRPSNKNKRKAAAEEARKEKAKKAKAEAKAEAEKLKKQKEWEKLLA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHD1	DDT domain containing protein	0.984	1065-1084	PPRKARAKVAKGGKVKGRGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRY2	Uncharacterized protein	0.769	18-31	RRISDKRLERKEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTU9	BZIP domain-containing protein	0.85	151-159	PKRKRGRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUC1	Zn(2)-C6 fungal-type domain-containing protein	0.632	48-54	RGKHVRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVP7	Ubiquitin C-terminal hydrolase family protein	0.994	826-863	KDRKDSGKIKKEKKDRLRSKSRDPGAALEKGKHKDKNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVP7	Ubiquitin C-terminal hydrolase family protein	0.696	11-21	REKHHEKRASK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXD8	Uncharacterized protein	0.902	621-632	VKKKKEKEKEKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4U8	ATP-binding cassette protein	0.626	69-72	GRRL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4U8	ATP-binding cassette protein	0.601	66-66	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9X8	Uncharacterized protein	0.692	58-67	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAB7	Uncharacterized protein	0.806	41-50	PRRRPGRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBH0	Cytochrome b561 domain-containing protein	0.869	514-525	ARRRERKNKARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBH0	Cytochrome b561 domain-containing protein	0.747	617-627	RRRRRAERAQA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF11	Transcription factor tfiiib complex subunit brf1	0.921	594-604	KPKKPKQKRKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF11	Transcription factor tfiiib complex subunit brf1	0.901	332-357	LKVKAQPPAIWRRAEREERVEKRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF11	Transcription factor tfiiib complex subunit brf1	0.84	456-464	KKRGRRPKM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF14	Uncharacterized protein	0.997	133-195	VKKAKVESAKPAPKPKAAPKPKAAPKAAPEPKAKTPTPQPEAAKVNPALVPNPKGPRRPKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF14	Uncharacterized protein	0.974	67-115	PKKRKVNASKPAPQVTKKPAVPARSRVKKTETPAPEPKAATKKTTKRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF14	Uncharacterized protein	0.68	14-35	PVEKKESKEVKTNGAASRRGAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLJ5	Chromo domain-containing protein	0.861	5-20	KRKRNPSRMTPRKRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLJ5	Chromo domain-containing protein	0.824	209-220	RTRPRPRPRPRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLM6	DEAD/DEAH box helicase	0.654	1704-1709	KKKFKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRI2	RNA-binding protein	0.997	18-37	KKERREKKDKKEKKDKKRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRI2	RNA-binding protein	0.913	83-94	SKKAARKAKKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRI2	RNA-binding protein	0.862	331-339	KKPGKKRKW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRI2	RNA-binding protein	0.833	391-416	GGDRRFGKQEKSGGKPDGRDFKRKVD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRI2	RNA-binding protein	0.715	231-243	GRGAKGAGKPGHP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRT0	Uncharacterized protein	0.901	1202-1224	RPTAARGGRGRGKPGLGRPMIPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTV6	Uncharacterized protein	0.757	233-242	RLRRRVRGPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTV6	Uncharacterized protein	0.662	195-198	KKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV82	Integrase catalytic domain-containing protein	0.634	977-982	RRPNRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVD3	Uncharacterized protein	0.983	191-216	RRPKTRKPKEGAERRRSSTRSKSRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWH4	MCU domain-containing protein	0.971	493-507	LKKERKRKEDKKKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXU0	Flavin_Reduct domain-containing protein	0.62	778-782	KKEAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1L8	Type 1 phosphatases regulator	0.941	148-169	KHRRQRRKPSPNAYEKMPKQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2B7	Uncharacterized protein	0.723	270-289	GGKDRDGERDGGRRGNGSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2B7	Uncharacterized protein	0.603	266-266	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8S3	Sec7 domain containing protein	0.609	489-490	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAQ5	Annexin ANXC4	0.918	10-30	RRSRSKSPGRGRERDRSRSHN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAQ5	Annexin ANXC4	0.847	382-399	SSSKGRHVRRRTRSTSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBN5	Uncharacterized protein	0.841	4-18	KGKGFLRPKPKGKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCR4	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16	0.806	964-976	KRPVLGKSKFRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCR4	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16	0.678	7-11	PKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDR0	Uncharacterized protein	0.775	72-78	GRRKRKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEL1	Non-histone chromosomal protein 6	0.983	5-30	KTTRKAAPKSKADGGKKKKDPNAPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF31	CUE domain-containing protein	0.954	105-163	KKVKDRSRSKAKENIPIDGASSLRGRPDGARRGVDSGRGGRGGRGTDRGRGGIRGGRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGV1	RNA exonuclease 4	0.999	345-358	KKKSRNRKKKKKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGV1	RNA exonuclease 4	0.891	40-81	SSLKRKRPQHGDGKHRDESAKAVNGSVKNTPRKPLPSRKRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH51	GTP binding protein (Bud4)	0.948	824-856	KTSAERKPAWTKEPWIGKPRRKSIRTASGRRQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH51	GTP binding protein (Bud4)	0.647	1000-1003	KKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKY3	Integrase catalytic domain-containing protein	0.768	433-472	RRIRGGSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMY9	60S ribosomal protein L18	0.986	161-189	HSHKKPYVESKGRKFERARGRRRSRGFKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNL0	Helicase swr1	0.676	52-56	ARKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ52	Uncharacterized protein	0.975	396-409	EAKRARRRRGKRNA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQN3	Uncharacterized protein	0.955	78-101	GAKAGMKRKRGVKSLPATKRRTTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQN3	Uncharacterized protein	0.76	382-401	AKAAKPEKAEKPATRSSARL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRD2	Developmental regulatory protein wetA	0.856	497-512	KTKARREKEAADKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSM8	TRP_N domain-containing protein	0.798	598-605	HRKKRKEA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVN1	Cap binding protein	0.737	15-28	RDRGGYRGGNKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ51	Uncharacterized protein	0.836	164-183	KGARWRWRSMKKSWKPSAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZM3	Pre-mRNA-processing factor 39	0.87	547-564	HKKRKGQPHNAVNKRQRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0I4	Uncharacterized protein	0.747	105-114	KRLGKKRSSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0I4	Uncharacterized protein	0.637	295-302	PRSPKSPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5M7	RNA-binding La domain containing protein	0.936	62-87	RRNDRDDRNGRPGRGGRGGRGGRGAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5M7	RNA-binding La domain containing protein	0.924	383-406	WNKRRDRFKSGKNDRGSRKEEKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5M7	RNA-binding La domain containing protein	0.857	355-376	RGRGRKTNGHRDRDNRRRDRSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W685	Ubiquitin carboxyl-terminal hydrolase	0.848	400-410	RARKRQKRMKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W685	Ubiquitin carboxyl-terminal hydrolase	0.623	427-429	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7N3	Uncharacterized protein	0.923	121-134	PPKKTLKRKKTKPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U5	Uncharacterized protein	0.861	916-930	MKNGKGGKKEQRSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAS4	Uncharacterized protein	0.997	686-720	LEKKKQRRKEKLYRKQHRKGTKEKRPAPGRGAERM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAS4	Uncharacterized protein	0.996	553-605	RGRRKDIHKKRSPLPSPKRLRSPPPAKRGAHRSPPPRKLFGNSPPNRLHSPPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAS4	Uncharacterized protein	0.82	447-456	KPSKRRKSKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAS4	Uncharacterized protein	0.64	493-498	RRRAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI21	DNA polymerase epsilon subunit C	0.945	143-154	KKKKTSTRKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLB5	ATP-dependent DNA helicase II subunit 1	0.964	561-592	RGKPVAKKRPAGGADADGKPAAKKVKKDPKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLQ7	Spindle pole body component	0.815	657-667	RARMRRSRKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMW2	ULP_PROTEASE domain-containing protein	0.995	963-996	PKSAKKKKQKETEKGKRKATSPPASSLNKKKQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMW2	ULP_PROTEASE domain-containing protein	0.966	181-219	KAKERVAENYKRAKEAKEAANKAKEAANKAKEAAKKAKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUB0	Uncharacterized protein	0.688	20-26	RPLRKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV57	2OG-FeII_Oxy_2 domain-containing protein	0.87	67-104	SPRKRTTTTPKTTAKRSSRKPATTTKRGSQISKGLKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV57	2OG-FeII_Oxy_2 domain-containing protein	0.814	48-58	RPKRERKPPEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYC0	Carboxypeptidase S1	0.964	560-579	KKREARRIARPKMWKGGKRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1V2	Uncharacterized protein	0.737	8-24	RIQREHKKADKAGTRAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2P1	Uncharacterized protein	0.998	169-232	KERKRTRKGKKARIAIRQKLQATKEKQTEQARLAQEKAEAEREKRTRRNREKKLKKKAKGQAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4B1	Nodulin-26	0.65	399-402	RRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAU1	Leucine rich repeat protein	0.947	637-650	GQESQKKKKGPKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBZ0	Phosphorus acquisition-controlling protein	0.735	542-554	KKNAKSARNPKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE07	C2H2 zinc finger protein	0.998	551-580	RKKKEEKDAAKEAKKEGKKKAKEIKKVAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE07	C2H2 zinc finger protein	0.626	86-90	REARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG49	Ion_trans domain-containing protein	0.973	1088-1100	KKKGKGKKKSVKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG49	Ion_trans domain-containing protein	0.809	878-889	PMSPGKKRAKPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH52	Histone-lysine N-methyltransferase SET9	0.972	644-657	AKKMKKKGGRARKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJN3	Uncharacterized protein	0.882	986-1009	EEKKKHGLLGFLHRDKSKREKKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLX7	Nucleolar protein 16	0.958	7-26	KKKNKSSIPKKRQNGPSKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN39	Ubiquitin	0.995	73-99	LRGGAKKRKKKVYTTPKKIKHKRKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNG4	Uncharacterized protein	0.979	89-124	LARKKAEEAASKNKTKTKTRPKSKTDSKSKSKAQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNG4	Uncharacterized protein	0.819	72-81	NRKPKPRIKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ32	Uncharacterized protein	0.749	100-106	RRKKHSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW3	DNA ligase	0.998	106-139	SKRQRRKPSEDKEKPKKKTAAKPKAEKSTAKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW3	DNA ligase	0.898	160-173	VAKGKKKAATKPKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW3	DNA ligase	0.627	189-192	KGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUV2	RING-type domain-containing protein	0.798	47-65	PPRRVHRDRPRRSVVAPRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUV2	RING-type domain-containing protein	0.698	87-99	KAGAIVKPKQKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY90	Uncharacterized protein	0.943	333-362	RPKGGSSRPTKRKREEGDTPTAKGSRKKNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY90	Uncharacterized protein	0.839	32-45	PVKRSWRRKYRKMR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1I0	Mitochondrial ATPase (Afg1)	0.672	741-747	KGKKGEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W215	Protein kinase domain-containing protein	0.66	247-251	RAKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEC2	Lysophospholipase NTE1	0.857	347-362	KQPKTRKSPSRPAKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEC2	Lysophospholipase NTE1	0.677	772-777	KKKRTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEJ4	XPG_I_2 domain-containing protein	0.978	517-533	KKKKRLAREADRKKRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGX8	Uncharacterized protein	0.737	297-307	RRRSRARERER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHY5	Uncharacterized protein	1	20-52	KRKKRKKRKKKKKKKKKKKKKKKKKKKKKKKNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI00	Uncharacterized protein	0.973	49-73	EWGLMRHRPRKTHRKVKHSGRHRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLS4	Uncharacterized protein	0.999	104-238	APVPKKRGRPRKEAAAQEDAPITPKRGRPAKAAAPDLNRVTDSRVGKRTSPRSKPTKAAAAPPRQDPRMQSKLRTRLPPAKKIIEEQPTPQPARRGRPPKKAAKAAPPKKDVGRKALDAGIKKPTRPLAPRKMRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLS4	Uncharacterized protein	0.97	39-93	EPPKKRGRPPKAKANEPEAEIEDAPQPKKRGRPSLHASKPEAEEDVPKKANGKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLS4	Uncharacterized protein	0.814	10-30	RGTGRKASAAEATPKRGRPAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSV6	Zn(2)-C6 fungal-type domain-containing protein	0.614	147-148	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL1	Fungal_trans domain-containing protein	0.97	10-21	RKKMRKGRRRKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0J8	Nudix family hydrolase	0.634	65-67	RRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0X8	50S ribosomal protein L17	0.961	210-237	KKPNPDRIKWFKKVGKKVHKSLHGRKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3E5	Uncharacterized protein	0.685	246-252	KQPGKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Z3	Uncharacterized protein	0.741	594-604	RRKQAAERKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Z3	Uncharacterized protein	0.684	432-436	RRRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Z3	Uncharacterized protein	0.625	443-446	KAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4I4	Uncharacterized protein	0.768	416-431	HRHRRHRSHEHTGRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4I4	Uncharacterized protein	0.691	479-492	RRQPIARNWSKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W868	Uncharacterized protein	0.769	166-188	RQRLKEVREKERAKQVAERARQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAD8	WD and tetratricopeptide repeat containing protein	0.775	375-382	NRKRKRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEW4	DNA polymerase	0.99	96-137	RPAKGKAAKRKREEDEEKRKKIDKGISKYFNAKNAAKAPKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEW4	DNA polymerase	0.685	658-671	KKTPGWHRIGRLKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHD8	Uncharacterized protein	0.923	57-67	SKGKKRKRNIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI16	Stress activated MAP kinase interacting protein Sin1	0.605	114-115	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS11	Peptidylprolyl isomerase	0.946	375-425	APKPEAKKEAAKGPRNVSGVIVDDKKEGKGKAAKKGDRVEMRYIGKLKSGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS11	Peptidylprolyl isomerase	0.843	320-332	SKKQAKKLKKNDG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS11	Peptidylprolyl isomerase	0.624	338-340	EKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN5	Dihydrolipoyllysine-residue succinyltransferase	0.944	190-241	KPEPPKQEEKPQPTKESKPQPKKESKPQDEPKPATPGSREERRVKMNRMRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYV8	HMG box domain-containing protein	0.963	178-199	PREKRRYRRHPRPDAHAPKKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYY2	Uncharacterized protein	0.913	257-270	RKRAAGKRGRDRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYY2	Uncharacterized protein	0.674	283-287	KKRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ10	RING-10 protein	0.99	696-707	AKRGRRKGKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2H9	Uncharacterized protein	0.947	379-410	RGERGRGRGKQRGGGRNDRNEYRQRTPPRRQP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6N2	Uncharacterized protein	0.937	787-808	KRSEKKEKKESHSGKKSSKTSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6N2	Uncharacterized protein	0.884	620-636	PSSKRRSFGESKKGKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6N2	Uncharacterized protein	0.679	280-288	KLGPRPRPS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA88	Ubiquitin carboxyl-terminal hydrolase	0.858	177-186	RASRGRRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAF0	Uncharacterized protein	0.646	108-112	KPKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ7	BRCT domain-containing protein	0.896	25-36	PPKRGGKKKAAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ7	BRCT domain-containing protein	0.724	168-177	PTRKAPAKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ7	BRCT domain-containing protein	0.703	49-60	PTKTTAAKRKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ7	BRCT domain-containing protein	0.675	243-250	APARKPAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ7	BRCT domain-containing protein	0.643	97-103	KRATRGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ7	BRCT domain-containing protein	0.604	129-129	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ7	BRCT domain-containing protein	0.603	134-134	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WED3	Uncharacterized protein	0.779	304-311	SRGRRRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEG4	RNA polymerase II transcription factor B subunit 2	0.753	470-482	KKKKENRESARGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNV0	ATP pyrophosphate-lyase	0.61	493-494	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNV0	ATP pyrophosphate-lyase	0.603	487-488	HR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK0	Uncharacterized protein	0.9	418-434	ERRTSKKLQKKRRESNA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VST3	DNA replication ATP-dependent helicase/nuclease	0.748	125-132	RKNKKRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU17	NMDA receptor-regulated protein 1	0.996	592-621	RKKAEKKAKKEREKAEKAEAEKKAAAAAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUE1	Transcription elongation factor 1 homolog	0.92	37-54	GGKRKSSSKPQGPKKKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUJ5	Uncharacterized protein	0.854	160-167	ERRKRKRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUJ5	Uncharacterized protein	0.766	10-19	APRRRRDRPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUJ5	Uncharacterized protein	0.619	139-141	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Q7	Rho-type GTPase-activating protein 2	0.95	134-145	RRRKKSKKPPSV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5S6	Uncharacterized protein	0.825	727-745	DRKQRPRRSMVSVKRQRKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8S6	60S ribosomal protein L29	0.94	60-106	KKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9Q3	Integrase catalytic domain-containing protein	0.902	981-995	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDD5	BZIP domain-containing protein	0.892	83-101	QPPKRRGPKPDSKPALTRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WED7	60S ribosomal protein L13	0.96	30-53	GKKKSRRNARVAKAAKVAPRPVDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WED7	60S ribosomal protein L13	0.808	197-209	GVREKRAKAKLRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHF7	Cell division control protein 42	0.85	173-185	AKKEGGERKKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLY3	tRNA-splicing endonuclease subunit Sen2	0.82	53-61	APRKPRPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN68	Serologically defined colon cancer antigen 1	0.996	1128-1151	GRRGAEIAKGKKKSARGGRGSKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN68	Serologically defined colon cancer antigen 1	0.915	920-932	PLPRGKRAKAKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN68	Serologically defined colon cancer antigen 1	0.766	208-215	KKAKKAGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNU6	Low temperature essential 1	0.863	35-60	RRRADDSRRLRRVKDSKEQLKRRTTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRJ3	Vacuolar calcium ion transporter /H(+) exchanger	0.993	452-471	KTKKERRKHRKSHKDRRNRN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRJ3	Vacuolar calcium ion transporter /H(+) exchanger	0.959	356-370	KRKAKRMVKRLRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRT2	WD repeat containing protein 57	0.986	365-382	KSKKRKRGKGWEKRIRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSG2	U4/U6 small nuclear ribonucleoprotein Prp31	0.984	359-375	EKPSRKRGGRRARKAKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX50	Csm1 domain-containing protein	0.981	125-159	EAAPAPAKRGRKAAVKEPATKRETKAKTTAKSKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX50	Csm1 domain-containing protein	0.926	104-119	AKPAKRGRPAKKAQEE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX50	Csm1 domain-containing protein	0.853	203-225	PSRPSARRAQAKPNSRARRASAG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX50	Csm1 domain-containing protein	0.828	21-54	PARKARGTVAQAKKAALATKATAKGRPATRRVSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX50	Csm1 domain-containing protein	0.788	60-76	MKKTGAGVKKASAKGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W162	3-oxo-5-alpha-steroid 4-dehydrogenase family protein	0.601	158-158	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3M1	Uncharacterized protein	0.942	76-105	RRQAKDLDGKTTQPKRGKALRKSNVPKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3M1	Uncharacterized protein	0.744	14-21	KRLPKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3M1	Uncharacterized protein	0.678	161-166	KPKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6X9	Uncharacterized protein	0.945	142-155	RPGRSPRRRGKGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBC4	Uncharacterized protein	0.889	10-39	RRSKRKRNYAAIKQVHAPTPAPARKRRAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBF5	Uncharacterized protein	0.694	176-187	RSRHGHRSRSPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD73	Alpha-1,3-glucosyltransferase	0.785	8-14	KPRRRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFH8	Spindle pole body component	0.869	514-526	AILKRRRQRAAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG74	Uncharacterized protein	0.988	340-360	SPTRKAKKRRSEEKNRPKSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG74	Uncharacterized protein	0.733	648-668	KRTSAKKRWSHPDLPQKAEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNH4	PNPLA domain-containing protein	0.677	560-568	PPKPEARKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ35	Integrase catalytic domain-containing protein	0.968	812-829	QPRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQQ9	C2H2-type domain-containing protein	0.917	898-913	GKPLPKKKGRPVGWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQQ9	C2H2-type domain-containing protein	0.791	838-847	KQKRRGRPPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSB5	Uncharacterized protein	0.996	91-166	AAEKKRSQEAAKVARQQAKIAKDAEQLRQREEKAAKRALKKLQQAATAQKSRDTANKRKREASHKPAKKPTKRRRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU67	Uncharacterized protein	0.76	225-246	RPKPGCHKRPHHPAPHPGKPME
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU67	Uncharacterized protein	0.646	251-258	VGKPPHRF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW91	Uncharacterized protein	0.879	497-513	LKARRPRNSRFRHRRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW91	Uncharacterized protein	0.801	968-981	RLRERDEKGRKKEE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1W8	Uncharacterized protein	0.951	71-98	EAIRKHWRKDHQGWSAGKKRGRPSRTRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W325	37S ribosomal protein S25, mitochondrial	0.829	50-61	VPKMRKARKASK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5D2	Polarized growth protein Boi2	0.957	704-716	KRAKDGRKKAKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5G7	Uncharacterized protein	0.697	280-287	RKRVRARQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W825	Fungal cellulose binding domain containing protein	0.808	303-313	GKNKRGRRAFR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W927	Glucan 1,3-beta-glucosidase	0.976	84-141	RRKEKNLEKERIKEERAAKRRDELENAKRRAAESDAAMHEDKARRRREERRRAAEVRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W927	Glucan 1,3-beta-glucosidase	0.969	160-197	REDRRRRQSARPAPTEAEERRERRRQEKQHRTEQKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W927	Glucan 1,3-beta-glucosidase	0.891	239-245	KKKKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGS7	Uncharacterized protein	0.816	52-58	RRRRRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHU2	WD repeat containing protein 26	0.707	693-704	RGRQPHRISKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIA6	Uncharacterized protein	0.996	716-751	SKYRSSRREKEKHRSSRSHRERSKEHRRRHRSRSPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIA6	Uncharacterized protein	0.991	773-830	SRRKHRSGDKDRRDRSRDRERERDRKDRKERERDYDYEREKDRSRDKDKDRRRRRDRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIA6	Uncharacterized protein	0.884	612-659	RSRSPLRDESMRVKDRSPTRSRSRSKAREDVRDEPRERSRSADRQSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIA6	Uncharacterized protein	0.861	842-857	KHRSSRRSRKDRERER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIA6	Uncharacterized protein	0.848	1039-1061	KGPKAEAKPPTGPANHRDKRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJK4	Uncharacterized protein	0.853	884-903	VRRDAAMKTRRGSRLAGKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKD9	Ribonuclease Z	0.98	901-917	NGKKKQKKQKEKNKRNN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKD9	Ribonuclease Z	0.66	97-101	RGKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL43	Uncharacterized protein	0.695	116-123	KRRSKLHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRG3	Ribosome biogenesis protein RLP24	0.712	41-51	KMKRNPRKLAW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRG3	Ribosome biogenesis protein RLP24	0.69	188-194	KSKRKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRG3	Ribosome biogenesis protein RLP24	0.601	111-111	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX18	CDT1_C domain-containing protein	0.923	142-154	PKRGRGRPKKADA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXI6	Phosphatidylinositol transfer protein CSR1	0.841	56-71	KKDKKKSRLNVFKRNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Q9	Uncharacterized protein	1	15-44	KRYSPKVASVAKKKKKKKKKKKKKKKIKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2R1	Uncharacterized protein	0.892	263-280	SRRSTRRRSSGRRSSGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8X8	Nucleolar protein 9	0.977	3-20	KEHKKRGRREDQKKRKRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8X8	Nucleolar protein 9	0.838	670-683	KAAQAKDGKKPKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9A9	Uncharacterized protein	0.971	90-107	RKTSRTRRKLSKRHRRPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC55	Uncharacterized protein	0.675	14-24	SKDKVVKRPAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIZ2	Ash2-trithorax family protein	0.958	43-83	ARARPKAPAREQREKRETIKKREASASTRQNTPNAKPKKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIZ2	Ash2-trithorax family protein	0.935	274-300	SRASKIFKPLPKNAKSKHMKARPPHGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKJ0	Protein translocation protein SEC63	0.865	64-76	RKKQKRMERRIKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQA1	Uncharacterized protein	0.951	106-133	EAIRKHWRKDHQGWSAGKKRGRPSRTRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ9	Uncharacterized protein	0.716	273-279	ARRKKNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT07	Uncharacterized protein	0.845	91-102	KKPATPRKRKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT07	Uncharacterized protein	0.777	118-127	PKKSRGRSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUX0	Ankyrin repeat and protein kinase domain containing protein 1	0.899	560-583	GKTKTKEKTKKAQKWSGSRQAGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUX0	Ankyrin repeat and protein kinase domain containing protein 1	0.764	1115-1124	KRRWRERKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3S9	Carnitine O-acetyltransferase	0.602	127-127	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W480	Uncharacterized protein	0.963	122-144	PPNSETKKQSKGKNLKSKKGAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W480	Uncharacterized protein	0.813	700-718	NPKAKAAKAVDKSKEKAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W480	Uncharacterized protein	0.743	932-942	EKKGKDAKDKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5V1	Uncharacterized protein	0.933	439-457	KRKFEKEDKKKKAQEQKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5V5	Uncharacterized protein	0.694	53-58	RKRRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z3	Uncharacterized protein	0.928	924-941	EPGPTVKRRLKRKPTAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z3	Uncharacterized protein	0.785	821-838	KSAQRGKKTKLPSNPPAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z3	Uncharacterized protein	0.722	663-672	GRRKSGAPKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z3	Uncharacterized protein	0.714	624-642	KRKRQTKLADAFAKSKKVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z3	Uncharacterized protein	0.638	270-276	LKPVRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Q3	THUMP domain containing protein	0.971	8-36	PKKRKAESGGAHDGGNKRAKGKKNRDMPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9R3	Uncharacterized protein	0.785	271-282	RPKRHHKSQKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCR3	Transducin family protein	0.994	236-249	KADKPKKKKKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCV7	Peroxisomal biogenesis factor 6	0.974	10-22	PRKRRRRRRLDRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIZ1	Bystin	0.695	31-38	KAPRRQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJP9	Uncharacterized protein	0.977	184-205	ERKKETEREKEENRTRKKRKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP68	Uncharacterized protein	0.996	182-242	GGRGGKNKKMGIPELKAILGPKEKELAKRLKEKLKIHKEKKELAKKLKYKLNIHKEKMEKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR76	Ribosome biogenesis protein erb1	0.663	261-274	KRRFIPSKHEAKRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVC0	Uncharacterized protein	0.723	32-38	PQKKKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVC0	Uncharacterized protein	0.7	48-57	RSPSPPPRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVC0	Uncharacterized protein	0.665	300-304	KRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX20	Peroxin/Ferlin domain-containing protein	0.966	131-152	RRRRWLRRRVKQKLPPKTKANA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXH2	Solute carrier family 25 member 39 protein	0.642	146-149	VRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXJ9	DnaJ domain containing protein	0.99	525-547	KKNPKHAALKPVTEGGKKGKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXJ9	DnaJ domain containing protein	0.785	481-493	MGKAAQKRAKRAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZK8	zf-LYAR domain-containing protein	0.999	320-404	QKQRKADVKAREKAEKKEKDAKEKEKKEKKEKEAKEKEKKEKEKEKKDRGRDRDRKERKATTALVKIRPKKKREDSSTEVRRIRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZK8	zf-LYAR domain-containing protein	0.629	58-60	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1K6	Actin-interacting protein (Bud6/Aip3)	0.889	922-951	EAERLRKAKDERARKENFEREAARQRAKAE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M7	Endoglucanase IV	0.608	334-335	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W387	Heat shock protein Hsp88	0.852	530-544	KEPPKMRKVKKQQRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5T7	Uncharacterized protein	0.93	44-61	QFRFERKFKRRIKAKSIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5T7	Uncharacterized protein	0.616	30-31	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Y0	Uncharacterized protein	0.827	460-469	SWKRQRPKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7L5	Uncharacterized protein	0.991	324-337	KKKRKRRKPNKSGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8K4	1,3-beta-D-glucan-UDP glucosyltransferase	0.983	294-310	KANRRTRKARKAAKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG32	Mitochondrial import receptor subunit tom-20	0.738	40-51	FRKQLKKESKRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJP7	40S ribosomal protein S9, mitochondrial	0.982	300-331	RRAGTITRDPRKVERKKPGHVKARKMPTWVKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLP6	Uncharacterized protein	0.986	808-870	GKGKKKVRTEEEMVGVSRKGKGKVAGTKRGTTAKPNQMGARKKAKVEAKVEVRKVEVKKRAKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLS6	Uncharacterized protein	0.856	169-176	KQRKKRKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM33	Histone demethylase JARID1D	0.905	1000-1015	QARRKAERPGRGRPSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMF6	Uncharacterized protein	0.637	310-316	KPRSRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPQ8	CCHC-type domain-containing protein	0.914	569-593	KPRTKPRTRSPNDRNPARKARSGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPQ8	CCHC-type domain-containing protein	0.739	341-357	PRPRGDSHSRSRSRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPU0	Bms1-type G domain-containing protein	0.863	15-33	TKKDKKGFKSRHATKGALK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.996	1495-1526	RPRKKLSSKEEKRLEEKRLKEEKKLKKSKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.996	2216-2275	ERRKARGKAPVEDKDREHRSSRRKEKDRDAARPKSERRRSHQDEEADRRRRHEERRAARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.993	2374-2410	RIAGRKGPKRDKERAERRKTEERERERDKTHKHSRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.981	1072-1100	SKKKESAKEKKAREKKEEQERLEKERIER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.98	331-342	PGKKKKGKKGKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.971	1693-1712	KKHRKSKKSSKTRAPPPPPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.971	2143-2185	EARRAERRAKRDAEKGSRRAELEEAEAKAERRRERERENERAT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.97	1287-1296	KDKKKKKKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.963	966-992	GGSSKPLKKETSLEKRARERREKKERE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.958	225-243	DKGKKKTKKEKEEEERLKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.946	661-672	AKKKKGKRVAKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.946	2021-2037	RPRRERERERERPRRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.931	1199-1219	KKKETTKQKREREAREKKERE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.931	1767-1790	TPPPEPKTESPRKARKAGRSGPSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.929	1431-1444	KEERRLKKSKKHRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.926	518-526	KEKKKKKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.92	2066-2100	GRKKAAPEEAPRERRRTAYETEDERKRRKRSTTRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.881	813-821	KKKKKDPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.871	169-182	SHAKKKKATGAAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.86	853-861	KKAKKGKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.853	1610-1622	RRLRKSKKSSKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.798	946-957	KKKSKKDKESTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.787	712-719	KKGKKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.763	762-767	KKKKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.758	478-485	KSKKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.62	2108-2111	KRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.604	2426-2426	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK9	Uncharacterized protein	0.602	577-577	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL8	Uncharacterized protein	0.964	106-136	KTANKLNGKKRAFKATRWDRRKSVLPRKKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL8	Uncharacterized protein	0.933	746-765	PKKKRPKTSKDSTPKIRRVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL8	Uncharacterized protein	0.838	609-626	RSSRRSSRTKKSRLPAPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL8	Uncharacterized protein	0.775	40-60	GWERKQEVKRLGQGKEKKIWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYZ5	Inner centromere protein, ARK binding region protein	0.776	843-862	PLREPRKLAKPSSKDGIHKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYZ5	Inner centromere protein, ARK binding region protein	0.76	69-81	KLRGKTPRTARKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYZ5	Inner centromere protein, ARK binding region protein	0.751	709-738	RRTRSSTEREKQKERETREKEVREAKQEQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYZ5	Inner centromere protein, ARK binding region protein	0.642	742-753	RLKQMREKEQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZD6	Non-specific serine/threonine protein kinase	0.987	600-617	PKKKKTHRGRRGGRKLSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2W6	HTH_Tnp_Tc3_2 domain-containing protein	0.611	152-153	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3N8	Adenylyl cyclase-associated protein	0.975	347-370	RSKSPAPPKAKKPESMRTKKPPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W897	Far upstream element-binding protein 2	0.791	140-156	RRSRSRSRSPVRREAAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W897	Far upstream element-binding protein 2	0.675	166-180	RRDERRGGYGRERDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB45	UDENN domain-containing protein	0.995	116-129	EARRERRRRRRRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDW8	Uncharacterized protein	0.756	289-297	RRSRKKAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE00	IBR domain containing protein	0.989	83-124	PESRRERERERESSKREPVKEKSRSSKEKEVRRDSSKRTKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE00	IBR domain containing protein	0.754	49-58	RERRERRRAE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHV9	Uncharacterized protein	0.669	357-364	RKRKELAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI63	Uncharacterized protein	0.933	733-755	PVKNGKKKPAKRYVMSKVKFQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIU9	Uncharacterized protein	0.822	201-208	GKRRRKSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL04	Forkhead domain containing protein	0.903	289-324	SKQPNKRGPRNHQPQPQRQASGAKGGKASRRSARMR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLV4	BRCT domain containing protein	0.974	1495-1509	APLGKTKKGGKKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLV4	BRCT domain containing protein	0.627	949-952	KPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSG6	Uncharacterized protein	0.949	159-202	KKQRQNRKKVEEAKAAREEEEKARKALEEKQRRVAREARGEPAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSG6	Uncharacterized protein	0.859	56-70	PKSQKPKTKAPRKSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVF5	Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B	0.881	60-72	AAKEQKKVKKKNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYB1	Zn(2)-C6 fungal-type domain-containing protein	0.67	338-345	PPSNKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYM8	Uncharacterized protein	0.898	483-499	HGAGGGRSAKDRRKRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W014	AP-3 complex subunit delta	0.995	1003-1041	VKKKKKKKVKADGDKEKAGEGAGEGDEEGNAKKKKKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W014	AP-3 complex subunit delta	0.923	968-976	KKKKRKVRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W196	GRIP domain-containing protein	0.932	19-33	SQKKKNKKKASAHGN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3R1	Outward-rectifier potassium channel TOK1 channel YORK	0.909	344-353	RRARKRRLKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4T7	Uncharacterized protein	0.692	437-444	KKKRSIKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W533	Rho guanyl nucleotide exchange factor	0.888	936-964	SRRRRLANRAIGSEHSNDKPAPKPKKTRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W533	Rho guanyl nucleotide exchange factor	0.873	1009-1026	ENRRVKREEKKDREPRPE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W839	Integrase catalytic domain-containing protein	0.958	1080-1096	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W839	Integrase catalytic domain-containing protein	0.768	433-472	RRIRGGSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAE0	Pre-mRNA-splicing factor cwc22	0.763	53-60	KKRPGRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEK0	Endoplasmic reticulum junction formation protein lunapark	0.893	386-396	TRSKSKARAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGP3	Beta-ketoacyl-[acyl-carrier-protein] synthase I	0.626	1545-1549	SREKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIJ5	C3H1-type domain-containing protein	0.991	114-131	RKEKDENKRTKKRARRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLX9	Integrase catalytic domain-containing protein	0.967	645-661	PRKRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN02	Lysyl-tRNA synthetase	0.994	30-62	KSELKRRQKQREKDEKKKEKEASLPARPKKEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTN2	Uncharacterized protein	0.732	49-57	KKKAAPARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU80	ATP-binding cassette sub-family G member 2	0.697	674-680	GGWRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU80	ATP-binding cassette sub-family G member 2	0.606	671-672	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXE0	tRNA (guanine(9)-N1)-methyltransferase	0.998	66-102	KNQLKKLRRQERWEAGREDRKLKRKEKIKEKKERRRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXE0	tRNA (guanine(9)-N1)-methyltransferase	0.675	115-125	KPRPPPSRAPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4I6	ATP-dependent RNA helicase ROK1	0.999	149-174	EPRSEKKSKKRKKEKDIKEKKKEAHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4I6	ATP-dependent RNA helicase ROK1	0.992	659-717	KRDKQTLKRRGVEARRKGKEGGRISSKSGYDRKIENMRRGKMEKVRREKSGAGGGKKKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4I6	ATP-dependent RNA helicase ROK1	0.737	92-99	KKQRKKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W594	Uncharacterized protein	0.624	568-570	RRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R9	60S ribosomal protein L32-A	0.765	10-17	IVKKHRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R9	60S ribosomal protein L32-A	0.76	34-49	RKPKGIDNRVRRRFKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5V6	Intramembrane protease 2	0.736	57-64	KPIRKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7R0	Uncharacterized protein	0.995	370-412	RRPPGRRKKGRLSVLRPKSNRLSGKSKGVKIAPGKQKGGKGKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U6	Uncharacterized protein	0.748	56-65	KKKKNPSKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA43	Uncharacterized protein	0.812	109-153	ERQRLKEMREVERAEKAAERARKVEAQHQKKSIQQAQQRKRKASQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA43	Uncharacterized protein	0.794	34-42	KKKHEKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA43	Uncharacterized protein	0.654	157-164	PSNKRQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA43	Uncharacterized protein	0.634	89-92	KKQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBD4	F-box domain-containing protein	0.928	189-197	KRRRRRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBD5	Uncharacterized protein	0.846	290-311	RSRKSSTRRKSATRNKNSTRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCB5	Fanconi-associated nuclease	0.756	268-285	AKVKGKNKGELLKALRRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCB5	Fanconi-associated nuclease	0.681	42-50	NSPKKAPPT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX4	Vacuolar calcium ion transporter /H(+) exchanger	0.82	62-70	RKKKAFKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX4	Vacuolar calcium ion transporter /H(+) exchanger	0.705	284-291	PKRKSGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPC0	Fatty acid synthase S-acetyltransferase	0.803	2535-2545	GLRNKRGRKPQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS91	Isochorismatase family protein	0.98	363-380	KTKIRMRTGRTKKKKKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW28	ATP-dependent DNA helicase MER3	0.657	1190-1193	PKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY98	Uncharacterized protein	0.771	20-33	GKERPRKEQVRNRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYA8	Uncharacterized protein	0.982	472-511	KWTKLKAKLKRSASKKSLKSMKSSKSVKSGKSVATKPGDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYA8	Uncharacterized protein	0.652	191-195	RPKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYN6	Peptidyl-prolyl cis-trans isomerase D	0.758	354-365	KRVQARKEKEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZG0	Uncharacterized protein	0.647	58-61	RKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZJ9	Uncharacterized protein	0.981	232-277	RRKSKGMKRGEERKGSKAYIMKKKEQMERQGKVVKASSKYTGRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1H7	BHLH domain-containing protein	0.89	172-185	KPAPRKRGRPRLNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1W1	Uncharacterized protein	0.78	280-311	RERARKLLKEYDAKKSSKLLVKTPKQRNSHKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5E6	Integrase catalytic domain-containing protein	0.958	928-944	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5E6	Integrase catalytic domain-containing protein	0.658	312-319	RGFKPRWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5E6	Integrase catalytic domain-containing protein	0.639	287-299	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Q7	Uncharacterized protein	0.99	172-193	KIKNRKKVKSGKPEVRKKRQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7S2	Integrase catalytic domain-containing protein	0.968	716-732	PRKRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Z4	Uncharacterized protein	0.993	44-94	PATKVKKPNTKTNTKKPEKDKTKKTQTGRVEKVKANTKKKVAAGGKKGKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW3	RNA binding protein	0.999	188-210	KAAKKEKKKDKKEKKEKKTKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW3	RNA binding protein	0.994	84-98	KKKKEKKSKKSKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW3	RNA binding protein	0.993	342-390	RKTKIAAKNEKLHDERARDRIKEAEVSMKQRERKEKKEAKSGKKADKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW3	RNA binding protein	0.992	142-161	KDKKKSKKDKDSKKSKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW3	RNA binding protein	0.982	53-68	KKDKKSKKDKKEKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW3	RNA binding protein	0.892	7-32	DKPEKKRKRDVEVAEDVPKKSKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW3	RNA binding protein	0.635	321-325	KKEGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCM4	C2H2-type domain-containing protein	0.787	603-614	PKKSKERQRRPS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCM4	C2H2-type domain-containing protein	0.672	621-632	PKRAPSGLLKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCM4	C2H2-type domain-containing protein	0.669	654-663	KPRRIGSWGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE71	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.639	721-724	RKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGE6	Acetyltransferase	0.983	146-163	AKKRGRRRRGKAVVRAWT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGE6	Acetyltransferase	0.602	165-165	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHC7	Uncharacterized protein	0.736	117-125	KKVKKRWGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WII5	Uncharacterized protein	0.892	1085-1105	DVRSRNKLKKEKELRFHRRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WII5	Uncharacterized protein	0.727	642-649	RRKNAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WII5	Uncharacterized protein	0.654	494-498	RHRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN08	BTE binding protein 4	0.941	407-422	RRQAKRGRPKKSSRPD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRA1	Uncharacterized protein	0.939	210-221	RIKEKKPKSKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS58	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.825	576-585	RGHHGKKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS58	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.663	314-319	RPRKPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS58	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.631	409-412	KRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSX5	Pre-mRNA-splicing factor cef1	0.969	172-203	SGKKAKRKARERQLEESRRLALLQKRRELKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSX5	Pre-mRNA-splicing factor cef1	0.809	272-280	DRKKKKDEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU70	Uncharacterized protein	0.767	453-460	RRKRKSRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ31	Uncharacterized protein	0.965	359-375	KSKERRRRRRIPTRAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ31	Uncharacterized protein	0.834	229-239	RRRQKARPKRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Z4	Uncharacterized protein	0.849	171-180	KPKRKKPWEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W612	Hormone-sensitive lipase	0.827	760-776	RGRGRVQKSARGNRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W704	Elongation factor 3	0.988	1067-1089	KFRSRKKKKMTKKEVKDREVRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Z2	Uncharacterized protein	0.724	11-19	KKITKKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAW4	DNA damage response protein RcaA	0.666	637-644	NFKKFRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAW4	DNA damage response protein RcaA	0.654	311-315	KKRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES5	Zuotin	0.992	290-363	IKKFRQAEHAQKNKRRLEKEAALKREAEEAEARKAEEAKAAAEKEAAEKAAKADNKKAKEAAKNAAKKNKRVVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES5	Zuotin	0.906	255-271	RHVERKNTAARRKKKTE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES5	Zuotin	0.894	120-138	KRAHRRKVLKHHPDKKAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFL3	RING-type E3 ubiquitin transferase	0.988	18-72	RREGGGGRGRGRGAHNGPESSHEGVGSRGRGRGGSRGRGRGHGHGRGGPAQEKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFL3	RING-type E3 ubiquitin transferase	0.789	775-784	GKKKGNKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFL3	RING-type E3 ubiquitin transferase	0.617	399-404	RREGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI88	RING finger domain containing protein	0.94	157-180	RERRRRERSRDASRESRRNRDERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI88	RING finger domain containing protein	0.845	261-280	RRQMERHAERQRERRERRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIH5	50S ribosomal subunit protein L15	0.96	54-78	KKIRRGRGPASGKGKTGGRGQKGQH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIH5	50S ribosomal subunit protein L15	0.807	305-319	AKDRKKQSARKNAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WML3	ABC transporter CDR4	0.707	1905-1912	KSKKSKGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTL4	Cell wall biogenesis protein phosphatase Ssd1	0.886	501-511	KREKEEKKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTV8	Tyrosine--tRNA ligase	0.757	400-410	KKQKKVKDKGT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV77	Diadenosine tetraphosphate synthetase	0.93	138-146	PKKKKKKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWX8	ULP_PROTEASE domain-containing protein	0.786	275-288	LPTRRTKPPLRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXC3	CCHC-type domain-containing protein	0.914	569-593	KPRTKPRTRSPNDRNPARKARSGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXC3	CCHC-type domain-containing protein	0.739	341-357	PRPRGDSHSRSRSRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYN5	Uncharacterized protein	0.998	25-81	AIKEKKERGFRGVLPFQRKSKRKDKDKDKEKEKESRKEKEREKERDKENRKDKGKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYY7	DNAJ domain containing protein	0.825	539-554	RRPSEATKRPKASRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZY3	G-patch domain containing protein	0.999	170-222	KKRKKRKHEERTEDEPKLKRKKKSIDLRDESKEVKDKKSKKGKKDKSRKSKRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZY3	G-patch domain containing protein	0.999	243-274	KARRKAEKKARKQEKRAKKALKKAAKRAAKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2T8	p-aminobenzoic acid synthase	0.91	861-871	PPPKPKKKGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z6	40S ribosomal protein S30	0.932	46-57	KKKTPKGRAKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U1	DUF4211 domain-containing protein	0.948	164-177	PRKKRDSKRRKMRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U1	DUF4211 domain-containing protein	0.876	263-273	RSTRRRLKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U1	DUF4211 domain-containing protein	0.817	670-679	DRKREKKARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U1	DUF4211 domain-containing protein	0.749	188-196	ASRKSRRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U1	DUF4211 domain-containing protein	0.742	343-361	HDKPKNKRQEALEALKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8M0	Nucleolar protein 58	0.996	469-518	RKEKKDKKDKKSKKSKDVEEDASEKKSKKDKKRKHADEEVSDKKKKKSKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFP2	Transmembrane domain transport protein	0.972	332-341	GKRRRRKPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG78	Uncharacterized protein	0.898	165-173	GKKKKSKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI02	Ubiquitinyl hydrolase 1	0.999	1437-1471	GRQNKKKSKKARKHERKMERKHKNNKNFKHRKGGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI95	Uncharacterized protein	0.99	48-75	RQRVRNRNKKAKGKKSARSGGGGGSGEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKL1	Uncharacterized protein	0.937	12-42	RPKPKPKPAPEPPKEPQHEKVGQSSKEKRTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKL1	Uncharacterized protein	0.768	929-944	TRRSSKASRHEGKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLN4	Transcription factor tfiiic complex a box associated subunit sfc1	0.879	104-113	KRTGRKRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT55	Small nucleolar ribonucleoprotein complex subunit (SOF1)	0.984	386-439	PEIKRIDRHRHLPKTVKKAGEIKAEEIKSIKRKEENVRAHSKKGSVKRKAEREK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTS4	Uncharacterized protein	0.821	119-126	RKKARRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUV6	Uncharacterized protein	0.979	1183-1207	REYKGKIRKGRVSKRRGGGGVGRGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUV6	Uncharacterized protein	0.907	1275-1293	KNGRRGKTAKDKLGRKAKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUV6	Uncharacterized protein	0.694	131-141	RERRPTPPRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXZ7	40S ribosomal protein S26	0.907	85-109	RVRSREGRRNRAPPPRVRYNKDGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXZ7	40S ribosomal protein S26	0.837	3-18	KKRASNGRNKKGRGHV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY46	Mitochondrial proteins import receptor	0.99	76-99	KRKRQRERKRAKERAEKDTGAEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0H1	Uncharacterized protein	0.947	130-148	ERGQAKRGRAKRKAVLGAS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W240	Uncharacterized protein	0.626	337-343	KRSWRVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5S3	AKAP7_NLS domain-containing protein	0.858	237-250	KPKRGRGGRTKSAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W616	Uncharacterized protein	0.994	388-430	KVKKGRGRPPGSRNSKGVSKPAPKPVAKPIAKPTTKKPKPRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W616	Uncharacterized protein	0.769	578-595	KKNAKKWRTEWKHQKKHG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W616	Uncharacterized protein	0.727	452-457	KPRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKC6	Uncharacterized protein	0.996	293-321	KKQRKKKSLPPKSSKPPPKLEKPKKKTSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNN3	Uncharacterized protein	0.765	103-117	LRPKNQRKIAKAIRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP87	Integrase catalytic domain-containing protein	0.958	1006-1022	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP87	Integrase catalytic domain-containing protein	0.768	433-472	RRIRGGSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQN5	Uncharacterized protein	0.939	701-721	GKRRWNERIERSKKPRREGSP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQN5	Uncharacterized protein	0.609	372-375	RRVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQU7	Uncharacterized protein	0.996	733-746	AKKEKKKKKKKEKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQU7	Uncharacterized protein	0.712	909-915	RKRKMGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRJ7	DUF3074 domain-containing protein	0.905	474-506	EKHEKEKRKQETKYQKEIRKLEERRAKETRKLL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS53	Uncharacterized protein	0.603	187-188	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSG1	Pre-mRNA-splicing factor clf1	0.905	615-627	EKQMPRKVKKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.998	1489-1523	KEKERKEKEKEKERERKREKERERGWKRESSSSKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.998	2022-2056	RGKEKSRESESELKVSKREKKDKKKKKSSSSKSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.997	4746-4759	PKKSKKKKKAKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.993	5257-5269	SKKSKKKKKGKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.992	5014-5026	PKKSKKKKGKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.991	3174-3190	PKGKGKGKTKKNKKSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.991	4501-4513	SKKAKKKKGKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.989	4619-4631	SKKSKKKKAKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.988	5504-5517	SKKSKKKAKKAKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.987	3337-3349	KAKKAKKSKKGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.985	7615-7626	KKGKKKSKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.984	5372-5384	PKKDKKKAKKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.981	4390-4402	PKKSKKKKAKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.976	8654-8668	APKEKKEKKNKKSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.975	5746-5757	SKKKKAKKAKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.974	2546-2570	ERRRKHRRRESERDASPSEKKHRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.973	5878-5890	KKDKKKARKAKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.972	4223-4235	PKSKKAKKSKRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.966	2486-2520	ERRRRRREARSETREKSHDRGYGEEGGERRRRHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.961	3846-3858	AKKKTKKEKKDKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.95	4086-4097	KTKKGKKNKRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.948	801-817	PPKEKRSKENSLKKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.943	124-139	KDRKKAKDRKVEKRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.94	6711-6723	KKEEKKNKKAKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.94	8107-8118	SKKIKKEKRKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.931	6133-6142	SKKKAKKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.927	8568-8583	LRRREGKMKRERSRKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.926	6874-6886	KQAKKKAKKTKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.924	7927-7939	SKKLSKKEKKKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.914	1815-1828	SKKSSKKEKRKQEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.908	7177-7191	GRKLSKKEKREARKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.89	2657-2665	RKHRRRKHR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.879	731-768	KKQPSRSKSPKRVQVLHPRRDSSDDERKRRRSQQLRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.865	7062-7070	KKKNKKVKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.857	5656-5664	KKKSKKAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.78	683-695	KDRRDHKVRRRHS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.767	2614-2624	PKKEKEREKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.76	6018-6025	KKLKKAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.756	842-852	RRRRRSSVKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU89	Uncharacterized protein	0.661	641-647	SRRSRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ27	Uncharacterized protein	1	3-30	RKKKKKKKKKKKKKKKKKKKKKKKKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZD9	Small nucleolar ribonucleoprotein complex subunit	0.83	150-156	KKRKRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL7	Pre-mRNA-splicing factor spp2	0.997	346-423	ERRRDKDRRRNKDDYHESDRRRDKLKERVRGDDYDGERRREKRRDRSRSPDDRKEKRRDRYRSRSRGSDDQRKRRRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL7	Pre-mRNA-splicing factor spp2	0.88	304-338	KKPSKRKSKYNDGSEEDERRRERRRENRDDRDRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL7	Pre-mRNA-splicing factor spp2	0.637	85-92	RREEARRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZN6	Beta-taxilin	0.902	42-54	APAPAKKGKGKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4S0	DNA-directed RNA polymerase subunit	0.846	328-345	RPLKTIRGRLKGKEGRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4T8	Uncharacterized protein	0.919	8-18	KGDKKVKKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4T8	Uncharacterized protein	0.666	203-214	KPRFKANKEEKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W536	Zn(2)-C6 fungal-type domain-containing protein	0.855	118-129	SRRGWKGKRKNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8K9	PH domain containing protein	0.854	99-118	LKKKNSVKRSGSLKRSGSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9H5	VHS domain containing protein	0.822	208-218	KRDKKDKKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9Z3	Acetyl-hydrolase	0.964	547-565	PAPKPSPAKPKKKAKVDAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9Z3	Acetyl-hydrolase	0.896	666-681	GRRLKGMKTKKTKEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9Z3	Acetyl-hydrolase	0.602	636-636	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBI7	Uncharacterized protein	0.752	168-174	PRPRKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCM0	Uncharacterized protein	0.83	255-281	RSRKRRRSTASNSNSNRTQKRRGHARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMN0	Uncharacterized protein	0.868	219-243	KRDFNKQRYHERGGLKRKRLASERW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN70	Rab-GAP TBC domain-containing protein	0.761	388-403	RRRRLGRSSSRAPSSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPG2	Transcription initiation factor IIF subunit alpha	0.967	509-541	GKSKKRPGSPNLSEASGNESSRKKHKKKHSEKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPG2	Transcription initiation factor IIF subunit alpha	0.965	568-580	GKKRKKDKKEKNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPG2	Transcription initiation factor IIF subunit alpha	0.823	26-42	RRRRPRPQADVLRKPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPG2	Transcription initiation factor IIF subunit alpha	0.66	184-191	GTKKPPAF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPG2	Transcription initiation factor IIF subunit alpha	0.601	171-171	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ27	Uncharacterized protein	0.938	39-46	KKKRRRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQP5	Kin17_mid domain-containing protein	0.721	280-295	KRKKDDSEQKPVKKIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS25	Uncharacterized protein	0.987	116-131	SKKPRARKPKTPKKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS25	Uncharacterized protein	0.616	91-92	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUI3	XPA_C domain-containing protein	0.932	332-358	KERKQKKFKNKLEDLKKRTRVEAYRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUI3	XPA_C domain-containing protein	0.611	162-163	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVU6	T5orf172 domain-containing protein	0.956	173-192	PKKKKERRPSTSSRPPRRVN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVU6	T5orf172 domain-containing protein	0.687	215-229	RKDHIRPSKPSPQRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH2	PHD finger domain containing protein	0.899	354-370	ESGPPKRKPRAPPVPAQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH2	PHD finger domain containing protein	0.662	308-311	KRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH2	PHD finger domain containing protein	0.646	276-281	KPQKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZU2	Uncharacterized protein	0.989	689-727	RTRRRRDKDRRGGGDRERERERDRGRDRYSKKSHTGRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W018	Ubiquitin-like domain-containing protein	0.993	50-67	RRKEEERKEKKRDRKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0W3	Uncharacterized protein	0.769	176-187	SGPARRAPKPRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1M1	Integral membrane protein	0.776	280-286	RKGKKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U0	AAA domain-containing protein	0.999	136-169	KAKRKKKRKLAAKRAAAKKKQKEKAKNKKARSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U0	AAA domain-containing protein	0.997	195-213	KKSRRKALRAKAKKRKNKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U0	AAA domain-containing protein	0.996	242-258	KRKRAKSKAKRKSKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U0	AAA domain-containing protein	0.971	94-112	KKSDKKGRRGSQKSKRKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U0	AAA domain-containing protein	0.968	433-453	KKTLKTRLKKAKRSKEQKRLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U0	AAA domain-containing protein	0.738	687-693	DKKGKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4N9	1-alkyl-2-acetylglycerophosphocholine esterase	0.886	251-263	HKKRSKHRKDGHG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4N9	1-alkyl-2-acetylglycerophosphocholine esterase	0.748	30-41	GKIPNAKKPRTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAN5	SET domain containing protein	0.874	117-126	PPKKKIRKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAN5	SET domain containing protein	0.782	262-270	RAKKRTKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC54	Uncharacterized protein	0.999	141-171	KAKAKRKRDKYAKRRKEKRLERGLPRRRGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD31	Uncharacterized protein	0.985	79-135	PKKTPRKKAAAAKKADGEEGPAATTPKKTPTPRKRAPKKQDVDGESSPKKKTTRGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX2	Pathway-specific nitrogen regulator	0.925	17-35	AKKGRRGKRDGGSDESKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI17	Uncharacterized protein	0.909	238-250	GKGKKKKPVVPRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI26	Uncharacterized protein	0.998	109-203	PKTASSAPPKAEKASKTDKPSRTEKAEKSSLSKKTSSQTKLMPPTKAAAPPKKVPEPKAVPLKKKPEPKPALKSAPEPKKQSRPKPETRTSSRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI26	Uncharacterized protein	0.874	32-59	RRGAPPKAAAAPKPSPEPKTPAKLSRTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLR8	Serine/threonine-protein kinase bur1	0.962	16-68	DRREPYPPRRLDDRRPERPDSRTDIRPARPERRTPPPQIPKTKTIIKKRMKPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLR8	Serine/threonine-protein kinase bur1	0.92	399-443	LRKEKDKQEHEARRVAREEKDLARKDEGKRRAEAAAGEERDAKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPM2	Uncharacterized protein	0.856	71-80	QRKKKRLQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPS7	Kinesin light chain	0.866	185-199	RSKSKKKFTRPRLKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQX9	Integral membrane protein	0.861	297-307	NKKKGKKENKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRF7	Uncharacterized protein	0.995	10-41	GGEPKARVKRRNKHGWKGRQSRGRRSERKSKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK6	MI domain-containing protein	0.997	24-68	NKRRNGSRNGPPNRKDKRKADRVEKKRQNKQVRKPAPTHPHNGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK6	MI domain-containing protein	0.828	147-158	KRLGVKGKKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK6	MI domain-containing protein	0.779	99-129	KKEPQKPLKGILKAKPQQKEEASPPPAKLSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTW7	DNA-(Apurinic or apyrimidinic site) lyase	0.978	442-461	RKAIKDAKPKRATKKASKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTW7	DNA-(Apurinic or apyrimidinic site) lyase	0.856	34-45	GRKRKAGAKPAV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTW7	DNA-(Apurinic or apyrimidinic site) lyase	0.648	91-99	KAKTTRAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTW7	DNA-(Apurinic or apyrimidinic site) lyase	0.601	66-66	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ03	Uncharacterized protein	0.946	1924-1942	NKRRDYIKKKRARIEGKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ05	Uncharacterized protein	0.876	427-452	TKKKKGLLGLGGDKGKEKKDHESKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL5	Uncharacterized protein	0.612	696-698	RRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0B1	U3 small nucleolar RNA-associated protein 25	0.732	64-69	RKKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W288	Ribosome biogenesis protein Kri1	0.997	640-654	EKKKKKRSRKRKAGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W288	Ribosome biogenesis protein Kri1	0.984	559-582	FRDPVKKKKDKKFLSKKARIRQWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W288	Ribosome biogenesis protein Kri1	0.98	312-343	DKSGRRKAREAARAKREAERREKEQDLARLRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W288	Ribosome biogenesis protein Kri1	0.957	472-494	KKSSKKRKQERAEAKSAARRDRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W288	Ribosome biogenesis protein Kri1	0.951	411-421	GKKGKKPKKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2C8	Uncharacterized protein	0.752	156-161	RKRKRN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4P2	Uncharacterized protein	0.999	244-285	PKENKPAKSGDRAEKPEKAAKDKKQKKSDKREKKSKKTEKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4P2	Uncharacterized protein	0.985	135-163	KKTTDKKSKRKREESDAKASKKSKKADAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBU8	40S ribosomal protein S9	0.95	166-180	GRPGRVRRKKAKAAE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHA3	Protein transport protein sec73	0.724	778-783	TKKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHA3	Protein transport protein sec73	0.69	189-196	KSMDRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHA3	Protein transport protein sec73	0.643	1242-1250	KQRRSLHRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHA3	Protein transport protein sec73	0.623	1260-1262	HRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHA3	Protein transport protein sec73	0.606	1255-1256	RG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHA3	Protein transport protein sec73	0.602	1252-1252	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKH0	SWR1-complex protein 5	0.993	74-88	ARRKRSKKKGKKGSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKH0	SWR1-complex protein 5	0.66	235-242	KIRRPLRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLT6	20S-pre-rRNA D-site endonuclease NOB1	0.958	165-185	RKSKTEANNKRRSRRRAAKAN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLT6	20S-pre-rRNA D-site endonuclease NOB1	0.724	619-636	GGRVKVGAGKNVNAKKRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRJ9	AP-1 complex subunit gamma	0.809	609-620	KKRQSKIAKKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX44	Zn(2)-C6 fungal-type domain-containing protein	0.77	85-100	GRARRRPAPGEQVKHR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXC4	Uncharacterized protein	0.63	179-183	RRNKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W060	SH3 domain containing protein	0.787	461-468	PPKKKKPI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W060	SH3 domain containing protein	0.7	295-302	KEKPKRPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W060	SH3 domain containing protein	0.618	1175-1179	REHKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0H0	VEFS-Box domain-containing protein	0.955	361-373	SRPRRRKKKFPVP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0H0	VEFS-Box domain-containing protein	0.658	523-530	PKLDRKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1P7	Uncharacterized protein	0.669	844-851	RKWSKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3P8	CT20 family protein	0.99	266-283	RRANRAKPKAAPKRTRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3P8	CT20 family protein	0.718	206-220	AKGAKGARTAKTGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6I4	Bromo domain-containing protein	0.978	480-501	RPKQTPPKAKAQRKSRAKGKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6I4	Bromo domain-containing protein	0.949	536-551	SGRSRRKAPAKRARPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7W2	rRNA biogenesis protein RRP5	0.975	115-130	AAKSKKKFPKKSKKSH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7W2	rRNA biogenesis protein RRP5	0.955	1455-1465	PKKKKKSKKAS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7W2	rRNA biogenesis protein RRP5	0.805	12-31	ATPSKKAKSALTDRSAKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8A1	Zn(2)-C6 fungal-type domain-containing protein	0.833	38-45	PRKRRRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCY4	Zinc homeostasis factor 1	0.764	206-218	RRRSSISKKNKRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGL3	Uncharacterized protein	0.807	505-517	KHHKAKKTTPRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGZ1	Uncharacterized protein	0.862	172-199	PRYPKKKTPEEKQAEKEKEGTGQPKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHI2	Uncharacterized protein	0.945	6-29	RERGRTMKSTRRSFSRTRKAKRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHI2	Uncharacterized protein	0.801	368-394	KRRRSSIIMGKIGTSIKSGARKVARRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB6	Uncharacterized protein	0.885	62-81	RTRRSRLQLRDRRRAKRTLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL79	Uncharacterized protein	0.765	288-297	SMRKKAKAGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLM3	Zn(2)-C6 fungal-type domain-containing protein	0.883	57-66	KPPRKSRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMM6	Transcriptional adapter 2	0.973	156-174	ARKKRRIEKKKEEAAAREP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPZ1	Uncharacterized protein	0.864	117-142	RKQAKRDRKKGETDEQRNARRQATKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPZ1	Uncharacterized protein	0.673	345-356	KQRLERRLEKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPZ1	Uncharacterized protein	0.616	170-172	RKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQL9	Chromo domain-containing protein 1	0.831	1032-1051	PRKRKAASSSAREQRAAKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRQ5	Clustered mitochondria protein homolog	0.847	620-639	KPKAKKLTSAEKKAAKIAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRQ5	Clustered mitochondria protein homolog	0.63	588-592	KKEAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYB9	Uncharacterized protein	0.706	405-414	RKKKSTKTPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W280	tRNA (Uracil-5-)-methyltransferase TRM9	0.988	190-203	KHKKEKEAKRKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4A1	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.976	46-61	RDGPRKGKNKKEKKQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U0	pH-response regulator protein palH/rim-21	0.792	439-451	SPRAEARKRRSIH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U0	pH-response regulator protein palH/rim-21	0.711	393-405	SKRKGPQSGRDEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8A0	UV DNA damage endonuclease	0.995	486-503	RPWKPKSKKAAKKSRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8A0	UV DNA damage endonuclease	0.982	596-620	KAPAKKATPAKRAAAKPTKKKAAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8A0	UV DNA damage endonuclease	0.839	553-573	PKRIIKTKTENAATPAKKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W973	Transcription factor BYE1	0.947	177-193	GERPWARKKGSKPKARP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W973	Transcription factor BYE1	0.935	279-298	KRRHEASAEKPNASKKRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W973	Transcription factor BYE1	0.715	16-24	LARPARRRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W973	Transcription factor BYE1	0.683	76-86	TEKKGQAHGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA30	Integrase catalytic domain-containing protein	0.971	953-970	QPRRRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA30	Integrase catalytic domain-containing protein	0.658	375-382	RGFKPRWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA30	Integrase catalytic domain-containing protein	0.639	350-362	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAF8	Uncharacterized protein	0.817	66-80	RKSRHKRPILPREKF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ59	Transcription initiation factor TFIID subunit 14	0.745	146-153	AAKKKSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL85	Uncharacterized protein	0.836	321-333	KFKKAKKNPRIAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK1	RED_N domain-containing protein	0.997	524-541	KGPKKQRKRGGKKRKGDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK1	RED_N domain-containing protein	0.838	199-224	REKAEKKGEKMRTPPPVAGVKRSRND
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK1	RED_N domain-containing protein	0.72	286-292	EKRKVKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK1	RED_N domain-containing protein	0.612	557-558	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP51	Uncharacterized protein	0.719	27-38	RHRATKQRAKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.888	495-556	REKVLVKLEKEKREHEEERKHILAEARAKQAREEREAEEQREKILTAMEKKKKREEEERQRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.789	658-668	EEEEKKRKEKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.739	675-688	RKQREREEEEKRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.717	337-355	REERDRERRELEEEKKRAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.713	455-486	REKVLAKLEKEKREQEEERKHILAEARAKQAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.689	417-435	KILAKLEKEKREQEEERKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.682	563-577	KMEKEAREREAREKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.681	391-406	EERKRILAESRAKMSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.622	645-648	KKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.615	440-443	ARAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.608	386-387	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQZ7	Uncharacterized protein	0.604	656-656	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVG9	Uncharacterized protein	0.813	219-231	KVREAKRLEKKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVG9	Uncharacterized protein	0.681	267-272	RKGKHR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVL9	Uncharacterized protein	0.89	140-177	RAANRKRAEGKRAEEAQTRAVARREKKAQIEAAKQAKM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVL9	Uncharacterized protein	0.627	185-192	RAEKERQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ28	Uncharacterized protein	0.68	547-554	RGRGRGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZF4	ABC drug exporter AtrF	0.699	1535-1541	KLKGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZI5	SWIB domain-containing protein	0.996	141-166	RATRGGNTKRRAPAPKKKTKKKSSNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZI5	SWIB domain-containing protein	0.685	110-115	KKKVKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W265	Uncharacterized protein (Fragment)	0.658	517-524	RGFKPRWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W265	Uncharacterized protein (Fragment)	0.639	492-504	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3S5	Uncharacterized protein	0.878	606-635	GKGLREKGKEIQSRLAEIRERQKAGDKRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB80	Uncharacterized protein	0.706	99-106	AKHKRRLE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB80	Uncharacterized protein	0.624	340-343	RRNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHN4	Uncharacterized protein	0.737	175-183	RSPRKRQRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI79	Uncharacterized protein	0.621	73-83	HKNPEVKQRGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJZ0	Uncharacterized protein	0.928	332-345	KRRKARSSRRRERL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLG5	DUF2040 domain-containing protein	0.846	76-95	PAKAKKGQPPAPPSNKPKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLG5	DUF2040 domain-containing protein	0.731	23-31	KPGLGKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSR3	Subtilase-type proteinase psp3	0.637	248-250	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTX3	JmjC domain-containing histone demethylation protein 1	0.947	45-81	PKAKKQQGWPKGKARGARNSTAAATSSRRKKTTPKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTX3	JmjC domain-containing histone demethylation protein 1	0.773	1190-1212	KASRTPSRGGRNSKTPKSTPGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUX6	Pre-mRNA-splicing factor cwc2	0.98	50-64	KKVKKIIRRKRRPAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUX6	Pre-mRNA-splicing factor cwc2	0.611	304-305	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX87	Uncharacterized protein	0.667	526-536	KPTKTSKPSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXR4	Component of oligomeric Golgi complex 3	0.786	17-27	KPPEKAKHRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXR4	Component of oligomeric Golgi complex 3	0.655	87-95	KEKALEKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZN4	Protein kinase domain-containing protein	0.996	368-390	ERKAKRRERKRKEKEAEAKSLRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZN4	Protein kinase domain-containing protein	0.614	532-535	RARS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.999	552-592	GKAKPRARKPAAKRKRGKEDPKETPRPKKLKRIRIRIRIPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.944	237-266	KEEKKTSTRRAKKEPRDATPVRSRGRQPKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.864	165-185	PAKRGERRKAAAEAPSRTRST
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M6	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.758	199-212	ASRRSGRQSRRRQV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Z1	Uncharacterized protein	0.98	10-35	EPPQKRPRGRPRKDGRPAGSVPKVAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Z1	Uncharacterized protein	0.713	54-62	KRGRGRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4E1	NIMA-interacting protein TinC	0.998	781-806	KRMKKERKKREKEEKEEKKHRKHKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4E1	NIMA-interacting protein TinC	0.986	816-845	KRRSGSGEHRRRSRSREHGHEHRRKKSGSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W524	Stage V sporulation protein K	0.723	968-975	AKRLKKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W524	Stage V sporulation protein K	0.65	1720-1725	RQKKLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6L2	Phosphatidylserine decarboxylase proenzyme 2	0.999	243-267	KKAEKREKRRKKLKLAKLKRKAKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6L2	Phosphatidylserine decarboxylase proenzyme 2	0.652	774-779	KKRIRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W717	F-box domain containing protein	0.845	148-169	RRKPRNGPSPHAIRKRMSKLLG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W717	F-box domain containing protein	0.65	250-256	KSKSKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAW7	mRNA-capping enzyme subunit beta	0.679	53-57	PKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC20	C2H2-type domain-containing protein	0.894	137-161	KERAKNGGRKPVLKGEREAREERGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC20	C2H2-type domain-containing protein	0.81	36-52	RRSPGSGDRRTGRRRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC20	C2H2-type domain-containing protein	0.695	815-835	RDGRGRPPVNGGRLTPPRGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC46	Serine/arginine repetitive matrix 1	0.997	151-235	RPERGRGGGGRYRGNDRRGRGRDFDRGPPRRDSRSPPRRRFSPPTRERDVYIPGGGRGRGRGGRRDRSRERRRSPSGGRSASPPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP17	Protein kinase domain-containing protein	0.627	729-731	KRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP81	Uncharacterized protein	0.746	95-115	RGRRLKHYARSRGSRTPSPTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVE8	Class II aldolase	0.949	88-139	RRKTLPPLPTSPRSLAPKSPRSLAPKSPRSLAPKSPRSVAPKSPRPVAPKTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZU9	Zn(2)-C6 fungal-type domain-containing protein	0.847	53-64	TPRKKPEPRRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W235	Uncharacterized protein	0.995	69-129	VPGGRSSRPRSRSPAFRRRSRSPRRDDNWRARPRSPPRRAFSPRRDDYRSERARSPPRRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W235	Uncharacterized protein	0.99	22-65	PRSPGLRPRSPPRGDSYRARSPPPRRGSPPPRRGSPIRRGIASA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W235	Uncharacterized protein	0.871	139-201	RSPRPRERSPLPRERDVSPARSRGVRSPVRPSRYEEPRSRVNSPPRRYSPVRDYRRRSPSPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W235	Uncharacterized protein	0.777	278-294	RSRDFSRERERSPPRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Z3	Exonuclease 1	0.879	90-101	KDRRERRKEGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Z6	Chromatin structure-remodeling complex protein rsc1	0.986	158-213	GKRKRRRGPRSTAAITKREGGSRAAKEDIKNDDPESRKKRGRPPRVDTPMEARIKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Z6	Chromatin structure-remodeling complex protein rsc1	0.915	729-758	AKAKKEAVKASKRKADAANAGEREAAAKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Z6	Chromatin structure-remodeling complex protein rsc1	0.714	259-265	KRKLKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Z6	Chromatin structure-remodeling complex protein rsc1	0.615	215-220	MKAIRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W976	FF domain containing protein	0.95	509-538	RAKKWAERERREKALADRERRVREEKRKQE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W976	FF domain containing protein	0.696	188-194	REKKERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEE4	Uncharacterized protein	0.948	142-157	FKSKRQKKKEKQAPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEE4	Uncharacterized protein	0.825	229-238	RSKKKADKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEE4	Uncharacterized protein	0.745	96-113	KRKAKAHIAAKQEAARSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFB1	Eukaryotic translation initiation factor 3 subunit C	0.938	818-842	GRGNRGGRGGGRGGGGRGGGGPRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFY4	Uncharacterized protein	0.95	368-403	AKGKVTKKGKSARKVAALEDEKVEHRKSKRQRKSPS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WID8	Uncharacterized protein	0.916	667-691	RKAQKKNMSKWARVKAGFKRRFGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTB0	Uncharacterized protein	0.748	270-282	GRKRRPILVIKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTH7	Uncharacterized protein	0.998	459-490	KDRKERKRLAEKRRLLEKARMKGRKGKKASKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTH7	Uncharacterized protein	0.781	397-405	PPPRKPRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVN5	Tetratricopeptide repeat protein 1	0.998	966-1046	RRLREAEVRRREEEKKRAEEEALEKKRKYAEEQERLIRRDRELMEKRNEEERRRMEEDEDKELRKAERKARGPKGPKRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVN5	Tetratricopeptide repeat protein 1	0.987	1082-1100	RPREKKKRKLARKSEPAGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWE7	BZIP domain-containing protein	0.928	44-74	PRKKPKKVNSEIRKQQNRIASRNYREKRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWS9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.988	423-447	VRAKRIKKIKSKAYRRVHRKERERM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWS9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.907	710-755	KAKKERKATKEPELFPAPATTKPAASEKSKAQSKPTPKAKEQKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWS9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.877	112-123	KSHKGKAKKSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWS9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.765	175-182	RERNKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWS9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.71	52-57	KRRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWS9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.704	477-491	ERMGAKHRESKWAKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWS9	Small nucleolar ribonucleoprotein complex subunit Utp14	0.629	884-888	KRKDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYT2	DNA-directed RNA polymerase III subunit RPC9	0.985	164-179	GASKKRRKIKRRVDKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ06	60S ribosomal protein L8	0.664	250-254	EKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZD1	Uncharacterized protein	0.995	107-145	PKKAAKAAKKAAGKLKAAAKPLNKAQRRTEKKERERKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4J3	HET domain-containing protein	0.966	342-385	HRGARLSERGKAAIELLARKLARNKKTKRLSIYLRRKIKLDKPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4J3	HET domain-containing protein	0.872	523-531	RGVKRKRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5C6	Uncharacterized protein	0.713	417-428	KRSRMPRIRPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W715	Uncharacterized protein	0.636	20-23	KRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W754	Uncharacterized protein	0.814	624-643	SEKKAGVRPGEGRGRWADKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W754	Uncharacterized protein	0.602	567-567	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAT7	Exosome complex protein	0.993	213-236	SKKGKKKTKTQKTKAKKEAKKAKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAT7	Exosome complex protein	0.991	353-369	KNKSKKGGKKGTRGKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAT7	Exosome complex protein	0.914	276-287	RKRGRPPKKDKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAT7	Exosome complex protein	0.664	132-140	RMAKEKARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDC3	Uncharacterized protein	0.843	22-51	KKPQPHSHKHKSSRHHRDRLDGHRHSSSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES4	Leucine zipper protein 1	0.989	509-525	AKKRARNKKNKKGGKGP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGY6	Cell morphogenesis protein (PAG1)	0.657	214-221	SRSSRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI68	Sister chromatid cohesion and DNA repair protein (BimD)	0.998	1278-1325	RKAIRNKKRKASDSVDKPRKKTKGDRPIKEKKSRAERTTKTPKKKRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI68	Sister chromatid cohesion and DNA repair protein (BimD)	0.655	1480-1487	ATKAKAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIU0	Uncharacterized protein	0.846	280-306	PIRRKWSHGVKGQEKERKRVMSWGRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIV4	Enhancer of mRNA-decapping protein 3	0.979	240-272	GKKTRRGGKSRKKELAAQERKNGLGPDTSRKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNT0	Uncharacterized protein	0.93	341-355	KKQFPKPKSRPRRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPN9	RING-8 protein	0.782	81-90	RPHRRRREKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSF1	KRR1 small subunit processome component	0.999	311-335	GEKKKKKRKREEGAGKEKNKKKKRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSF1	KRR1 small subunit processome component	0.758	227-239	KKRSLSKRRVPHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSF1	KRR1 small subunit processome component	0.659	286-297	EKMKDKMDAKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVL3	tRNA (Cytosine-5-)-methyltransferase NCL1	0.992	23-88	RKRKDAPVAADPERKKRSRTAAREAREAKAKATPKTRVAGKPVKPVKTAAAVLNGAKAKAKGKPVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVL3	tRNA (Cytosine-5-)-methyltransferase NCL1	0.951	726-739	KKARRKSSEKKSKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVL3	tRNA (Cytosine-5-)-methyltransferase NCL1	0.945	643-703	KTMRRKGRDPKAIVPKGEKSVNGEAKEATKKATKEASKEVPVEKNGVATKEKAGRKEKKGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYW0	Uncharacterized protein	0.99	99-122	HQRTRKYSKRKDSRKKRRGLDKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Y9	Serine/threonine-protein kinase PAK1	0.754	373-392	KRRRLGKNNSHEDKIKREIA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Y9	Serine/threonine-protein kinase PAK1	0.61	395-396	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Y9	Serine/threonine-protein kinase PAK1	0.609	1058-1060	KPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2C3	Zinc finger transcription factor 1	0.681	842-849	KHARKNKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W502	Fibronectin type-III domain-containing protein	0.997	941-980	EDKAKKAAEKEARKAEKAEKKEEKEKKAKADKAEKASRKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W598	BTB domain-containing protein	0.911	294-331	QRFLGRASMRRGKGWRNGPRPGSGMVGGRGGYGRGGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R4	SCD domain-containing protein	0.999	79-104	KERRRKKKARAPARKPASKKAKTNGD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R4	SCD domain-containing protein	0.96	108-131	LAIRPASNAIKKLSKRPRKAPIRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R4	SCD domain-containing protein	0.82	1099-1116	QRKITKKTAKPGKQGEKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R4	SCD domain-containing protein	0.72	19-30	RRKSGRVSKKPD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R4	SCD domain-containing protein	0.613	951-958	GKMVKTPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDR4	Reverse transcriptase Ty1/copia-type domain-containing protein	0.899	442-456	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGH3	F-box and WD domain containing protein	0.619	572-576	RRLRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGQ6	Uncharacterized protein (Fragment)	0.987	302-324	KAPGKRGRGKSRKTPGPGKDRKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJM9	RING-type domain-containing protein	0.993	22-50	PKVAKRRRSRAADPWAKRRKPSTKPKSPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLV9	UBA/TS-N domain containing protein	0.715	723-733	PKRPPPVRKPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMX1	Uncharacterized protein	0.922	68-79	SRKRRRSRKGLD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVG5	DNA methyltransferase Dim-2	0.738	1064-1073	PGKRAKPSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW44	Btz domain-containing protein	0.842	193-216	RPAGRGRGRGAPIRGPFSPAKALR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW44	Btz domain-containing protein	0.693	68-77	SKRKANGARD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXI5	DASH complex subunit DAM1	0.893	179-222	PRGRGGIPRAGGRGGIPTRGGATRGTRGGTGIARGVAGRGRGAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXI5	DASH complex subunit DAM1	0.611	17-19	SKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYD4	Phosphoglycerate mutase family protein	0.941	95-103	HRPKKKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0N8	CDC50 domain containing protein	0.723	24-31	KKAKSRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0S5	Uncharacterized protein	0.667	1441-1450	RPKVAQPKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W158	Uncharacterized protein	0.879	225-251	RRGPRRNGRDERDGRDMRGRGRGGGRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W158	Uncharacterized protein	0.753	181-190	RAPRKRSPAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W158	Uncharacterized protein	0.73	312-326	RRYRSRSRSDNRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2J5	Uncharacterized protein	0.9	359-386	RSIKRLKNSASRKSLKRQSSRLHRKFSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W441	Meiotically up-regulated gene 56 protein	0.961	1048-1073	NRKEGKRTKLKRVAKLGSKGRSVVFR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W637	40S ribosomal protein S8	0.976	8-56	RHKRSASGAKRAYYRKKRAFEKGRQPANTRIGTKRVHLVRTRGGNRKFR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W637	40S ribosomal protein S8	0.792	123-145	RRRQAKAGEKEEDKKKSNSVTKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W807	EF-hand superfamily Ca2+-modulated protein	0.919	3-20	PKRRARTKAPPTKRPSKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8F6	60S ribosomal protein L12	0.817	86-99	KEPPRDRKKEKNIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9B8	Uncharacterized protein	0.85	120-129	KRRKRGKGLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9H8	Uncharacterized protein	0.788	6-13	KKIKKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCE9	Uncharacterized protein	0.812	1000-1016	KKKEKEKPIPVPKAPTP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCE9	Uncharacterized protein	0.77	610-627	KKRYVKAAGNKKEGKLSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCE9	Uncharacterized protein	0.614	640-642	KAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI19	Zinc finger containing protein	0.972	314-329	KEEKKKKKDKERAPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLB6	tRNA pseudouridine synthase 1	0.983	15-67	NRGNDKKRKWADKDRRNAARGGGGRQQGGSHPNKKRNMGHRRDRNKEQQAKIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRR5	Uncharacterized protein	0.677	440-445	GPKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTN3	ATP-binding cassette sub-family F member 3	0.908	45-64	VDRKKLEKAERKLRAKQDRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH7	Histone acetyltransferase	0.968	361-394	KPKKKIVLPTREQERQERRRQRDRERRERNRRAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH7	Histone acetyltransferase	0.875	313-330	RLRPARARRGQPKRTDKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH7	Histone acetyltransferase	0.759	872-884	RRRPGRPFGSRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYH7	Histone acetyltransferase	0.727	256-261	TRKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0B5	Uncharacterized protein	0.658	108-115	QPRKESKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1X0	Cytokinesis protein sepA	0.934	1469-1490	RAAKPEARDQRDRRRRARLKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1X0	Cytokinesis protein sepA	0.722	1078-1085	IGKKSGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1X0	Cytokinesis protein sepA	0.613	1598-1600	RRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B3	Uncharacterized protein	0.868	64-99	KKKAAKVPSSFVERQEKLKVSKRKGPLQERQREKTH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7X5	Translation initiation factor eIF-2B subunit delta	0.934	92-124	DKSRPLALRRRPSQPNTPTAKEPEKKSKKEKEP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7X5	Translation initiation factor eIF-2B subunit delta	0.698	46-59	LKKQKQAEKQAKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8W7	Uncharacterized protein	0.922	272-287	KGKKKPPPTPKHRHGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W925	Smr domain containing protein	0.951	198-210	HRGKKGKNKKKQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD02	Uncharacterized protein	0.764	2142-2155	KPERPERPKSLRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD02	Uncharacterized protein	0.702	1787-1796	ERSERRKDRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD02	Uncharacterized protein	0.697	1802-1818	RESRESRESKRESRELK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD02	Uncharacterized protein	0.613	1579-1581	KGP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD02	Uncharacterized protein	0.601	5-5	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFC3	Uncharacterized protein	0.661	181-186	HSRKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIK0	M protein repeat protein	0.992	10-36	EKMAAAKKRVEQLKKQRAKKAGGKKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK01	Uncharacterized protein	0.72	200-209	VKKRWSKMRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP85	Uncharacterized protein	0.977	23-88	KSDKSDKSHKSHKSDKSDKSDKSDKSDKSDKSHKSHKSHKSHKSDKSDKSDKSDKSHKSHKSHKSH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT12	Uncharacterized protein	0.982	505-538	PPKKASKKAAQPKVKALAPAASSKANAKPRKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT12	Uncharacterized protein	0.855	607-613	KKKKRKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT12	Uncharacterized protein	0.776	384-426	RTTKEKLKEKEAKLERADRAETAPPAKSSSTAAAKPAKNSRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTE5	Integrase catalytic domain-containing protein	0.902	994-1008	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXU1	Uncharacterized protein	0.992	379-442	NGLRRRKRAMKKKLYMRNRGEEVKHVKHVKRRLNRGEEEEKQVKKEKRAMQKQKQKMMRLNPRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXU1	Uncharacterized protein	0.791	249-268	RKQRKSKDDKREVEGKGRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYL5	AMPK1_CBM domain-containing protein	0.914	788-806	KKKKRRSFFGKLKDKLSSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZA0	Uncharacterized protein	0.988	195-229	RKPGWGEGGKKVRIVRRLLALFKRKSKAGRKKAVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2W9	Mediator of RNA polymerase II transcription subunit 6	0.967	313-331	GSKGSVGPAPKKKKDRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7W0	Uncharacterized protein	0.887	9-26	PKPPSDSRIRKPLRKRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7W0	Uncharacterized protein	0.819	133-147	KQKLGMGAGGKRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8R8	Uncharacterized protein	0.795	51-60	RHRRRRHKSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W996	Integrase catalytic domain-containing protein	0.902	1034-1048	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA4	DNA topoisomerase I	0.992	193-244	VKKRAPAKKTNGVKKQESDSDAPIAKKSAAKKATKAKPAAAAPAKKTKAKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA4	DNA topoisomerase I	0.974	152-182	KKKESIEKAAAKEAKAIRTKDKAAPKRKQKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA4	DNA topoisomerase I	0.667	431-442	RGEHPKTGRVKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA4	DNA topoisomerase I	0.663	382-392	KKKALSAAEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA4	DNA topoisomerase I	0.637	515-520	RELKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDJ5	Uncharacterized protein	0.972	293-307	KHTKPRKGGRRGKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE81	Uncharacterized protein	0.754	179-194	AKKDGDKPKDKTPKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGH4	Sec1 family protein	0.98	573-589	KPGKEEKEEKKKKKKLH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIK1	Uncharacterized protein	0.989	412-449	KPKSVARKMGRKPRKVKSWANSIITRKGKHSKRVKARS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIK1	Uncharacterized protein	0.93	865-882	REAPKEKKKKNIGSRLRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQA4	Uncharacterized protein (Fragment)	0.698	6-12	KRVRRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRS8	Uncharacterized protein	0.68	526-533	SKRKMPVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSU0	Pumilio domain containing protein	0.998	5-108	KRKSAGATAPEIKTKSKKVKVDKPTSKHESKHEVKPAKKPSKSKRKRALVDPKSRTLASRKPAFMANNSREAHAKQKALAKERKAAKPNADIIERSKKLWEKLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSU0	Pumilio domain containing protein	0.676	644-649	NKKQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUD2	Integrase catalytic domain-containing protein	0.899	1034-1048	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVF1	ISWI chromatin-remodeling complex ATPase ISW2	0.96	993-1002	TKGKGKGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVF1	ISWI chromatin-remodeling complex ATPase ISW2	0.925	146-165	KKSKASKVRKGGAAAERRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW01	Uncharacterized protein	0.996	4-36	PHTPKKRGRSDGKNKKRKDTRIGLRKIRGPNGI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW07	Uncharacterized protein	0.998	2773-2856	RRQRRRSRRPSKLEERPKTRRISVTEKERPSGRRVESDRPRTRDRGEERPRPKRGETERRDRRKKKEESSGLKGLLGGLKRRIA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW07	Uncharacterized protein	0.989	2405-2521	HVKRRIVDEKEEEAERQRRREARRAEKERLAAADAARLKAEEEARKLEHRERRRAVKRAEEELVRAIEERRRLKEEKKAAAEEEERRIRHEKRRQRHEAEKEARRQEQEAKLLEKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW07	Uncharacterized protein	0.897	278-326	APPPPKEEKKKVTTPISIIKKKERRSSSLSVSSIEKPKISKGDKKSKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW07	Uncharacterized protein	0.897	2311-2374	KTRRRHSRAHRDGHHHSSRRRESGASTRDRPAMPSTAPPEPPKTKRRDSMTEREAAERRKERLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW07	Uncharacterized protein	0.893	2529-2548	EEEARRLRRQKRAEREAAKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW84	RNA polymerase II transcription factor	0.711	605-609	RKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W195	Uncharacterized protein	0.805	71-82	KKKTSYRKKRQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W195	Uncharacterized protein	0.683	136-146	KQAKQLKRDRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8T5	STAM binding protein	0.697	104-109	RIKKRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8T5	STAM binding protein	0.611	115-117	RRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9V2	Uncharacterized protein	0.887	154-166	KRRRTSRKEREKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA80	Ribonuclease P	0.937	51-68	KPAPKSRKPVNRKKLAKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCL1	MFS domain-containing protein	0.752	509-527	QKLAEKKKLQSEAKEKEKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE27	Uncharacterized protein	0.914	381-401	RKRKSRSLVLRWLGLKKPKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG24	Prolyl-tRNA synthetase	0.879	20-41	KKSKKDGNPQKAAKKPQQQKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHC0	Uncharacterized protein	0.901	535-556	KEEQKSKLKKIFKGWIHKKEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHK7	Acetyl-coenzyme A synthetase	0.668	622-628	DKQRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL81	Uncharacterized protein	0.744	24-36	PKHAKGSRPPRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN77	Sodium transport ATPase 5	0.916	248-266	KGSRVREVKRKPNGKAKPH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSR2	Beige/BEACH domain containing protein	0.694	644-658	RALRPKASFARLRKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSR2	Beige/BEACH domain containing protein	0.611	1244-1246	KRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL0	Uncharacterized protein	0.98	27-40	AKPEPRKRRHKKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL0	Uncharacterized protein	0.634	163-165	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W061	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	0.675	111-115	KKKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W450	Uncharacterized protein	0.715	42-47	PPKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W579	YDG domain-containing protein	0.985	110-148	KAGKRKVLAQKPEERRTKKEQVRKKQKEEAEKKAEGLKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA91	Deoxyribose-phosphate aldolase 2	0.697	222-228	KSKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB44	Uncharacterized protein	0.945	9-64	AKKRKQAKKTGGAEDASRSKKPSTSTKASSAPEEEKKTAKKTPTLAKSSKPIPTKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD93	RNA cytidine acetyltransferase	0.993	968-987	KEAEKFKEKKSKKHKSGKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD93	RNA cytidine acetyltransferase	0.949	69-83	HRKKREKKIKNEIKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD93	RNA cytidine acetyltransferase	0.632	956-958	KRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES3	Serine/threonine-protein kinase SRPK2	0.748	26-31	GKKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES3	Serine/threonine-protein kinase SRPK2	0.667	294-298	GRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIQ9	60S ribosomal protein L5-B	0.868	256-293	KKEEGAGPKKSKDEWKAESLKYRTKKLTKAEKEERVKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNR3	Uncharacterized protein	0.781	135-154	PGRRRSSTVSSGRPKAIRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNR3	Uncharacterized protein	0.763	353-381	KKAPGKDGHARNKVATKATSRRAPSAASR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRN3	Uncharacterized protein	0.888	72-84	AKKPKKVKERQRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV70	SNF2 family ATP-dependent chromatin-remodeling factor snf21	0.997	1048-1097	RKEAKVAKRGRKSGGRPEEDSPVPSRASSEEPMPKKRGRKPKAEKRKADE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV70	SNF2 family ATP-dependent chromatin-remodeling factor snf21	0.735	1105-1112	APRKRGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVK3	Uncharacterized protein	0.724	44-53	PAPRKVKGRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW38	Sec3-PIP2_bind domain-containing protein	0.685	805-809	RRKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW38	Sec3-PIP2_bind domain-containing protein	0.6	263-263	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXF1	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16	0.947	83-120	RPEKSSKRKKPEVAPESAKPNTKSDQKAKPRSKQSEKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXF1	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16	0.946	22-32	KKGKKRKRAQP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W030	Uncharacterized protein	0.656	111-115	KAKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Y7	rRNA biogenesis protein RRP36	0.984	266-328	REHKKKEKELVKEGKKPFFLKKSEQKKIALVDRFQNMKAKQRDKVIERRRKKVTAKERKNMPD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Y7	rRNA biogenesis protein RRP36	0.875	116-136	KAEKLANGTQPSKKAKKSKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Q6	XPGI domain-containing protein	0.696	88-94	PWKRGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8E0	Uncharacterized protein	0.64	104-110	NKKEEPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC51	PWWP domain containing protein	0.994	99-128	PKKATNGKRKSGAGVPEHKKKTPAKKGKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC51	PWWP domain containing protein	0.988	329-366	ENDKRAKTPKTKLKLTTKTPKEASAAKLKKEPKSKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC51	PWWP domain containing protein	0.963	312-325	TKKKATKKRKKTDE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC51	PWWP domain containing protein	0.76	279-290	KKEKAEKSAKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE67	C-4 methylsterol oxidase	0.958	277-291	SKRRRERKLAKARKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEB1	Mediator of RNA polymerase II transcription subunit 17	0.677	584-590	GKDRKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEM4	Stress response protein NST1	0.998	470-630	RKDAKEAKKAKEAQKRKEKKDKQKQLKAEEKARKDAELAAKEAEAKAAEEKRLEEQRKKREEQRKKKEAERKAQEEERQRKEAERLKRQQEERERQQEAERKAREQKALEKKAKEEAKRKEREEREAKEKEAREKKAQEEKERKEREAKSKSEKDRTRKED
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEM4	Stress response protein NST1	0.987	103-119	RGGSSKKPRRKKKAPSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEM4	Stress response protein NST1	0.952	19-34	RKKQKRREKEAAKRAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG64	Leucine carboxyl methyltransferase 2	0.845	9-21	PKKSAPKRKGNQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJI6	Uncharacterized protein	0.894	374-388	GKKAPPPPPPKKKEL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJL8	Uncharacterized protein	0.783	626-635	KKREKKGWRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNE5	Glycerol uptake facilitator protein	0.707	529-538	KKNRTKERAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRL8	F-box/LRR repeat containing protein 2	0.889	653-662	GARRRRRRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRL8	F-box/LRR repeat containing protein 2	0.609	683-684	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW9	Uncharacterized protein	0.972	273-295	KGRPPGTKKSTDPDKKKRRRVAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW19	Uncharacterized protein	0.998	113-150	KHKEELEKKDKEKTEKNRLKREKARLRKERAKKGGKRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2R7	Transcription factor IWS1	0.999	117-146	HKRKRAAGENEEPKKKKKRADKPRRKKNKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2R7	Transcription factor IWS1	0.972	156-173	GDRRSKRSKKGGKAARGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2R7	Transcription factor IWS1	0.631	207-210	RRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3F3	Eukaryotic translation initiation factor 5B	0.999	136-208	RVKTKAEKEKEKKEKEKQRKKELAAKKKATGPAKAEPAKPESKPEAAAAPAAATPTPEAPAAGGKKKKLNPAL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3F3	Eukaryotic translation initiation factor 5B	0.991	310-334	KKKKPKYDDRKKKKKQAETQKEKEA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3F3	Eukaryotic translation initiation factor 5B	0.97	247-283	QKRKEEAKALKKQKEKEKIEQLKKEGKYMTKAQKEAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3F3	Eukaryotic translation initiation factor 5B	0.937	57-67	AKRGKKKNKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3F3	Eukaryotic translation initiation factor 5B	0.662	217-221	ERKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3F3	Eukaryotic translation initiation factor 5B	0.614	112-115	KKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5I0	Uncharacterized protein	0.968	680-699	TRAKKRKPLGILKSKKARGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5I0	Uncharacterized protein	0.709	650-655	GKRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W647	Uncharacterized protein	0.924	48-70	RTPKRKPCRPSPPKRAKQSPPKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEB5	Ribosomal protein S6 kinase beta-1 (P70(S6K)-alpha)	0.988	83-97	KKAQKNKKKKKKGLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEB5	Ribosomal protein S6 kinase beta-1 (P70(S6K)-alpha)	0.772	481-505	RKDPKKRLGFNRAKDLQTIKKHRFF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEI6	Hva1_TUDOR domain-containing protein	0.999	244-288	AETKPAPKKGGRPKKEKKETAKKKKEPKKAATADGQPRRSGRNKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHU4	Uncharacterized protein	0.709	372-385	KKRANAAKQTAKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ86	Uncharacterized protein	0.994	297-320	KHKKMEEKAAKEAGKKKKTRKEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ86	Uncharacterized protein	0.654	1095-1106	RRSSHSRSQKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKA3	Uncharacterized protein	0.934	138-175	KLPSRKRSEIRAKPVKSTTRETPRRRDAHQKHGEKRGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQM0	Endopolyphosphatase	0.996	700-717	KKGKKHNKGKKGKHHKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQM0	Endopolyphosphatase	0.987	525-539	MKHRGKKDKKKRKYK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQM0	Endopolyphosphatase	0.905	613-633	KIKQKRWNEGKHKKHQGKQPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSZ5	Inheritance of peroxisomes protein 1	0.891	188-206	RPKSPPRRVVKRKPSGQAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTX7	CwfJ domain containing protein	0.939	288-301	RGRRGNKRRKGEPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW14	Methionine aminopeptidase 2-1	0.997	66-79	AKKKRKRNKKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW35	DNAJ domain containing protein	0.979	351-366	PKKSRAKPKARKHGRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW35	DNAJ domain containing protein	0.978	216-253	KAKEAEKKRREDFDKRQAKEEAAPTNGKSKAKPKAKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW35	DNAJ domain containing protein	0.718	309-321	RKKQKTNSRSKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZD0	Amine oxidase	0.998	196-213	EKKGKAKKSKKNKKGKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZI8	Uncharacterized protein	0.999	156-219	KRKAAEAAAEESKKRVWTKAWPKNSDRLKKKKKKFRYETKTERKAERMKQGMKKRKQKEARTSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZI8	Uncharacterized protein	0.901	35-67	KRKLARIKHAQEENAKREKEEKLKFRRELREQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3H4	Uncharacterized protein	0.988	220-234	KKEKKDKKHKKHKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6C5	Phospholipase	0.643	41-51	RKLPFKIRNGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8P2	Uncharacterized protein	0.99	33-46	EKPKPKKKRHAKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD89	Uncharacterized protein	0.735	170-176	KKARRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFJ7	Uncharacterized protein	0.993	163-188	KEAKKKAKKERHLQRKREKAAPKLHH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFJ7	Uncharacterized protein	0.767	114-123	KSNKSKKPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHV8	SH3 domain signalling protein	0.956	409-422	AGKKKPPPPPPKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNT4	Uncharacterized protein	0.906	125-135	PKKKPTPRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNT4	Uncharacterized protein	0.804	99-108	AGNRKRKSKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPH0	Uncharacterized protein	0.921	292-330	KKKKKEQERQKNEREIRREEIARARDAEREERLAERREK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPH0	Uncharacterized protein	0.89	28-61	SHKKHQESRRRSRSPHGDRDNDNHRYKRRRTRSP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS65	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit	0.615	182-186	KRMRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT24	Kinesin-II 95 kDa subunit	0.943	608-620	KAPKPKPKPKPKW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT24	Kinesin-II 95 kDa subunit	0.893	658-671	PKAAARKPKKTTKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVL5	Uncharacterized protein	0.963	93-113	SKKPKINKDGAPRKPRQPRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWK8	Uncharacterized protein	0.835	1771-1779	RNKRRRKAF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZF1	Uncharacterized protein	0.984	243-274	KRKELEHRGRDDASLKSSRSPKRIRSKSKERK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZK2	Uncharacterized protein	0.858	101-115	RKDAKSARIKKNKKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZK2	Uncharacterized protein	0.657	158-164	KNPKGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Z7	Lysophospholipase	0.973	717-748	ERKKALREQREKEERERRWRWKMRQGRIAGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W447	Uncharacterized protein	0.718	1252-1262	RKKGSKDSAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W615	Uncharacterized protein	0.706	41-47	TSKKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W747	Uncharacterized protein	0.988	87-113	REQRKRERRRAKSAAKAPSRSLSRGRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W747	Uncharacterized protein	0.984	39-67	KNRKTKGKSRKERRQSEEPSARRSSRRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W747	Uncharacterized protein	0.981	447-515	RSRSRSDRRSTSRSRSRSRTRTHDRERSKGPGLRARSRSIIDRFRSKSRGPEDRDAGRDDRRDDRRDRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W747	Uncharacterized protein	0.605	546-547	HR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFF3	60S ribosomal export protein NMD3	0.898	410-426	RSKKNKNKRNWRVKRMN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFV8	Sister chromatid cohesion protein	0.968	1789-1820	RGRKRKSNVNLGNTPKKARSRTSGSKKKGRNS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG80	Ribonuclease P protein subunit	0.978	46-75	ARAVRRRALNDRKEVNRKRSKNKPRPLSAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGL5	Uncharacterized protein	0.698	367-374	PRAAKRPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNB9	Uncharacterized protein	0.704	516-525	RRPKWMKREK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS98	Uncharacterized protein	0.692	213-222	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSE2	APH domain-containing protein	0.779	58-68	RIKKRPSRWRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTW6	rRNA adenine N(6)-methyltransferase	0.87	320-334	SKSKNGVNRKRKGRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV68	Uncharacterized protein	0.996	286-307	GGGGGRGGKKGGKGGRGRGGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV68	Uncharacterized protein	0.937	221-267	RLGEEKRRSEAREAGIVLERESRGGSGAGKKGGERRERGVGGPSVGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVD0	Uncharacterized protein	0.689	20-27	NGVKKPPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0B3	Transcription factor TFIID complex subunit Taf13	0.999	120-155	AKGAGEGKEGKKDAEREGGEEGERRKKKKKRREGGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2X3	Uncharacterized protein	0.795	276-286	KAKSKAHKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Q5	Uncharacterized protein	0.66	1355-1360	KPKLKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5M3	C-type cyclin	0.716	579-591	KKESKGKDEKRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5M3	C-type cyclin	0.672	441-448	ARPNKKIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA89	RING finger domain containing protein	0.97	699-711	KKQAGGKKKKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA89	RING finger domain containing protein	0.944	545-568	IERRRKKHTEKETKEEKARQRAEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA89	RING finger domain containing protein	0.774	346-376	IRSIREAKEKLKGIGNPPEEPAKPAEPKMKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC74	Galactosyltransferase	0.997	437-454	KKKKKAKKDEKKKDEKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEI3	Ribosome biogenesis protein Ssf2	0.972	353-384	KKWAQRNKEKEERRRIQKENVEKKRKEKAAAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEI3	Ribosome biogenesis protein Ssf2	0.887	281-311	RREKEKLKAGDETSHARARGSKPRVEKRAVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEI3	Ribosome biogenesis protein Ssf2	0.845	5-25	RGTARKKQSAKDKELAKKPQA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEW7	Uncharacterized protein	0.64	1274-1277	KRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUG8	Chromatin-remodeling ATPase INO80	0.958	1734-1750	GGKRKKGGLSKKAKTAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUG8	Chromatin-remodeling ATPase INO80	0.951	1685-1697	APPGKKRSKKKQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUG8	Chromatin-remodeling ATPase INO80	0.925	494-508	KERKKDMQRKRRREK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUG8	Chromatin-remodeling ATPase INO80	0.896	590-608	GKRKGNRGTGRLKKSKEQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUG8	Chromatin-remodeling ATPase INO80	0.787	445-451	SKRKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV37	Sphingosine N-acyltransferase lac1	0.943	31-42	PKRRKPKTKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW48	Usp domain-containing protein	0.821	266-277	KKRERGRQRSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW48	Usp domain-containing protein	0.748	602-612	RKRLRKHSKYK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXQ7	Uncharacterized protein	0.961	125-181	SKTPAASRKRERPAETKMTTVKQQKRRPPSPLRTSPRLAKRQKTEVNGKKKVVDKAG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY38	Spindle pole body component	0.958	888-904	PERRRRKGSQKREREKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY38	Spindle pole body component	0.835	176-189	AEKPEKPEKRRERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1G3	Uncharacterized protein	0.626	114-118	RRSRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4D0	Autophagy-related protein 2	0.939	1762-1782	RPRGTTRSKRRLKLERSKHKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5D3	SP-RING-type domain-containing protein	0.992	1087-1111	RDREREREKREREREKKEREREKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5D3	SP-RING-type domain-containing protein	0.9	86-110	VRGRVRPRKHGVQLPKRPTIKPPSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5V8	Uncharacterized protein	0.813	179-191	TNRRHKKHEKNMR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R6	Uncharacterized protein	0.692	914-926	GRGRDDRDERRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7H2	Uncharacterized protein	0.891	256-286	KKKITKTKTKHAERLLCRKRLALKKKLEKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7H8	Uncharacterized protein	0.871	171-178	KKKKKPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7H8	Uncharacterized protein	0.852	9-29	AKRKAQRESTKQPGKPRAERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBP0	BZIP domain-containing protein	0.954	438-459	EKRRRNAGASARFRARRKEKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD29	Uncharacterized protein	0.998	89-120	AKQKRVLKKARKRKVEAKKAEGAKRSEKDEKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDL4	Peptidase A1 domain-containing protein	0.716	509-522	RRKSAKIDKHKDPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP3	AdoMet-dependent rRNA methyltransferase SPB1	0.997	774-835	RLMSRAAKKKPKQKVSVIVAKGGNKGIKNRPKGTKGKYKMVDARLKKDVRGEKRAAKKNKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP3	AdoMet-dependent rRNA methyltransferase SPB1	0.988	718-754	KEKLRALNARPIKKVREAQARKKFKAAQRLEKLKKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP3	AdoMet-dependent rRNA methyltransferase SPB1	0.959	374-393	KEKESKSKKKQRRAENERKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP3	AdoMet-dependent rRNA methyltransferase SPB1	0.669	6-22	KHGKGRLDKWYKLAKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP3	AdoMet-dependent rRNA methyltransferase SPB1	0.629	237-240	KKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK77	Kinesin-like protein	0.959	679-714	KASPRRKKILGIAVKKGVQFSPARKKSPSKTKRGVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ40	Uncharacterized protein	0.992	3-30	RSGRRNRSYRRWRRRRSKKDGDSRDRGS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ40	Uncharacterized protein	0.865	44-58	GRSKSGRSKSSKSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVR5	NADAR domain-containing protein	0.627	4-8	RKPHR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYQ9	Phospholipase D	0.935	249-261	RRPRQKRRKSSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0G8	Uncharacterized protein	0.932	146-166	ANKKKRGRPTKAEAQQRAREA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1V6	Zn(2)-C6 fungal-type domain-containing protein	0.714	51-57	RGRRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2W4	Kinesin light chain 3	0.866	185-199	RSKSKKKFTRPRLKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3X6	Uncharacterized protein	0.812	173-181	GAKKGKHKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3X6	Uncharacterized protein	0.715	160-165	AGRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAE5	RRN9 domain-containing protein	0.988	441-459	RHLKRERRKEKHLERKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAE5	RRN9 domain-containing protein	0.795	624-637	RPKVGNARKRAKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGV0	Histone acetyltransferase	0.674	101-118	KVDKAPSKSDQKSLKRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGV0	Histone acetyltransferase	0.646	94-97	KKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJF8	Uncharacterized protein	0.937	1132-1150	KDKIRERRTEKRREKIRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJF8	Uncharacterized protein	0.821	549-564	SPKPRRASPTSRKSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJN5	Uncharacterized protein	0.999	132-160	RQSKGRAEAKRKRGRRKEGKGKSKDPGSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL17	Uncharacterized protein	0.714	17-26	PRRKNQKLRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL75	Uncharacterized protein	0.957	95-124	CKRNASKSVSSKADAKAKPKKTSAKSAKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL75	Uncharacterized protein	0.779	31-39	KGKAPKKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL75	Uncharacterized protein	0.773	198-211	PPSKTKMKSREKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLV7	WW domain-containing protein	0.98	257-289	SLKAERRAKPPNKAQVKQYQKQRKEKKEAKRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY1	Magnesium transporter ALR2	0.995	42-59	PPKKKKTHRGGKKRRNRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQW6	RRM domain-containing protein	0.928	546-587	KEKVARNPRFNGPPTGPARGGGRANFAPRGGRGGRGGGARGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQW6	RRM domain-containing protein	0.859	193-246	REKKANRDKPSTKANRQGRGEGKEDVVERGEKKILAKPGKENALNAGDKNRRLS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQW6	RRM domain-containing protein	0.781	360-377	NRKERPTRAERRAFKANQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS44	Low-temperature viability protein ltv1	0.917	345-354	GRRKKRKGAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS44	Low-temperature viability protein ltv1	0.647	449-453	RRVKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTD0	HMG box domain-containing protein	1	54-132	KKAVKTAAAKKPATKAKATPGKKAAPAKKTAKTTAKKPAAKKAAKKKPAAKKPGRKRVKKVLTPEEKEKAKIRELRAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU18	DNA-(apurinic or apyrimidinic site) lyase	0.951	311-347	AKPKKTNKRTAKAAKEEEEEVEEKAEPKPKRGRKNTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU18	DNA-(apurinic or apyrimidinic site) lyase	0.669	389-405	KPVKKQSTAKATKAKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU18	DNA-(apurinic or apyrimidinic site) lyase	0.645	256-260	GKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVP0	Helicase SWR1	0.957	347-384	TKVARKKKLTAKDKTEANRRRARFAHIADKWERKRAMN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVP0	Helicase SWR1	0.939	261-286	KGKGKGKAEEVSSKRRRSVRSSAKKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVP0	Helicase SWR1	0.862	139-150	RGKRSTRKGKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W388	Uncharacterized protein	0.788	316-327	GNNKKSKARGKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7Y2	Importin subunit alpha	0.794	24-50	ELRRRREEQQVEIRRAKREENLAKRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8E1	Transcription factor tfiiic complex subunit sfc4	0.998	241-288	PASNRGRRGAKRGRGSSRGRGGYHESRSTRGRRRGKPGRVKGPRGPRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8E1	Transcription factor tfiiic complex subunit sfc4	0.893	742-760	ARGRYAVRKRAALRNKKRM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8M8	Ubiquitination network signaling protein	0.738	404-413	KASTSRRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHJ1	Cysteinyl-tRNA synthetase	0.925	773-789	PKARSKKLKKEWEKQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI82	Uncharacterized protein	0.63	638-641	IKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP2	Uncharacterized protein	0.747	379-393	KKSFASLRGRPKAKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP2	Uncharacterized protein	0.739	48-65	RKPRDESPKKFLTKRKSS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJX6	Uncharacterized protein	0.703	411-416	VRKKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKQ9	Uncharacterized protein	0.964	5-56	KQRRKRALEKSKKHQALEEERKKQRALEEYKKKQALEKCNKLRDGSRDRRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMZ6	TBC1 domain family member 22A	0.678	121-126	RKGRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT41	Uncharacterized protein	0.948	377-430	EEKAEERKLAADKLKKEQRDAKLGRLSAEEQRKFLEKEREKNARKGMKRSTVKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT41	Uncharacterized protein	0.612	372-374	RKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTT3	Flap endonuclease 1	0.994	361-395	TLKRKADEKLEEKKKKQKVDAKAKKQAKAKPRTAG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW39	SRP40_C domain-containing protein	0.938	93-106	KPKKSKKASPKKAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW39	SRP40_C domain-containing protein	0.937	140-152	KVKKEAKKPKKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW39	SRP40_C domain-containing protein	0.842	228-237	KKDKKTKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW39	SRP40_C domain-containing protein	0.762	410-422	KGFTKEKNKGKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW39	SRP40_C domain-containing protein	0.63	280-283	AKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWB1	Uncharacterized protein	0.995	260-283	TKVKTEKARRKDGRKAAKGKRKTA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT1	18S rRNA aminocarboxypropyltransferase	0.935	5-28	KKDFKGNNKFRNPAKARAPPRPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z2	Uncharacterized protein	0.994	14-77	RLAQKKRAEREAARERRMKEKAEKEAERARKKADHDSKKTIQQSKNGKRKASTSSSNRNKRQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3W4	Lectin C-type domain containing protein	0.771	619-627	ETRRGRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7R4	Uncharacterized protein	0.895	97-106	HKKKRRQRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC12	Nucleolar protein 14	0.924	759-800	AEAKRLQKDYKRERKGAMRELRKDAHFIARESLREKKEKDRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC12	Nucleolar protein 14	0.918	820-834	RNGYEREKKARKAGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDE3	Multidrug resistance protein fnx1	0.948	585-605	KAKRLEREAERNERRKKRASK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDL9	F-box domain-containing protein	0.818	1175-1189	GPPRRSGPQRRRDRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDU9	Uncharacterized protein	0.999	73-133	KKKLNGTTLRGTKVRIEMAKPEKRKARAEADAAKEQEEAERPSKRAKKDKKEKKEKKRKEQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDU9	Uncharacterized protein	0.999	145-187	RKVKRGWTEPAAKHKKERKEKKDKKEKSDKDAKKERKHSKYTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDU9	Uncharacterized protein	0.986	207-224	HKDKKKDKKEKKEKNKSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDU9	Uncharacterized protein	0.971	555-581	RAWKKRRRDALKAKRHTENRKMTGGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDU9	Uncharacterized protein	0.942	317-327	TKDEKKKKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFI4	Uncharacterized protein	0.67	231-236	PAGKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ71	Uncharacterized protein	0.666	165-171	KKSKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJQ0	Cytochrome P450 3A10	0.972	980-996	LEGRKRKAKEAWKRGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJQ0	Cytochrome P450 3A10	0.844	713-742	APRGRNPAGGSARGRSSKSATPRSKAAQSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJQ0	Cytochrome P450 3A10	0.642	185-191	KGLRKLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK98	Uncharacterized protein	0.99	48-73	REAEERRKAAKKKREEKEAKEAAARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK98	Uncharacterized protein	0.879	104-115	KKRKEEEKRKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPE6	Uncharacterized protein	0.741	310-323	PPSPRGARPRSPGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUJ6	Uncharacterized protein	0.991	787-808	QKKKKMERARERRKRWKQTRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUJ6	Uncharacterized protein	0.879	5-28	RGGRGGDRRRGGHGGAHSNRGRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY28	CCHC-type domain-containing protein	0.914	126-150	KPRTKPRTRSPNDRNPARKARSGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY42	Tryptophanyl-tRNA synthetase	0.936	467-493	NAQKKAAKMAEVERKKKEKEAAAAAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYI3	Uncharacterized protein	0.807	595-633	RIRGRSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1Y7	Uncharacterized protein	0.999	140-199	RETKRKEAEARKSDKDLAFEERKKDLKKKRKRHSEPAAGKSDEGEKIKEKDRKFKQRKRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1Y7	Uncharacterized protein	0.995	5-72	KPAAKGKSPKGKSGPKSAGAKSKSKPKTTGSAPEGISKRKQKSMSLAKPGGAQKTKSILSKDGRKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1Y7	Uncharacterized protein	0.791	93-103	AKPKGVKKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W234	DNA-directed RNA polymerase subunit beta	0.823	5-18	KPKPKPAPRGAAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W595	Helicase swr1	0.945	1657-1676	RQKRNRKGQDPHVRHRKKKY
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W595	Helicase swr1	0.624	259-262	LRKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W743	N-acetyltransferase domain-containing protein	0.661	76-81	KSKKSP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W852	Magnesium and cobalt transport protein CorA	0.977	247-270	SRSHSRHLEKKKAKKPSLFKRAKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W944	Uncharacterized protein	0.951	343-408	RRSTRSRRTTHSESKHKSHRTKSEKTSKTTKTSESKRPSSKAPSVAPSKASSRSGKESSRKKEKEP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBL7	Uncharacterized protein	0.659	511-518	RLRRRTAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFD9	Uncharacterized protein	0.618	222-225	KKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI90	Thymocyte nuclear protein 1	0.86	33-46	KRNAKRTTRRKRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI90	Thymocyte nuclear protein 1	0.829	66-79	KKAATSKAKKSRAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ08	Nucleolar protein 16	0.958	7-26	KKKNKSSIPKKRQNGPSKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK70	Pre-mRNA-splicing factor 18	0.97	51-114	KARKERLEKKRKAEEDEAEREAERREKRVRMAEESRRIREEEEEAEERRRRKRLGLPDLPPKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM11	Queuine tRNA-ribosyltransferase accessory subunit 2	0.645	411-415	KREKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUB7	Uncharacterized protein	0.981	693-720	EREKDRRRRKDERSRSRGPEERSRASPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUB7	Uncharacterized protein	0.918	549-580	RERERRKAQDERDRQDRPDERRERKPEGRRNS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0L4	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16	0.858	59-68	KMSGKKKKRL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0L4	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16	0.665	231-234	KRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0L4	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16	0.658	9-17	RKHKVLARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4R5	Uncharacterized protein	0.978	223-243	KMKLMLRRKNTNAKKKEKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Y1	Uncharacterized protein	0.997	424-449	KKWKTAEKKIKSKPKEKKQRSKKAQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8G2	Vacuolar protein sorting-associated protein 51 homolog	0.686	204-208	KKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAQ6	MYB DNA-binding domain containing protein	0.822	304-316	KPRQPKAKGKEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAQ6	MYB DNA-binding domain containing protein	0.73	124-133	PPKRTAKRPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAQ6	MYB DNA-binding domain containing protein	0.602	246-246	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBH2	Uncharacterized protein	0.999	158-260	EEDSSRKKRRRSRSPHDRTHRREEKDKEQGRRSRKREHEERKDRRHRHRSYSRTRSRSRSLTQRSDRHDRRRKHRNPSPSPRGDSKSTRRERDSHKYSSSSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBH2	Uncharacterized protein	0.971	110-156	RRNHRDDGDRHGKRAREEERESSRDALTRRHRDRSRDRQRRKRSYDS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHH8	Uncharacterized protein	0.849	50-58	RRPKRAKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJV1	Ankyrin repeat domain containing protein	0.777	271-281	SPHRAPHKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKH9	ATP-dependent RNA helicase DBP6	0.975	48-58	KPSKKPKKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKH9	ATP-dependent RNA helicase DBP6	0.799	597-608	DRIKRGSKKVKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU83	Zn(2)-C6 fungal-type domain-containing protein	0.914	98-124	RIRRARGRPRIHPPRSPTTLAKQAKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWK2	DNA repair protein Rhp41	0.948	611-623	PLKRAKPKKGRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWK2	DNA repair protein Rhp41	0.783	64-71	RPAKKRKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWK2	DNA repair protein Rhp41	0.761	177-186	KRKVRRRAIT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWK2	DNA repair protein Rhp41	0.62	190-191	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX57	tRNA pseudouridine synthase B	0.862	305-344	KRKLAQDKEDRPKQRFRGGWVAETKKERIRQQGGKFKGKW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W168	Integrase catalytic domain-containing protein	0.967	1147-1163	PRKRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3G7	Uncharacterized protein	0.998	1353-1367	KSASKKKKNKKKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W828	rRNA processing protein Ebp2	0.991	407-432	SSRKMKGKPTGGASKRPGKARRAKTH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W828	rRNA processing protein Ebp2	0.955	19-38	KLEKQRKHEKEVQKRKEKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W828	rRNA processing protein Ebp2	0.916	362-394	RRGRGSDGKAFNAKRQKKDQKYGFGGKKRFGKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W828	rRNA processing protein Ebp2	0.901	68-84	GKAKKSKSGKKEEVKSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W828	rRNA processing protein Ebp2	0.884	288-334	AGKKAAAEARKQRDLKKFGKQVQVAKLQERAKEKRETIEKISTLKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W978	Transcription activator of gluconeogenesis PTRG_06536	0.965	44-62	NGKPNAKDPLRPRRKKARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9J2	ThrE domain-containing protein	0.771	857-868	KLRKAYRRKSPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9J2	ThrE domain-containing protein	0.713	476-481	KKNKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9U7	Uncharacterized protein	0.916	125-140	KVNHKKLKVMKKKNKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9U7	Uncharacterized protein	0.867	398-406	AKKRGKPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB8	Uncharacterized protein	0.978	152-196	SQHHRRRHPNQASQSTLRGRGAKRDPARHSKSKKNIRPEPSRGWS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB8	Uncharacterized protein	0.963	30-100	KKTPKTSPSSEKKRRDRPSDGALRGEGRAVAEEISEKRSSKDSSKKRRSADSTPRSPRSQHHKREREEHRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB8	Uncharacterized protein	0.604	203-204	PK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCW0	Uncharacterized protein	0.891	704-727	KDHSEKKPRDKSRTRTIFGRKKSS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEA8	WD domain containing protein	0.997	138-155	EHKKKDKKEKKRKDKAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEA8	WD domain containing protein	0.929	9-26	KRKREEAAAQKKAKKQRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI57	CCHC-type domain-containing protein	0.914	569-593	KPRTKPRTRSPNDRNPARKARSGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI57	CCHC-type domain-containing protein	0.739	341-357	PRPRGDSHSRSRSRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ24	EH domain-containing protein	0.98	543-573	KYKKKGTRIMGIKGRKHPNKHHEGTRRRWRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ24	EH domain-containing protein	0.724	376-390	SKPSLPPPRRAASRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLA3	RNA-binding protein 8A	0.858	120-145	KGRSRDHDRRQSGRGAGRARSRSPGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNX4	Ubiquitin carboxyl-terminal hydrolase	0.684	73-80	RTRKRVKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD1	PHD-type domain-containing protein	0.868	503-521	AKKAKNAAHARAAKKTKAN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD1	PHD-type domain-containing protein	0.663	201-208	KKKVKVSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT63	Uncharacterized protein	0.88	389-406	IAKRKAEREKQEKEKARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUI5	Cut12 domain-containing protein	0.892	674-691	RRELAKLRLANKKKERKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXM2	Hepatocellular carcinoma-associated antigen 66	0.819	71-82	RRKRIKRLGARY
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXZ9	Transcriptional activator spt7	0.953	1044-1078	KQRFPKPRLPPTGKISSPRKRPIREQQQMARKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXZ9	Transcriptional activator spt7	0.854	471-489	RGRKAPSKGGKGSSNARKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ36	DNA topoisomerase 2	0.997	21-67	AKPAKAAKVAKPKAAAPKKAAGTAKPRGRPAGATAKPKAKAAPKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ36	DNA topoisomerase 2	0.991	1289-1320	KRKKKIAGITRRASQKLGIAAGKSSKGKKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ36	DNA topoisomerase 2	0.991	1576-1637	KPAASKLTAKPAAKSKTAAAKPVPKAKALAKKPAAQSPAAKAYAKKHGKDAESAKPVPKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ36	DNA topoisomerase 2	0.919	1674-1696	KPAARKPAAGAARPGRRAAAAKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ36	DNA topoisomerase 2	0.884	98-112	PKAKKAPGPKKSSGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ36	DNA topoisomerase 2	0.861	1410-1427	KPAPAKRGRPAASKPVKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ36	DNA topoisomerase 2	0.854	1337-1344	KKKAKPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W150	Aurora kinase	0.949	38-64	KAKLRSYSRSKVTKARAKGKAVKKQER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W334	Two-component sensor protein histidine protein kinase	0.721	523-531	SKPVKSRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W334	Two-component sensor protein histidine protein kinase	0.601	358-358	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3V6	Uncharacterized protein	0.805	378-402	KLVNAKRAGARARDEHGRLMKGKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3W2	Trichome differentiation protein GL1	0.642	105-108	RRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W618	Base excision DNA repair protein	0.968	99-116	RKGKTPAKKSKKPAEPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W618	Base excision DNA repair protein	0.909	466-480	PVKGGSAKKTKGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W618	Base excision DNA repair protein	0.87	37-71	RGNARKRKAVKVEDSPKASTSKAPVTPKSTKRAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAV1	Phosphatidylinositol-4-phosphate 5-kinase fab1 (PtdIns(4)P-5-kinase)	0.77	529-546	RSLGGRPRSSSHKRHPSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAV1	Phosphatidylinositol-4-phosphate 5-kinase fab1 (PtdIns(4)P-5-kinase)	0.671	505-508	KKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF97	Uncharacterized protein	0.652	45-48	RRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNF6	XAP5 domain containing protein	0.859	131-141	FKKKRKVAAKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQR2	Retinol dehydrogenase 13	0.96	315-349	GAKRRAFEKKQKEKAGGKTAAPEKATTNGQPKERK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRH7	60S ribosomal protein L4-A	0.993	183-207	KARNTRKLRAGKGKLRGRRHKQRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRV5	ATP-dependent DNA helicase II subunit 2	0.961	570-589	KKVPPKVKGRGKRQRAERDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS32	Enhancer of polycomb-like protein	0.683	473-490	RRIGRGGRMMIDRRGVKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS49	Calcium/calmodulin-dependent protein kinase kinase 2	0.698	44-61	RLRKRAQSNLLRRPTAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSN6	Mitotic spindle checkpoint component mad3	0.942	373-393	KAKAAKRARREERANRTRKIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSN6	Mitotic spindle checkpoint component mad3	0.761	416-423	KPKIRRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM2	Cell cycle control protein cwf19	0.999	13-88	SKKKEDKKKRDRSRSRDRHSRKHRSSRHHDDDERDERHRHKRSRHHRETSEERARRKRKEREDKDDRSRRKHKEPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM2	Cell cycle control protein cwf19	0.62	98-100	RKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTS5	Aureobasidin resistance protein Aur1	0.763	37-49	RVRRKWRATKSRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYR1	Uncharacterized protein	0.967	586-603	QKMPKKAPATRKSRKRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYR1	Uncharacterized protein	0.964	818-830	KGKTKVKAKGRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYR1	Uncharacterized protein	0.769	429-439	RKRSMRARKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYY5	Uncharacterized protein	0.868	266-308	HARKMIRAEKRWINNRGSKVPPEEEARRKAAFADRRKEIYEAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W067	Uncharacterized protein	0.723	121-131	PSKPRRAAQRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6B9	Uncharacterized protein	0.819	468-481	RKKMKKLFKVKQRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6B9	Uncharacterized protein	0.718	621-634	RARKLRDLQRIKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6S4	H/ACA ribonucleoprotein complex subunit 2	0.998	8-41	KRLKKDKKEKKEKKRAETEGVSKNKKDKKDKKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6S4	H/ACA ribonucleoprotein complex subunit 2	0.898	91-119	KKILKTVKKSAKSKTLRRGVKEVVKALRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB82	Uncharacterized protein	0.752	195-227	AGARGVKSKTGAGVREKMPALKVGERIKRQTTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB82	Uncharacterized protein	0.692	133-143	RERQREKGRWK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLI6	Uncharacterized protein	0.933	38-50	GKARRKPKTKRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ80	Integrase catalytic domain-containing protein	0.637	608-613	KSRRPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRT3	Uncharacterized protein	0.844	385-395	DRRRGRRRMAW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRT3	Uncharacterized protein	0.668	771-782	KKKDTPARKSLS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRV7	ANK_REP_REGION domain-containing protein	0.995	579-651	RSPRRVKKEAPSASSQRIKRKSPPRRERSSSPRTEPKRAHHAKSTTATTAPQKSRRLMSGKEKATREGQRRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRV7	ANK_REP_REGION domain-containing protein	0.672	750-759	KAVKNKIKYK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRV7	ANK_REP_REGION domain-containing protein	0.642	764-768	KLRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSE7	Uncharacterized protein	0.996	155-192	KGLKKRAEKRAGLAIEEKHSDGKKTNNGKRRKARKKPH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSE7	Uncharacterized protein	0.729	67-77	RKKRQIIKRHL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSI6	tRNA(Ile)-2-lysyl-cytidine synthase	0.881	546-565	DKKKRDRKLDKLEALARAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUI4	Peptidyl-tRNA hydrolase 2	0.869	104-114	RKEKRKQKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUI4	Peptidyl-tRNA hydrolase 2	0.868	52-67	KKTRKQLRKQKAKDKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUX8	Uncharacterized protein	0.891	160-175	KSHERKAKKHSHRHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVP4	DUF2431 domain-containing protein	0.963	4-32	TKTKRARRELKREGDRKIMAHHRKIAKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVP4	DUF2431 domain-containing protein	0.896	342-351	DRRARMRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY94	Transcription initiation factor IIE subunit beta	0.959	233-245	SGKKKKGPRRGGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z1	JmjC domain-containing protein	0.978	792-803	NRRKKTKGKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z1	JmjC domain-containing protein	0.972	1209-1240	RPLGRPPGRSSMVPTRGSSTGKRGRGRPRKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z1	JmjC domain-containing protein	0.713	1011-1020	REKERRKTMP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z1	JmjC domain-containing protein	0.682	941-948	AKPGRPRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z1	JmjC domain-containing protein	0.608	1024-1025	KA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W236	Splicing factor 3b	0.889	7-24	KGKKQANKNAYRRAKKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W236	Splicing factor 3b	0.786	559-567	RKRAKREGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Y6	Phosphoprotein phosphatase	0.817	203-217	KRVPAPQKKKSKSAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Y6	Phosphoprotein phosphatase	0.652	260-266	KKPGAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Y6	Phosphoprotein phosphatase	0.627	518-521	NKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4C6	Uncharacterized protein	0.687	79-90	PRTKDIKRLHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W580	Nucleolar complex protein 2	0.972	11-44	QKDKLGDVIKRRKDVAKIKQRKQMDTKKKERKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W580	Nucleolar complex protein 2	0.954	90-102	KKKTKPKTGKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W580	Nucleolar complex protein 2	0.792	695-727	RKSRAAKAKMLDEARKMEDRKREEAEAEKRGGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W2	Integrase catalytic domain-containing protein	0.958	1080-1096	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W2	Integrase catalytic domain-containing protein	0.658	464-471	RGFKPRWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W2	Integrase catalytic domain-containing protein	0.639	439-451	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7E5	CAIB/BAIF family protein	0.711	350-355	HPRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7L6	Uncharacterized protein	0.764	107-129	RGDRGGRGGSRGGGVLGKRTRDG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9R1	Abhydrolase_3 domain-containing protein	0.827	244-253	KLKKKRAPKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAV0	Uncharacterized protein	0.91	306-315	AHRKKRRKEA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAV0	Uncharacterized protein	0.875	698-719	AIKRKLANSPDKSGRKQSKRRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLZ5	F-box domain containing protein	0.774	6-15	RFRRHKSPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPF2	Uncharacterized protein	0.99	13-110	SKKKATPQKASSSGSGKAKNRPEQDKKKAEPQKESSKSSKKGATPPGSNKKANPQNPSSGSSKKGKTPPASNKKKANPQNASSTSSKKSRSPKNLARW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQQ5	60S ribosomal protein L35	0.611	89-90	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR80	RING finger domain containing protein	0.677	70-77	PKKGLRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRN9	Uncharacterized protein	0.7	364-369	RHKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSX1	Uncharacterized protein	0.739	169-182	RRLLGHRKDSAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ32	Uncharacterized protein	0.828	175-182	KKKKRRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZH8	HMG box domain-containing protein	0.792	302-312	AKRKYRRHPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1N6	Methionine aminopeptidase 2-2	1	58-79	AAKKKKKRKPRKKKKAGAAGAG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3W7	Uncharacterized protein	0.985	144-189	KKNVPRPRGRPRTLYTEKVPSPRGGQIARVQKDHRGRPKGRKNRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3W7	Uncharacterized protein	0.869	213-228	RKRLGRPPGSKNKPKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3W7	Uncharacterized protein	0.624	74-76	KKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9G0	Non-specific serine/threonine protein kinase	0.87	839-852	RKARAEERRKKGGL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9G0	Non-specific serine/threonine protein kinase	0.668	207-217	KKRLSGGAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9G9	DNA-binding protein RAP1	0.819	203-217	APREAPKKKQPASKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9G9	DNA-binding protein RAP1	0.603	492-493	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE82	Uncharacterized protein	0.908	79-100	GKKRKRISPGSSSKLAKTPRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEQ7	Uncharacterized protein	0.902	422-436	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFA0	Uncharacterized protein	0.682	475-480	RPAKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFA0	Uncharacterized protein	0.627	611-613	KKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIT6	Uncharacterized protein	0.795	58-71	RFRSSRRGRANRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKL6	CCHC-type domain-containing protein	0.914	569-593	KPRTKPRTRSPNDRNPARKARSGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKL6	CCHC-type domain-containing protein	0.73	341-357	PRPRGDSHSRSRSRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMJ2	RanBD1 domain-containing protein	0.878	114-132	HSEKKPPGPHMRKRSRDIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMJ2	RanBD1 domain-containing protein	0.714	95-101	RLRRKRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV78	Ribosome production factor 1	0.98	12-51	LKPKNKLRRQAAFLSIKKAREADKRDARLRRKREEEKNPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVB2	ATP-dependent RNA helicase MSS116, mitochondrial	0.817	5-15	PKRKWPRGRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVX0	Histone H3	0.981	4-49	KSPARRNKARPSRGGRVSVGSRKESGKRLGQPGPAPDRAKKRYKPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW36	Uncharacterized protein	0.747	26-37	SKGPAKVHRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWA5	Uncharacterized protein	0.707	64-74	RARAKSRSPGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL1	Chromodomain-helicase-DNA-binding protein 4	0.965	279-298	GRKRKRRTTRTAKPEKVPRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL1	Chromodomain-helicase-DNA-binding protein 4	0.953	224-236	SRRRRKRKGAQEP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL1	Chromodomain-helicase-DNA-binding protein 4	0.919	182-198	RRRPGPQRTMKRRRGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWL1	Chromodomain-helicase-DNA-binding protein 4	0.906	1349-1359	PGKKNKKRKVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1D0	Uncharacterized protein	0.944	884-896	GEKKKKKRVGSGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9A7	Uncharacterized protein	0.759	7-12	RRKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB72	WD domain containing protein	0.997	395-411	KQKRKKRKRNKGKQAKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF65	Peroxisomal membrane protein PEX31	0.769	5-13	PRRKRHSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF65	Peroxisomal membrane protein PEX31	0.731	527-536	KRNWFKRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGA6	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16	0.917	146-158	KAPGKPKARSRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGA6	Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16	0.887	171-195	RSKRYRRRNASGSRSRSRSTSPRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHW6	Protein kinase domain-containing protein	0.823	404-410	RKRRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJD2	Mitochondrial DNA polymerase catalytic subunit	0.93	841-861	KGKKKDDPPRPAARQKKPGMP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJD2	Mitochondrial DNA polymerase catalytic subunit	0.734	1441-1451	LRAPPKPKTKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM59	Uncharacterized protein	0.636	475-480	HRGGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR32	Uncharacterized protein	0.691	416-420	KRRKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD0	Curved DNA-binding protein	0.998	381-397	STKKNKKKKKKPAKKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVC2	BAR domain containing protein	0.977	408-432	GKKAPPPPPPSRAKKPPPPPPPMKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVR1	Uncharacterized protein	0.746	263-269	RKKPRKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ49	Formyltetrahydrofolate synthetase	0.682	199-204	AKKGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W486	Uncharacterized protein	0.844	72-93	SFKRRKMAVIRERARPLLRKGL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8W6	Sister chromatid cohesion protein Eso1	0.781	623-641	SSPPRPQKRRPVFSIFKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W934	mRNA cap guanine-N7 methyltransferase	0.984	9-50	KRTRSPSRSPSRSPPRQRKRPGAGARVSAADREAARKRQQAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAJ3	Uncharacterized protein	0.999	132-154	PRRRPPPPKKKNKRGGPGRGRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFA6	Uncharacterized protein	0.901	207-217	AAKKSKKSKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFA6	Uncharacterized protein	0.641	633-636	RRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJC1	Uncharacterized protein	0.625	138-143	KRSQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM8	Uncharacterized protein	0.993	268-316	SRSRSRARGRDDSRSRSRSRSRARSRSRSIFGRSRSRGRSRSASEDGGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM8	Uncharacterized protein	0.993	524-540	SRRRKRRKLRERREKEA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM8	Uncharacterized protein	0.852	175-191	YGSRSRSRSRGGRKSEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM8	Uncharacterized protein	0.783	339-351	VRSKSRSRRERSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV66	Uncharacterized protein	0.958	206-222	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXC2	Uncharacterized protein	0.86	80-93	KPGRLKGKARKEAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYW8	Uncharacterized protein	0.961	46-69	PKGKRSSQRPAPKSSRATKKAKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYW8	Uncharacterized protein	0.838	132-151	GRITKPKSKATRSIRRSQKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1D4	Uncharacterized protein	0.65	1118-1123	RGVRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3C1	Zn(2)-C6 fungal-type domain-containing protein	0.764	615-624	AKSKPNKRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3T4	GPI inositol-deacylase	0.796	1104-1109	KRKKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAX7	WD_REPEATS_REGION domain-containing protein	0.603	757-757	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCU6	MutS protein homolog 3	0.894	65-78	KKSKKKTMKGSKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCV1	LEA domain containing protein	0.819	1844-1850	KKKKKGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE03	Uncharacterized protein	0.855	115-127	KNRKKRLAARKTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFD5	Uncharacterized protein	0.952	73-88	PRKKKKKIQQVKRELE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI56	Integrase catalytic domain-containing protein	0.902	1159-1173	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WME8	ECM11 domain-containing protein	0.851	532-545	RSPRPSKSPRAKRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUN1	Uncharacterized protein	0.732	309-321	KPREKRTVQKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVD9	Ribosomal protein L19	0.96	1093-1121	RARARELTAARRIGRHRGFGKRKGTKDAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVD9	Ribosomal protein L19	0.956	1168-1209	KRALVEHIHKAKAEKARERIIKEEMDAKRAKTKAARERRQER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW10	Uncharacterized protein	0.8	73-79	GRKRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ52	Integrase catalytic domain-containing protein	0.953	928-943	PRRRGRPPGSKNRRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ52	Integrase catalytic domain-containing protein	0.807	282-320	RIRGRSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6N0	Uncharacterized protein	0.685	89-104	IRRRNMSSKGGNGGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W872	Replication factor C subunit 1	0.995	1045-1062	KQPKKKAAPKKGGKKKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W872	Replication factor C subunit 1	0.995	1080-1096	KPKGKGKAKAAPKGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W872	Replication factor C subunit 1	0.993	251-291	KKTTASKKRKSPESEDEEEKPKKSRAKATPAKSPAKKKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W872	Replication factor C subunit 1	0.973	59-75	PKKASPKKPPPKKVKRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W872	Replication factor C subunit 1	0.962	94-128	KNKPKRTEPVKKKAAETLKATPKKAPAKATAKTSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W872	Replication factor C subunit 1	0.949	25-41	KKNEPTPKKAAPKKKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA60	Uncharacterized protein	0.71	356-363	DRPRKARM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBT0	Structural maintenance of chromosomes protein	0.601	368-368	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC19	PX domain containing protein	0.954	922-941	RKSRARAAEKLRRKAGEPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC33	Key lime pathogenicity protein	0.977	461-481	RRAHFHPRKRGRKGKNDEKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD96	KEX1 protease	0.866	767-775	GGRKKRAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD96	KEX1 protease	0.854	84-90	KRRRRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD96	KEX1 protease	0.638	111-116	KPRHWK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDN6	Cytoplasmic dynein 1 intermediate chain 2	0.737	183-193	PKSKRLSRRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEL8	Uncharacterized protein	0.979	201-223	KGLTHALKKAPGSSKKKRKHAEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFD8	Uncharacterized protein	0.993	529-544	KKKAKKAREAKRKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFD8	Uncharacterized protein	0.753	134-146	KRERKDAKRLARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVM0	BZIP domain-containing protein	0.751	76-91	RKRNQAASARFRQKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4X9	Uncharacterized protein	0.692	213-222	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P9	Ribosomal RNA-processing protein 12	0.993	1205-1282	KAKSGSGMGRGALKNGRGGQKPQRRALGQEKSRGGNVSGGEGRGGAKGRVEKTKSPRGRGGHGGFRGRGMGGKWSGPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P9	Ribosomal RNA-processing protein 12	0.878	998-1009	RKTREQRKKKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P9	Ribosomal RNA-processing protein 12	0.719	205-213	KSRKNKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6H1	Uncharacterized protein	0.856	136-152	KRFPVDAKRQLKKAKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9P0	Uncharacterized protein	0.725	8-14	PRERRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAP2	Aspartate--tRNA ligase	0.973	18-47	KNALKKAQKEKEKAEKKAAAKARELAERTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEN9	Ribonuclease H2 subunit B	0.993	373-408	REEKKRKKEEEEKRKKSEGRGVKQLKKVDTSGMKKM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEN9	Ribonuclease H2 subunit B	0.603	413-414	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES6	Usp domain-containing protein	0.707	68-75	PRPRERRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFN1	Uncharacterized protein	0.992	24-47	RARRKQEKKEKKEMRRLKKEARET
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFN1	Uncharacterized protein	0.95	72-103	PVKKGRYGPRGPYKKREKGPDGTPVSSMKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGL7	Uncharacterized protein	0.989	134-151	EPPRSRGPKRRRIRGRRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGL7	Uncharacterized protein	0.69	119-125	KGKRKVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD3	YL1_C domain-containing protein	0.976	115-169	LRKAERHERNKKRKAATNPFTARAAVAARKKVKLNVPRTQSPTHAPPRPKKKSER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD3	YL1_C domain-containing protein	0.739	217-227	AEARKMKAKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD3	YL1_C domain-containing protein	0.645	201-207	KEKDRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM17	Uncharacterized protein	0.614	128-129	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPX1	X-Pro dipeptidyl-peptidase protein	0.888	70-85	KKRPKLNRIRARARLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU92	Fungal_trans domain-containing protein	0.899	31-42	RRKRKAREYKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUM3	Lysosomal acid lipase/cholesteryl ester hydrolase	0.767	547-558	RKHRRNVLRKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWE1	Uncharacterized protein	0.952	125-143	VKKRQRKAAAPKNNRRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWE1	Uncharacterized protein	0.943	893-907	RGNGKGKGKARGRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWE1	Uncharacterized protein	0.8	95-101	KTRKRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWE1	Uncharacterized protein	0.68	850-857	KVKKGTRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZG2	Mitochondrial inner membrane protein Mdm31	0.71	172-184	SRALRKSRSSDRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1E6	Uncharacterized protein	0.635	38-40	KKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4D2	Uncharacterized protein	0.909	293-307	NAQKAPAQRRPKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4D2	Uncharacterized protein	0.694	689-697	AKKNKDKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6I1	PAPA-1 domain-containing protein	0.872	325-339	INRLLKKQPPKRGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6I1	PAPA-1 domain-containing protein	0.828	301-321	RRAEMARRRKNLSEKRNEEEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9X3	Uncharacterized protein	0.929	95-120	KFKKSRSIAKGRIWKQRHAESKRKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBF7	Uncharacterized protein	0.822	118-137	KDKAKYQAKGKETKAPRGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBF7	Uncharacterized protein	0.703	13-26	QKEVEKKEKHAVSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBF7	Uncharacterized protein	0.614	9-11	RKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL07	Uncharacterized protein	0.967	730-745	NGRPKSPKKIKPKKQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS66	Calponin	0.987	440-470	RLQEKKVRSRSKSRTRERSKSRARPAPPPRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSP0	Uncharacterized protein	0.869	276-290	PFKKRQDKGKEKGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUN5	Uncharacterized protein	0.982	81-102	RGRADKGKNKNKRMTKRKRSPS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWQ0	Rif1_N domain-containing protein	0.907	1475-1490	SSKKRKQTPSKKKTPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWQ0	Rif1_N domain-containing protein	0.727	1112-1137	RAFKSPRVKESPFRISKSLRSKSRSP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWQ0	Rif1_N domain-containing protein	0.611	1547-1548	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT6	Uncharacterized protein	0.9	271-290	LREMRDARAKRSERRRGGVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT8	Uncharacterized protein	0.944	208-226	RKRKATKQKTGKKNKAVKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT8	Uncharacterized protein	0.907	72-116	KRQRQRPEKPNAPAPTKKTTVTKKPVATKKTGTKKSVTAKKTHGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0E0	ATP-dependent RNA helicase DOB1	0.856	360-369	KRKGKGKDKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0E0	ATP-dependent RNA helicase DOB1	0.659	20-24	RKNKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W105	Merozoite capping protein-1	0.994	6-30	RKRKEAPPAPVRPAKKKAPAKAKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W656	ANK_REP_REGION domain-containing protein (Fragment)	0.992	579-619	RSPRRVKKEAPSASSQRIKRKSPPRRERSSSPRTEPKRAHH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFG9	Uncharacterized protein	0.63	224-235	NNRERNEPRWGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFZ0	Ribosome biogenesis ATPase RIX7	0.969	122-147	KSEKSKKRDGGKSKEERDSKRQRKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHT6	Uncharacterized protein	0.735	417-427	AKKAKTGRGER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHT6	Uncharacterized protein	0.723	389-403	PRGPRGSPPRPLRSS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIR0	Uncharacterized protein	0.998	346-371	PSKKKEKKKRSEAERKERKEKKRRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIR0	Uncharacterized protein	0.97	285-298	KKPKRKEKKLKERG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIR0	Uncharacterized protein	0.736	79-112	ASPPRPPPAAAVKGGQPAPPKSATPPQKIAPPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ6	Uncharacterized protein	0.635	136-140	KKRVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ6	Uncharacterized protein	0.612	341-342	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT77	50S ribosomal protein L2	0.879	323-372	GGRGKSKGNVHPVSPWGTPAKGGYKTRHKRNKHTFLVQDRPRNQGKRRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT77	50S ribosomal protein L2	0.746	111-121	RHRGGGHKRRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUQ1	Uncharacterized protein	0.761	275-282	PPKRKREP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUQ1	Uncharacterized protein	0.701	287-292	QPKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWJ2	Uncharacterized protein	0.824	260-271	VKKRGRPRSTNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWJ2	Uncharacterized protein	0.761	149-157	PRKRKHNIP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWJ2	Uncharacterized protein	0.643	278-283	PPRRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYD9	Plus3 domain-containing protein	0.849	131-172	RKSSRPKVQPRKNEKLEAYKREREQRGQQRQQNDDRRGRRRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYD9	Plus3 domain-containing protein	0.819	410-439	RERKLDQKKRAAQQKAEEEARKAKEEADKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYD9	Plus3 domain-containing protein	0.603	474-474	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYD9	Plus3 domain-containing protein	0.601	471-471	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYX1	OTU domain-containing protein 6B	0.955	120-134	RKKKPNRAKARLARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYX1	OTU domain-containing protein 6B	0.719	34-43	KKKQASKKTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZV6	Ino eighty subunit 1	0.833	670-690	RRLDRWEGGKSAPRGRPKGER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0G7	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.891	545-566	RRERGRERSRSRSKSPSTIAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0G7	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.798	381-387	KKPRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W252	Uncharacterized protein	0.667	308-313	PKRARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Z8	U3 small nucleolar RNA-associated protein 11	0.936	208-237	QARREARKFRKDRERGQERLVTRLRAIKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Z8	U3 small nucleolar RNA-associated protein 11	0.926	13-54	HKERAQPIEREKWGLLEKRKDYKLRAADHRQKKAKLKILSEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Z8	U3 small nucleolar RNA-associated protein 11	0.751	269-276	FKIRERKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBS0	Uncharacterized protein	0.714	310-324	KRKRNWDPKSAKAAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCE0	G-patch domain-containing protein	0.852	30-47	RAARKRKEGEARAHQKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WET3	Uncharacterized protein	0.884	206-222	KEEREKRRVQKEARKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHF8	Uncharacterized protein	0.83	220-230	RRNRSRRRPRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP44	Uncharacterized protein	0.808	86-93	KRKSRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ74	Telomere-linked helicase 1	0.951	71-98	EAIRKHWRKDHQGWSAGKKRGRPSRTRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRX0	Uncharacterized protein	0.934	40-51	GRRLRKRHRRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXS7	Conidial yellow pigment biosynthesis polyketide synthase	0.86	1565-1603	PASKAVAAKPAPKAIAAAPLKAAPAKAATKPVAKAAKAV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYJ9	Uncharacterized protein	0.995	132-166	KRPRGRPRKSDIAASPNPKPKPKRKGTPVKRTARS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYJ9	Uncharacterized protein	0.902	189-198	PKRRRGRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1D3	Integrase catalytic domain-containing protein	0.967	843-859	PRKRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2L5	Cupin domain containing protein	0.998	368-415	AAAFKKPIKPVGRPKANAEPKSKPASAEPKPKPAPKPAPKPKEKSKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2L5	Cupin domain containing protein	0.947	512-525	RKRSKKSSSKGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2L5	Cupin domain containing protein	0.919	265-297	PRKRGRPPGAKATASASEKTGKKSAPAAAQRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2L5	Cupin domain containing protein	0.867	239-248	EPAKRGRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2L5	Cupin domain containing protein	0.661	334-339	KRRGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W315	Origin recognition complex subunit Orc5	0.876	359-385	KRKNKRRAPSAASFSVTGKRSGTKHRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5D8	Uncharacterized protein	0.846	166-182	EVRNGNRDRKGKDKKVG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5D8	Uncharacterized protein	0.78	151-161	GKRKDKKVSRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B6	DUF2183 domain-containing protein	0.997	1467-1513	AWKASKLSKEYEKKGGGYENEAGSKNEPKKGAPKKKAEGKKKAEEKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B6	DUF2183 domain-containing protein	0.996	1641-1686	KPKADAATKKSESKAGAKSKAKKGETKAKERAEGTRKSSRVAGKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B6	DUF2183 domain-containing protein	0.994	1559-1592	KADAKESSTKEKPKKDTAKKEAPKKKGQGKKTAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B6	DUF2183 domain-containing protein	0.776	1426-1453	NAKPNMPSSKGKPTDPKLREKVKEEVKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B6	DUF2183 domain-containing protein	0.758	1701-1709	AKKTKKTKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B6	DUF2183 domain-containing protein	0.624	1459-1463	GGGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7B6	DUF2183 domain-containing protein	0.603	1457-1457	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7K7	Uncharacterized protein	0.898	27-56	NKKKQDKREAGLQSARSRSSSRRARRQRLE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX1	Uncharacterized protein	0.979	359-387	RKREKERASLKGKLKRVVGKVRKVGGRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX1	Uncharacterized protein	0.812	81-93	KKQEPKVKGKKGD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX1	Uncharacterized protein	0.602	222-222	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGE2	DUF2293 domain-containing protein	0.601	25-26	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH63	Eukaryotic translation initiation factor 5	0.993	144-165	EPKKGKKDKSSKKAERRARKEA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJH1	Uncharacterized protein	0.712	79-84	FKKKRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMP4	Ribosomal RNA-processing protein 8	0.995	84-101	KRGKKRKRGKAGGNKDKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMP4	Ribosomal RNA-processing protein 8	0.985	20-38	PKPKESKPGKKAQKRKEKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMP4	Ribosomal RNA-processing protein 8	0.978	140-153	SKRDKKKRKKESKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMP4	Ribosomal RNA-processing protein 8	0.927	255-277	SKLRPKDQRRDRRGPPKNAVRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMP4	Ribosomal RNA-processing protein 8	0.85	408-441	DKKKGGVPINSIGSLKKNVDKKLLKPTKKQKADK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WND0	Uncharacterized protein	0.827	4-13	RRRAKRRRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTB2	TPR domain containing protein	0.882	6-32	PADRRSDRSAKNGTKKASATKESKKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W187	Folylpolyglutamate synthase	0.969	324-340	RRKKRGEKRKTVIKPPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1X8	HEAT repeat containing protein	0.639	230-233	KKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAF4	Peregrin	0.909	985-999	KKAVARKRQKRSRGW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAF4	Peregrin	0.794	13-34	RSTRPPRRHISDSAPPSKRRKY
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAF4	Peregrin	0.781	212-222	KRRPGRPPRNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAF4	Peregrin	0.631	530-532	RKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBN3	Uncharacterized protein	0.88	723-741	KSSKKSKAEKEAAPKPAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBT3	Separase	0.907	2062-2077	KTPAKPAAKKSKGKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBT3	Separase	0.872	1318-1340	KARAAGARGRKPVVKAAAKAVPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBT3	Separase	0.633	1487-1491	RTKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX3	DUF1989 domain-containing protein	0.962	443-468	KAKKAPKKLGLKGKEEKEQSEEKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX3	DUF1989 domain-containing protein	0.89	519-527	PKAKKKPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC34	Uncharacterized protein	0.62	456-458	RKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA6	Valyl-tRNA synthetase	0.997	53-105	KGVEKKEKSAKELEKERKKAEKDAKFKAKKAAAAGASKDAGSAPAKEKKKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEP3	Uncharacterized protein	0.603	270-270	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIL7	DUF1713 domain-containing protein	0.995	280-308	KRQRKLKMKKHKYKKLMKRTRLLRRKLDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKK9	Oxysterol binding protein 1	0.741	719-725	KRRKQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKS1	Uncharacterized protein	0.979	14-31	KSKPKPKPKHSKASKKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKW1	WD domain containing protein	0.968	1014-1024	KKKKKRSKSRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLZ7	Uncharacterized protein	0.776	236-264	EQERGKRLQKAEPQKLVRQREEGIRKAKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLZ7	Uncharacterized protein	0.688	188-193	RAKRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSP4	HC-toxin synthetase	0.859	6872-6905	KGKMKAEEKANNKKSGAFGNLAKKIGFKKRESLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSS6	NAD-dependent histone deacetylase SIR2	0.959	323-341	KPTRKRKRASNGNGSRKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW94	C2H2-type domain-containing protein	0.836	464-477	GRGEGRRAKGKERV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXI8	White collar 1 protein	0.978	789-798	AKKKRKRRKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYX2	Uncharacterized protein	0.987	119-143	KSRKGAQKISKKETKKRPRNAARRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZE4	Uncharacterized protein	0.998	680-699	KISPPKPKKRKGKKSKPKVN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W203	Uncharacterized protein	0.922	555-571	AKPRKKGSKSRENSKSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2K7	Uncharacterized protein	0.802	8-24	KRKAEKDSSPSKPKKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4F0	Uncharacterized protein	0.999	434-504	RISKRAATRDLKQRRRELKRQHKQKKRELRAVHDRKGKGKARKSREWKEAKKEFKEKKKELKRERMAVRRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4F0	Uncharacterized protein	0.849	633-643	VKRKKRHATIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5B9	Uncharacterized protein	0.948	256-286	RERRKRAEGELKRKFEEDRRRVEGMRGRRGV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5B9	Uncharacterized protein	0.652	126-129	KKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7A7	Uncharacterized protein	0.981	43-60	EPKRQRKAKSKSKSKRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7A7	Uncharacterized protein	0.615	12-13	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7J3	Uncharacterized protein	0.818	151-168	KKRRDMEYARKREDKRKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7J3	Uncharacterized protein	0.81	101-122	RGRGGTSRGKRGVKLPSFTGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U4	AAA domain-containing protein	0.986	216-259	KKVIPKKQIKISKSGKLLSSPPKPAMEPEASLKKRRGRKPTKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U4	AAA domain-containing protein	0.956	50-62	KAGPGRKKRPRKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U4	AAA domain-containing protein	0.908	572-580	QPPKKKRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9U8	Uncharacterized protein	0.997	540-561	NKPKPKKSGKKGGKKAQKRAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9U8	Uncharacterized protein	0.786	98-111	KSKKGKGQAQPKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9U8	Uncharacterized protein	0.778	455-465	SRAQRRREKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE84	Uncharacterized protein	0.861	801-814	RKSRAKGPQRRRPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEH0	Uncharacterized protein	0.699	38-47	ASGFKAPKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEH0	Uncharacterized protein	0.636	28-33	KNQKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN42	SHNi-TPR domain-containing protein	0.946	99-110	KKNKKPKAKKAT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRE9	Dynactin Arp1 p62 subunit RO2	0.659	175-182	RDKERERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX66	Uncharacterized protein	0.692	226-235	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY15	MFS domain-containing protein	0.897	317-334	APKPSKRHNRARSKSPGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY15	MFS domain-containing protein	0.838	96-107	SRSRRPEKKRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYJ8	Flap structure-specific endonuclease	0.9	874-889	PAAWKARERKKRAIIL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYJ8	Flap structure-specific endonuclease	0.71	489-497	KTKPAAKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYJ8	Flap structure-specific endonuclease	0.705	470-476	RKLKPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYJ8	Flap structure-specific endonuclease	0.671	640-646	KKAKTRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYJ8	Flap structure-specific endonuclease	0.63	588-591	RRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYY8	Ribosomal protein L15	0.949	31-75	KVIHRASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRQAPKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYY8	Ribosomal protein L15	0.886	150-190	KPVHKHRESRGLTATGKKSRGLGRGHKFNNTTAGRRKTWKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZQ6	DNAJ domain containing protein	0.966	237-261	RNRRERRAMEKDARKPKKVQAVKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZQ6	DNAJ domain containing protein	0.859	384-394	RKRKAIVRKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZQ6	DNAJ domain containing protein	0.603	90-94	KAGGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.997	565-583	KKKKTKAVAKPKKAKKAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.966	7-26	KSKKRKGASEAAPKAKKARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.895	438-448	PKGKKGKKAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.861	69-78	KPKKGKKSKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.841	500-509	KKTKKDKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.827	468-478	AKKGKKATKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.741	103-111	PKKQGKKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.723	158-166	PKKAKAAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.692	126-133	EKVKKTKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1U9	MKI67 FHA domain interacting nucleolar phosphoprotein	0.602	538-538	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5D4	Uncharacterized protein	0.959	19-43	KKKRRRLHPVRRIARLLLGGSKSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z0	Glutamate decarboxylase	0.666	449-456	LKKEHKHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W624	Zn(2)-C6 fungal-type domain-containing protein	0.74	51-60	KRRRSSKTKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6N4	Uncharacterized protein	0.877	19-38	KKKHKTKSTKPSAEKPLPKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCR5	F-box/WD repeat containing protein pof1	0.989	313-328	RKSLVRKRKRKREKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE13	Uncharacterized protein	0.79	126-139	KRPPRAKGPVKQPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE13	Uncharacterized protein	0.677	22-28	LRKPPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEF2	Homeobox domain-containing protein	0.658	151-155	KRKMK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGC8	Integrase catalytic domain-containing protein	0.967	715-731	PRKRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGC8	Integrase catalytic domain-containing protein	0.767	195-204	RRGSKPRWKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ5	Uncharacterized protein	0.981	312-345	RERRRRRRPRSQGDRAADEALRQPPKISRRKSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ5	Uncharacterized protein	0.964	390-402	PKPRRRRSRRRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ5	Uncharacterized protein	0.95	206-255	HRPTSSGAGSGKGAKTSETAGKPKSPQPPKEKMEIVRMRPSRRRARTSPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ5	Uncharacterized protein	0.87	1297-1307	PKPRRKSTKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ5	Uncharacterized protein	0.858	432-443	KKSPSRRRRRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ5	Uncharacterized protein	0.71	192-203	KQRRPSKPSSSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKZ5	Uncharacterized protein	0.691	518-524	SSRRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY4	Uncharacterized protein	0.876	161-183	RARQKKEEERRLAEKKAREERER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY4	Uncharacterized protein	0.821	35-74	RREAEKKRLAEKKALDDLHREHEREQQARKREAKRQAEER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY4	Uncharacterized protein	0.662	453-460	KTPGPRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPF8	Uncharacterized protein	0.987	686-700	KKGKRRQRGKKKARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPF8	Uncharacterized protein	0.656	419-426	KKHARHPS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYK2	Uncharacterized protein	0.977	212-245	VPKKGKRASTKKRASARSSTASTASRKGTRGRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYK2	Uncharacterized protein	0.776	23-38	KGRRTSSRSKKAGTKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZY1	pH-response regulator protein palF/RIM8	0.925	212-223	SRRARAKPRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0E2	Elongator complex protein 1	0.988	1162-1179	KTSKNKRREERKRARGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1R5	Uncharacterized protein	0.995	976-993	KKKSRQKKKKDKKGVKEG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1R5	Uncharacterized protein	0.644	800-804	KPKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W674	Uncharacterized protein	0.895	1157-1174	NKPQKKAKTSKGAKEARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W1	SH3 domain-containing protein	0.971	414-440	KDDKRKKEKKSGMLSGLFKRKDKKGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W1	SH3 domain-containing protein	0.682	241-248	LKKAMRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX7	DNA-repair protein rad13	0.825	1192-1207	GPSGKKKGTGAAGKRL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX7	DNA-repair protein rad13	0.673	91-98	RKSRREGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX7	DNA-repair protein rad13	0.636	124-127	RRKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDD9	Uncharacterized protein	0.754	348-359	GEKRKSWFKRRF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDD9	Uncharacterized protein	0.752	26-40	GSPKSDKKASKHERK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGF9	SMI1_KNR4 domain-containing protein	0.983	510-552	RKTEEGKAEKRERERRLRENIGQEDEAKGGKRKRKSSNKGEPN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH21	Uncharacterized protein	0.984	54-78	RSKRSREESPSASTNAHKRKRKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHM4	Uncharacterized protein	0.692	213-222	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHV7	DUF2439 domain-containing protein	0.741	288-302	RQPPAKTPRIPKGKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHV7	DUF2439 domain-containing protein	0.724	176-186	ARKEKEKEKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIK8	Integrase catalytic domain-containing protein	0.952	843-858	PRKRGRPPGSKNKRKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJT0	Uncharacterized protein	0.99	118-182	RRRRPQPFQKESEVTRKKREEAEERQKAREEADRERQKKIAERERFRKTMAKARGGPNGKRKLGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJT0	Uncharacterized protein	0.979	8-61	EKGGESSAWKQKKGFKIGPANLPDGTHRRKIEKIKKSLIEKAKIKKQYAKLKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKN9	Chaperone protein dnaK	0.997	905-941	KKMKHFKPPNQQKPKASKPKSKSAKGKKNASKSKKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLF6	Pre-mRNA-splicing factor CWC24	0.842	21-33	FKKRGAKAAPRKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLI0	Telo_bind domain-containing protein	0.83	188-196	KKRRRKSFK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WND2	HLH transcription factor (GlcD gamma)	0.848	317-326	KKRRRRESHN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WND2	HLH transcription factor (GlcD gamma)	0.606	330-331	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNU4	ATP-dependent DNA helicase CHL1	0.953	97-130	LRRKQDLNDRIAKVKAKEKRAKERYENSEPKHKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP23	Uncharacterized protein	0.685	220-231	RKKIKEQRIKWK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPT3	Uncharacterized protein	0.692	213-222	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUH5	Glucan synthase-1	0.614	436-439	KPPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW32	OB-fold nucleic acid binding domain	0.828	220-246	IKKEERRIAREAYDAKRDRKLETRRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW32	OB-fold nucleic acid binding domain	0.632	205-207	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3I1	Signal recognition particle subunit SRP68	0.829	407-429	KPRRQRKDGKEWAEREEPTGRKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7H1	Uncharacterized protein	0.974	83-103	AKRKHEKHQLAKRRMAKRARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7P6	Subunit of DNA polymerase II	0.681	711-716	KTRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7S8	Uncharacterized protein	0.975	85-104	QPRRRGRPPGSKNKRKVSRM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9V4	Uncharacterized protein	0.909	271-280	RKKKRAKRLS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9V4	Uncharacterized protein	0.725	206-215	RPALRGRKRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCD3	Paired amphipathic helix protein Sin3a	0.626	1243-1248	RAKEPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEH7	tRNA (guanine(26)-N(2))-dimethyltransferase	0.858	94-112	RKSKKHEQFKERNARKKQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM16	DNA helicase	0.715	795-803	KLGRSGPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ67	Uncharacterized protein	0.93	469-488	LARKRRLVASRRKLIQRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQA9	Uncharacterized protein (Fragment)	0.992	79-162	KLEEKRVERQRLKEIRELERAEKAAERARKVEAQHQKKATQQAQQRKRKASRAPSSKNKRQKRAMEDRARDRVASPPSPPPPKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQA9	Uncharacterized protein (Fragment)	0.952	10-19	HKKKHKKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQA9	Uncharacterized protein (Fragment)	0.704	39-69	RKIREARAREVVRERDKIEEKLQKAQAKKQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR96	Membrane associated protein Pal1	0.998	136-247	KKRAPPPRPAPARSGTDPRAGHRPSRSEEERRERARESSRGPSRPRGPPSSSDRRDREHRRPRRNSESSIADKGTLDPREERRRRERRREREERSKDGKDGKDSKGKRVRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR96	Membrane associated protein Pal1	0.816	513-524	KSLKGGPRRRPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRF4	Uncharacterized protein	0.981	185-215	AKRVESMHEEARRKWGARRREAREDRGRRRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRI0	Eukaryotic translation initiation factor 2 subunit beta	0.987	70-82	KKKKKKSTKKKEG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRI0	Eukaryotic translation initiation factor 2 subunit beta	0.965	94-105	ALKKKKKSSKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS54	26S protease regulatory subunit 6B	0.985	18-49	KSKKDKKDKPKYEPPPQPTTRIGRKKKKAAGP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSA7	Uncharacterized protein	0.883	1233-1252	RAPVKKEEEKKSRKFWSRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUA6	Mtf2 domain-containing protein	0.654	338-357	KGRDSRGDKNAFRSTGKGRN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUA6	Mtf2 domain-containing protein	0.652	44-55	RAVRTEKIRAPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUA6	Mtf2 domain-containing protein	0.611	325-327	KEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUA6	Mtf2 domain-containing protein	0.606	319-320	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUG3	Uncharacterized protein	0.617	301-304	RLRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWM3	G-patch domain-containing protein	0.973	104-126	EEKKKRKAKTRGETRTTAPRPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWV0	Uncharacterized protein	0.982	563-580	KAAAKESSRREKKRKRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W680	Pre-rRNA-processing protein IPI1	0.989	6-29	KKKKENKKKDFQKPKLKVGKARPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W988	Propionyl-CoA carboxylase beta chain, mitochondrial	0.936	34-43	NKPRRRRKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB64	DNA helicase	0.977	815-836	SPPSKKPEPAKPPRAKPNKPRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDL6	Ribosome production factor 2 homolog	0.797	6-19	KPKNARAKRAMAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDL6	Ribosome production factor 2 homolog	0.614	250-252	KPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLV2	WD_REPEATS_REGION domain-containing protein	0.985	327-352	RAAGEEGSGKKRLKEKKDKEKARFKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN78	RING-type domain-containing protein	0.962	57-83	RRRQATPIPARPPPKIKKPALRRAEAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQA5	Integrase catalytic domain-containing protein	0.902	1159-1173	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR33	Uncharacterized protein	0.998	165-191	AKKKKAAAAKGKKEKAPAKPKAAPKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR33	Uncharacterized protein	0.995	77-117	KQVPTPRAKPAEKKTKAASETTRGVKRKAAAPAKKAKKRAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT01	Uncharacterized protein	0.898	290-304	PRRRRQKAKATGRIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUT4	Cation-transporting ATPase	0.897	1320-1333	KVKFGGKRGQKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUT4	Cation-transporting ATPase	0.758	129-148	GSGKSSHSRKSSSGRKSSER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W161	Uncharacterized protein	0.695	219-224	KRKQRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W864	Uncharacterized protein	0.991	357-377	RERRRGRRGRGRDRDRGRVRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W864	Uncharacterized protein	0.867	218-231	RKVSRAVRRRGKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDB3	Protein arginine methyltransferase NDUFAF7	0.696	38-48	HQRRGKATRLG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDB3	Protein arginine methyltransferase NDUFAF7	0.608	53-54	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN22	Uncharacterized protein	0.762	157-165	RRRRAPRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR59	Zinc finger protein 383	0.866	669-680	GKGKTGRRKSRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSC2	Uncharacterized protein	0.692	109-114	PRRAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSW5	Ribosomal protein	0.747	94-105	NKNKKLIKKLAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUR8	Uncharacterized protein	0.757	41-51	RRRLRWERRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV83	CRIB domain-containing protein	0.871	20-40	NKSLKESASRKSLFRGKKGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZX1	F-box domain-containing protein	0.652	26-33	KTERMKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2B1	Uncharacterized protein	0.998	321-343	TKKVAKPKKPKKGGRKPGLKPAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2B1	Uncharacterized protein	0.912	443-473	RKTYKRKSEPTAPSSARKRGKFGGIVGRPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2S1	Uncharacterized protein	0.637	9-11	RKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W382	Uncharacterized protein	0.679	283-294	PKVAKPSRERGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4H7	DNA repair protein rad5	0.999	790-837	KVKSKAKKPKKKNKDKKGKGRAQPKLSLAQLKKESLRSKAAKKRYMRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBM1	Uncharacterized protein	0.98	227-253	KEKEKQKEKEREKKVKIELPPKPKPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC63	Ribosome biogenesis protein NSA2 homolog	0.989	21-67	DERQRKRIAREGHNASKKAQNFRGLRAKLHAEKRRKEKIQMKQKIRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC63	Ribosome biogenesis protein NSA2 homolog	0.901	139-150	GKKTKKKSWKRM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCK4	Uncharacterized protein	0.864	332-348	EARKTKVVKAGKKGTKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD85	Palmitoyltransferase PFA4	0.679	89-96	GGKGKSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGM0	Uncharacterized protein	0.892	112-133	RGKKSPRWLKSVKRIIKKSAAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGZ2	Uncharacterized protein	0.644	163-168	RKKNSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJN6	Uncharacterized protein	0.985	279-309	KSVKVKKEQRKSRVTKEKVKDKGREKERRAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLG6	Uncharacterized protein	0.966	19-80	KASRFHFKSGSKRRSRRHDSKNKDEGADDELPRKRRIHKDDDEERDHRDSRRKHKHKHRTSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLG6	Uncharacterized protein	0.91	224-240	RRMEESLRRGEKRKKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMC0	Uncharacterized protein	0.847	137-153	KPKPEPRPNPPKSSKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMI3	SET domain-containing protein	0.995	105-134	KQRLRREAHSIGERKGRPKAPAKNPKKRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMI3	SET domain-containing protein	0.79	485-494	PKPRNKKMKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR16	tRNA wybutosine-synthesizing protein 4	0.695	21-27	HPKRRPQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR67	Kinase	0.924	1334-1348	RKAPKKKKTSKDKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR67	Kinase	0.78	946-955	KKREGKPKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR67	Kinase	0.757	213-220	RKPRKRPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWA4	ATP-dependent rRNA helicase spb4	0.844	581-594	ALKELRREKKAARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWN6	Uncharacterized protein	0.883	295-304	RRRRRREHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY00	Uncharacterized protein	0.997	427-455	ARKKAAKAAKLKAKGQVPKKRGRPRKSGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY00	Uncharacterized protein	0.977	133-143	AKKKRKARKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY00	Uncharacterized protein	0.852	401-415	RPKHFKGKGRAWKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY00	Uncharacterized protein	0.79	180-189	KSSTRKAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY00	Uncharacterized protein	0.786	472-480	KRKRPPPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2L8	Uncharacterized protein	0.925	971-980	EKSEKKKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4N8	Uncharacterized protein	0.799	68-91	RKRSRRSNSGEDGGALGKKARGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Q2	G/U mismatch-specific DNA glycosylase	0.938	88-98	PPPKKKRKPSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W550	Uncharacterized protein	0.929	406-453	AKAKKIKDKAAKTVDKSTNGRGKSAFKSTHRGKVKASNTGARKRQAAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6J2	Zn(2)-C6 fungal-type domain-containing protein	0.986	322-337	KKAPKKKASKGKRPAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAT2	zf-ANAPC11 domain-containing protein	0.847	230-241	KIPRKNKGKGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFI9	Ribosome biogenesis regulatory protein	0.965	179-203	SRKERKERIRRNERKQRANDVKSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFI9	Ribosome biogenesis regulatory protein	0.88	102-127	KPIPAAKEPTKWERFAAKKGIKDKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK51	Uncharacterized protein	0.967	308-326	RPNKKNRKKKAAASAAAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVF9	RNP domain containing protein	0.615	242-245	KQGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXG0	Uncharacterized protein	0.793	55-70	RQLKKTAPPRKQPAKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ67	Uncharacterized protein	0.641	252-258	RKSKLAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3M8	Ribosomal L1 domain containing 1	0.964	356-378	REAKRNKKTEKKSSISKEKRKAM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBA2	RING-9 protein	0.791	533-542	RIRRRRWRAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE65	DNA repair and recombination protein RAD26	0.997	319-334	RKRKPKGKKTKKAKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE65	DNA repair and recombination protein RAD26	0.904	248-256	KPRPRKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE65	DNA repair and recombination protein RAD26	0.836	364-375	KNRAAARKKAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEN8	zf-primase domain-containing protein	0.771	34-46	RKKYERRRERNSI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEN8	zf-primase domain-containing protein	0.645	206-215	NKEKVREEKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGW7	Uncharacterized protein	0.99	310-340	RDKRRREKKAKADQERLRRRLERRAEKQNAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGW7	Uncharacterized protein	0.789	153-161	RRKSSKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGW7	Uncharacterized protein	0.649	7-10	RRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP7	Dual-specificity kinase	0.769	366-373	SKGRRRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN61	Uncharacterized protein	0.772	5-17	RVRPKRRHCSKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPB4	Uncharacterized protein	0.859	148-166	KRKVSHKAAKNLTKRRRVA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPB4	Uncharacterized protein	0.684	110-118	RERERKQRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPW3	HTH CENPB-type domain-containing protein	0.895	347-363	KNKRTKRGRRLPLKGDQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUN2	Mcp5_PH domain-containing protein	0.797	857-887	RRPYGVKHQRKDSIRKVRSAAPVTRPSRPRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ13	Uncharacterized protein	0.798	207-217	KRKKEDRKSKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R8	B-block_TFIIIC domain-containing protein	0.994	588-624	KPGSKAKTQRGLGRPKKQAKTPKEKRVRVPKVPKPPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R8	B-block_TFIIIC domain-containing protein	0.969	1725-1738	ERKKRRVGKHKKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R8	B-block_TFIIIC domain-containing protein	0.954	692-709	IRAERGLPKLAKKEKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R8	B-block_TFIIIC domain-containing protein	0.916	831-853	APRKRKAKDLATTPAPAKKRRVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R8	B-block_TFIIIC domain-containing protein	0.813	970-980	KRKIGRGRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R8	B-block_TFIIIC domain-containing protein	0.602	1616-1617	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W757	Uncharacterized protein	0.959	63-78	RGKAKGRKEKDDKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9E7	Uncharacterized protein	0.692	200-205	KWKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAZ3	Transcription elongation factor SPT5	0.93	88-98	RPSKRRKKAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAZ3	Transcription elongation factor SPT5	0.8	285-291	LRKKKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBK9	Uncharacterized protein	0.982	1075-1093	KTSEKIKIGKKGKKKIAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBK9	Uncharacterized protein	0.879	20-30	PRRKRGRPSKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFH5	Uncharacterized protein	0.977	685-735	RLKKLQDAEAEKRAEEEKKERIAKKLAAMGPPKAKEQSPARPAKSPPKEKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFW0	Transcriptional activator xlnR	0.862	119-129	ERKKRGKASRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG34	Ribosome biogenesis protein NOP53	0.997	265-302	EIKKKRPERKSLSQRNKIKRRKEAQRKATHEAKMKAKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG34	Ribosome biogenesis protein NOP53	0.773	107-113	KRKKAKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG34	Ribosome biogenesis protein NOP53	0.727	162-174	KKKPKVEPKTLKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG34	Ribosome biogenesis protein NOP53	0.678	16-21	RKGKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGK0	FNIP_N domain-containing protein	0.702	1196-1209	GAGGKEGGEEKKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIX7	RHOMBOID-like protein	0.931	131-140	ARKKSKKKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJK1	UBX domain containing protein	0.942	358-375	REKARKKKEEAERKAREE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKJ5	LysM domain-containing protein	0.759	238-252	KKGKSKDSRTSGRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKT4	Uncharacterized protein	0.924	287-302	TPKQRKKPRKLGQPVG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKT4	Uncharacterized protein	0.758	310-322	GAPTPAAKKAPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKT4	Uncharacterized protein	0.604	306-306	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMJ8	Uncharacterized protein	0.756	1111-1118	KSRKKGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK6	RNA polymerase II subunit A C-terminal domain phosphatase	0.838	481-503	KAKKVPAGGRIAELKGEKSPKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNX6	Uncharacterized protein	0.879	319-364	RKPPAAPVKGAPPVMAGPKLGGSKSARAKMHKAQQDEAAAKKGKIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNX6	Uncharacterized protein	0.777	76-87	NRRRPRDRLREA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNX6	Uncharacterized protein	0.733	16-24	KRRKIAHPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY2	DUF3824 domain-containing protein	0.996	563-606	RSRSRSRSRDRSRSHRSRRRRSSSSSSGGRRGSRSRSRSKSRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY2	DUF3824 domain-containing protein	0.994	399-443	HHHHRSKSRHRSKSHSRRSRRRSRSVVGSDRGRSRSTSKHLDPKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY2	DUF3824 domain-containing protein	0.991	463-482	ERRRSKSRKREGKRSPSKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY2	DUF3824 domain-containing protein	0.974	503-538	KHKAKKEARAASRSKSRSRSRTRSVISRLTGRSRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY2	DUF3824 domain-containing protein	0.966	339-360	SSERGRGGRRTKSRHRSKSRVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNY2	DUF3824 domain-containing protein	0.95	625-642	AAKRRDRKKAEKEAERRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRK1	rRNA-processing protein EFG1	0.96	241-274	VPKKQEKKKEHAVKSKNTKAEEKLAQAKNRRERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRK1	rRNA-processing protein EFG1	0.849	19-40	KPFKKHRAFKPGQSNQKFKKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT87	Uncharacterized protein	0.804	39-69	KKARDELAKTVGKGKGPLNTGSQGIKKSGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT87	Uncharacterized protein	0.663	15-19	KKPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU14	BZIP domain-containing protein	0.837	53-64	AQRNYRKKLKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVW2	Peptidyl-prolyl isomerase CWC27	0.987	239-291	VIKAPKPDIAIPIRKPSRKSPPRSPSPKPVPKVDAEPSPKPKARTPPRELSPE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVW2	Peptidyl-prolyl isomerase CWC27	0.965	468-489	EAKRHKAEGKGKREWDGKKLKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVW2	Peptidyl-prolyl isomerase CWC27	0.962	191-203	TKKVKKPKRKAGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVW2	Peptidyl-prolyl isomerase CWC27	0.602	294-294	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW45	C3H1-type domain-containing protein	0.9	682-694	KEKRERKERRRHL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW45	C3H1-type domain-containing protein	0.741	261-285	KAGADSKKLRAKQLATKSQSRALKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW45	C3H1-type domain-containing protein	0.724	506-526	KKAKASPPPRVEPAESKGLKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW45	C3H1-type domain-containing protein	0.657	1028-1034	KRPKNRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2A1	Uncharacterized protein	0.98	302-323	KAPGKRGRGKSRKTPGPGKDRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U4	Chromosome transmission fidelity protein 18	0.605	83-84	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8D2	Smad nuclear interacting protein 1	0.999	94-237	PEPYRKPRVASRERKRHGSREGKRDRSRDRSRDRRRDKSRDRRRDRSGDRKRDSSKNKRRDRSRAKDTDRDKKRDGSRERHSRRDRSRSRDRRRRDKSTQGRRSRSPLPYRSRKPRTRSPSASASPPPKRRRRTRSPSPHKRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8D2	Smad nuclear interacting protein 1	0.992	39-76	GRVSRHGSERPKKEPVASGRRSRSRSRERKPPPPSSRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8H1	VOC domain-containing protein	0.915	565-578	RRRHRSHRHKSKKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8H1	VOC domain-containing protein	0.788	496-509	ESKAPPPKPPKPAS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W994	BUD22 domain-containing protein	0.934	342-398	PRKNRRGQRARQKIAELKFGQKAKHLEKAQRNAGWDPKRGAVSDDKHQRKGKPTTGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W994	BUD22 domain-containing protein	0.88	51-67	QKHSRRKKYATKKNDRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W994	BUD22 domain-containing protein	0.805	412-428	DRRDKKDRKMGLGVKRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W994	BUD22 domain-containing protein	0.671	4-15	RKRSSPPPTQKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W994	BUD22 domain-containing protein	0.601	18-19	PP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBA7	Pescadillo homolog	0.996	599-674	KKLEVKKPTRKEENATIRKKAEKKKRAEEEERERQKMMLSNKKRKLLKRIEYGENKRDNESENLRRKRARVEKAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBA7	Pescadillo homolog	0.623	50-52	NKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCM7	Uncharacterized protein	0.718	350-368	PPPRRTPRPLPSPNRTPRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJG7	Uncharacterized protein	0.613	473-477	RERDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK95	4-coumarate-CoA ligase 2	0.809	529-550	KIKRKLMREWAKKDAEKMNRAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLK3	Uncharacterized protein	0.704	272-285	KDRPDKQSKTKKYK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLK3	Uncharacterized protein	0.69	168-187	KKRHDGRGGDGHGNERGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLK3	Uncharacterized protein	0.656	20-26	RKAPKQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLK6	5'-3' exoribonuclease 1	0.977	1365-1385	GRGRGRGRGRGGRGRGGSRGS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM34	Structure-specific endonuclease subunit slx1	0.715	108-120	KGRKNASPVKRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQM7	54S ribosomal protein L31, mitochondrial	0.697	85-94	VKRYRKGIHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR53	Nuclear cap-binding protein subunit 2	0.611	22-24	KRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS18	Serine/threonine-protein kinase cbk1	0.987	512-525	KRRKREKKRPRDKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSP5	Uncharacterized protein	0.952	61-79	ARKRKRSEKDDRHRGGKHG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU35	H/ACA ribonucleoprotein complex subunit CBF5	0.999	447-492	KKSKKRKSRGDGEEEADEDKAERKKKKKEEKAAKKAAKKDKRKSKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUE5	Uncharacterized protein	0.897	615-665	SNRKKQDGKKKDAKWIFPKAVEGADVRVPKGDIRVRFRRREGLPASKIVRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX59	Integrase catalytic domain-containing protein	0.958	928-944	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX59	Integrase catalytic domain-containing protein	0.768	281-320	RRIRGGSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX80	CBFD_NFYB_HMF domain-containing protein	0.813	107-127	KKRLEEKEKEKAEDGKKAGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY27	Uncharacterized protein	0.862	40-49	RKKRKDKAPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VY27	Uncharacterized protein	0.739	451-467	PRPRGDSHSRSRSRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W063	Uncharacterized protein	0.99	342-413	KEKERATAREEARAAKEMERLQAEKERERAAAREEARRRKHEEHERERLAQEKKERDDKMARDRKKEKSKPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W063	Uncharacterized protein	0.788	282-293	RPKVSDERRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W063	Uncharacterized protein	0.645	681-683	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W063	Uncharacterized protein	0.607	98-99	GK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5W0	Uncharacterized protein	0.802	29-51	RQRKPQKIKQEPNAPPIKKITKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5W0	Uncharacterized protein	0.692	177-183	EERAKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9G3	Nucleolar protein 10	0.949	467-512	KINKERESKIRGTKKAAVKVNRKLAEKMLEKQEEQERRRAKRVLKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9G3	Nucleolar protein 10	0.938	691-717	ERKQKRKGGDGGDKGERHDRRKSGDRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC17	TAP-C domain-containing protein	0.784	42-53	RGRGRGRGPRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC17	TAP-C domain-containing protein	0.694	9-17	ARGRGRGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCS8	BAH domain-containing protein	0.697	290-295	KKRGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCZ2	Protein disulfide-isomerase MPD1	0.987	252-276	PKAKKSKPKKDTKKESKSSSKFAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF23	N-acetylated-alpha-linked acidic dipeptidase 2	0.874	111-128	RARRNRSRGRFSKRLNRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIV1	Phosphoinositide phospholipase C	0.685	1068-1073	SERRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPM7	Integrase catalytic domain-containing protein	0.982	1035-1051	PPRKRGRPKGSKNKPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRP8	MAGE domain-containing protein	0.761	297-304	GRKRGRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT60	DNA-directed RNA polymerase subunit	0.984	1779-1790	PPKKKKSKKHGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT60	DNA-directed RNA polymerase subunit	0.712	1115-1123	KKAAKKARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT60	DNA-directed RNA polymerase subunit	0.634	1344-1349	KDLKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUY4	THO complex subunit 2	0.989	2219-2335	SHRDSRRSERSGRERSSPERSERRPDERSSRTAPSDRPEGERGGREKRGGDRETSRRDREREGESRSAREPRESSRRERGTREDGGRTSGREDRDRRSRGGGGSSGVDDGRKRGRDP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUY4	THO complex subunit 2	0.706	1749-1760	SPGRRARLPGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUY4	THO complex subunit 2	0.698	2343-2347	VKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUY4	THO complex subunit 2	0.667	1915-1928	RREREPRLNSPRHG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5R5	CRAL-TRIO domain-containing protein	0.693	276-284	RRQRKERWE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W667	U3 small nucleolar RNA-associated protein 5	0.616	409-412	KSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W667	U3 small nucleolar RNA-associated protein 5	0.609	18-19	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6A5	Beta-glucosidase 1	0.852	54-67	KIRRKKSKGDLKIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6J5	HECT-type E3 ubiquitin transferase	0.839	2715-2741	EVARKLKEEQEKKEQKEREEREKREAQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6J5	HECT-type E3 ubiquitin transferase	0.783	3157-3168	RANRKGKAKESK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB23	AB hydrolase-1 domain-containing protein	0.996	431-464	ERHEKAEKAEKPEKESKEKKEKKSSSRRKHGGSH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA8	Ribonuclease P/MRP 30 subunit	0.663	228-236	KRQQAKNKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDR6	RNA exonuclease 4	0.858	66-76	KRRRKERSPHG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDT9	Ubiquitin carboxyl-terminal hydrolase	0.694	576-581	RRKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI75	Integrase catalytic domain-containing protein	0.968	1167-1184	QPRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI75	Integrase catalytic domain-containing protein	0.667	549-557	RGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI75	Integrase catalytic domain-containing protein	0.642	524-536	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ16	Uncharacterized protein	0.838	226-237	KRGRGRPRKTDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKK2	Vegetative incompatibility protein HET-E-1	0.788	125-134	HRKRKPVIRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPU3	Signal recognition particle receptor subunit alpha	0.944	232-244	SAKKKGKGSKKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPU3	Signal recognition particle receptor subunit alpha	0.885	202-218	ARPLGGKISRRDKKKAS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSV1	Sas10/Utp3 family protein	0.998	573-604	GLTPHRKKSVRNPRVKKKEKYKEKQKKLKSMK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSV1	Sas10/Utp3 family protein	0.808	390-397	KKAARKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSV1	Sas10/Utp3 family protein	0.695	4-12	KRKAGGGAS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSV1	Sas10/Utp3 family protein	0.673	342-350	KPIRQRKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSV1	Sas10/Utp3 family protein	0.631	429-431	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSX9	PHD-type domain-containing protein	0.995	193-215	PVRAKSKPKPKKSKGSRSSKRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTP9	Uncharacterized protein	0.802	196-222	NRPRRASASTRQPAASPKKPTAPPKSS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTP9	Uncharacterized protein	0.607	120-121	RS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTP9	Uncharacterized protein	0.604	123-123	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W004	Multidrug resistance-associated protein 5	0.947	577-595	PGKKADAKKDKKEKRASVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W004	Multidrug resistance-associated protein 5	0.932	311-325	KKMLKKKDPKKAPKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W004	Multidrug resistance-associated protein 5	0.711	83-91	RKKKPFYKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W042	Uncharacterized protein	0.665	28-32	KRSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W073	Protein kinase domain-containing protein	0.797	37-61	NKENARPHSSGGLLSRRGSRKSEKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W073	Protein kinase domain-containing protein	0.763	1025-1049	KPKPKSSSPPVRKPTSPSKDALRKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W073	Protein kinase domain-containing protein	0.627	1078-1082	KEKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W073	Protein kinase domain-containing protein	0.616	31-33	KKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W073	Protein kinase domain-containing protein	0.611	1059-1060	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6T6	SprT-like domain-containing protein	0.837	660-688	KALRREKERELAREKEQIKKLDREKERAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W731	Uncharacterized protein	0.723	571-579	GAKRGKHHH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W990	Zn(2)-C6 fungal-type domain-containing protein	0.892	9-21	PKPRKPRPSRARG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAJ6	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.75	18-34	RRSGRSKSRSPAPNGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES9	Eukaryotic translation initiation factor 2C 2	0.966	9-78	GDRGRGNFRGDRGGGRGGGRGDSGGRGGGRGDSGGRGGGRGDFGGRGGGRGDFGGRGGGDRGGGRGGGGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WES9	Eukaryotic translation initiation factor 2C 2	0.876	431-448	PKPGAEGAKGKGKKVPTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHB6	Pinin/SDK/memA domain containing protein	0.765	59-71	KPAPVRREKGRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIY9	External NADH-ubiquinone oxidoreductase 1, mitochondrial	0.644	63-68	KPKPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMQ0	Uncharacterized protein	0.89	257-267	PRKRIKRAKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS39	Uncharacterized protein	0.989	120-160	AKKAGKPRATKAKEPKKITARVTKPTKTSTKVVKPKKVTKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUW4	60S ribosomal protein L39	0.696	40-46	KRRHWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ86	Integrase catalytic domain-containing protein	0.958	944-960	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ86	Integrase catalytic domain-containing protein	0.658	464-471	RGFKPRWR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ86	Integrase catalytic domain-containing protein	0.639	439-451	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZK4	alpha-1,2-Mannosidase	0.812	109-119	KKKKKIDWDKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZK4	alpha-1,2-Mannosidase	0.81	623-653	KKRFKTGWERIPRDEKGTLVPKKAEEAKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZZ4	DNA polymerase subunit delta-2	0.866	491-504	AKGEKQGKKRRNNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZZ4	DNA polymerase subunit delta-2	0.708	204-213	HKKEVPKRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1Q1	C6 zinc finger domain containing protein	0.603	19-20	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8J6	Calponin-homology (CH) domain-containing protein	0.905	231-248	KKEKKVPRKALAAPPKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8J6	Calponin-homology (CH) domain-containing protein	0.82	1064-1086	RWVRRITAGRVGGKEKVRRVRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8J6	Calponin-homology (CH) domain-containing protein	0.69	167-176	KKQAPKKDLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8J6	Calponin-homology (CH) domain-containing protein	0.651	104-108	RAKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8J6	Calponin-homology (CH) domain-containing protein	0.621	117-121	KMPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8W2	CUE domain-containing protein	0.992	582-612	GRGGRGGRGRGRGRGRGGPGGGRGGASVAGP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8W2	CUE domain-containing protein	0.892	619-648	QISRQRKEANKSSSANHNRKAQRGKKMARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8W2	CUE domain-containing protein	0.869	292-307	RPKRLIRRKVDKGKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8W2	CUE domain-containing protein	0.603	616-617	KG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9S6	Uncharacterized protein	0.939	347-366	RPKAREKKKMEVRKERILKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAE2	Uncharacterized protein	0.943	325-338	GIKRKERAKKTRKM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG46	Vesicle-associated membrane protein 712	0.987	62-84	SKPKSRKRARVPPAERRARPRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHN2	Uncharacterized protein	0.988	8-31	RRRTEDQLRGKVPKKEKRKVKKQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJZ8	Uncharacterized protein	0.966	133-150	RPIVRAPKRKHRHGGKKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJZ8	Uncharacterized protein	0.841	507-525	KRKGTAKRSKISSLRSPGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJZ8	Uncharacterized protein	0.748	533-542	VAKGAPRKKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKI5	Dual specificity tyrosine-phosphorylation-regulated kinase 3	0.652	576-580	EKKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKR6	Uncharacterized protein	0.696	171-178	RSLRKRQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLM8	Uncharacterized protein	0.973	220-239	KKGWGNGKGKKKERRPVDKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNC7	Nitrogen permease regulator 3	0.967	250-260	KKLKRKKKKLS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRN8	Uncharacterized protein	0.994	403-461	TKMQERWEKDKAKERKEREKGEKKRLEQVEKDKKQRENEEKKRQEQVEKERKEKETQEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTR8	Zn(2)-C6 fungal-type domain-containing protein	0.635	228-232	KRGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYS6	ATP-dependent RNA helicase HAS1	0.943	11-43	KRKRSHKSKKVAEVAVPAHNGVEKARKKARKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYS6	ATP-dependent RNA helicase HAS1	0.753	596-605	GRRPMKPGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W124	40S ribosomal protein S23	0.869	3-23	KGKPRGLNAARKLRNHRREGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W124	40S ribosomal protein S23	0.702	137-144	KEKKEKPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4X1	Uncharacterized protein	0.91	218-232	SAGRETKERRKPRKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ9	26S proteasome non-ATPase regulatory subunit 12	0.665	488-495	KAAKSKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCF2	ATP-dependent DNA helicase	0.997	812-865	RAKPVPKAKAKEPAKPKKAAAPKAKQKLGPEPQENVSPMAPKTPAPRARPRKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCF2	ATP-dependent DNA helicase	0.96	629-641	PKKGRRTKKPPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCF2	ATP-dependent DNA helicase	0.648	980-986	RPKRTPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDA5	Uncharacterized protein	0.99	163-204	PMVRGPNLRGRDASKPGGPGGKRKAGGAGNNRGEGGPKRRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDL0	DNA-(apurinic or apyrimidinic site) lyase	0.829	393-404	RKETTKRKRIKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE38	Nuclear localization protein	0.983	106-125	IKRKRGRPSGGGRGRPPKGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE38	Nuclear localization protein	0.902	75-88	PRKKRLGRPPKNRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFK6	Uncharacterized protein	0.682	224-230	KARRHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFN9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.983	876-890	LKKKAPPKNKKKTKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFN9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.94	648-699	KGRNGGFGARGGRRGLGAWDPSTRRGKKPPRIVNAFVDERRKASAPKPRVAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFN9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.617	45-47	RKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFN9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.61	822-823	KG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFN9	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.603	825-825	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG54	Uncharacterized protein	0.949	24-38	RKRRKTAKAARKLRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI59	Uncharacterized protein	0.692	213-222	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIM1	Uncharacterized protein	0.683	68-72	NKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJP4	Uncharacterized protein	0.85	3-15	KRHNRKRTRSRPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJZ3	Integrase catalytic domain-containing protein	0.967	843-859	PRKRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR83	Transcriptional activator xlnR	0.873	59-70	EKKRRGKVPRHI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK8	DNA replication regulator SLD2	0.99	334-362	GKPRKAWKKKGLKRQTRRVIMRPNITKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK8	DNA replication regulator SLD2	0.985	438-477	LKTAARKIKATANANYRRLNIKGKAATGGKSGKGKFGRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK8	DNA replication regulator SLD2	0.676	67-75	PSKRGASRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSK8	DNA replication regulator SLD2	0.648	414-421	RKVTAKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTA6	Casein kinase II subunit beta	0.87	336-347	RRKKAIRTRRRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTF8	Zn(2)-C6 fungal-type domain-containing protein	0.879	565-577	AKKRALHLRRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUL1	NAD-dependent deacetylase sirtuin-2	0.987	45-70	QDRPWRNAEEGRKGTGKGKGKGKRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUL1	NAD-dependent deacetylase sirtuin-2	0.669	34-42	RKHKGHRQQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W069	DNA repair protein rhp42	0.998	1121-1149	SPKKAARGRGGARARGRGRPRGRAGKAKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W069	DNA repair protein rhp42	0.99	7-37	RKRLRSDSPKAEPPAKRARDRKPPAPPRRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W069	DNA repair protein rhp42	0.759	1045-1071	TRHKSTSTRGRSTPRARASQSSTRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W069	DNA repair protein rhp42	0.637	858-863	KERAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBD7	ABC1 domain containing protein	0.987	533-553	LPKPRKRKIKPPFTRRKWVRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFK7	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.958	20-62	KAKREKEAAEAKPRFIPRAERERIALEKRKKEVEDAQKKREGL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFK7	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.825	142-148	KKKRKRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFK7	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.821	219-228	ERRRKEKGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFK7	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.714	103-114	PPPLPDKKHGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFK7	Pre-mRNA-splicing ATP-dependent RNA helicase PRP28	0.677	81-98	GPRSMREAPTGPRHERRN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFU8	Uncharacterized protein	0.632	1024-1029	KKIKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ61	Uncharacterized protein	0.988	311-372	AKPGPAKPKPTRKPRTRNNTIGIRKFRGKLRIRTYTTKGSRTRVAKPRGGPPVLRIRRYRGD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ61	Uncharacterized protein	0.965	162-182	RKRRRGIRKYPVKPKSAAKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ61	Uncharacterized protein	0.921	491-504	KGSKAGGGRQRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ61	Uncharacterized protein	0.86	401-412	RARRAERSRKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ61	Uncharacterized protein	0.758	110-124	LKRKIKFQALKKPGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ89	DNA base excision repair N-glycosylase 2	0.966	103-121	PKKAPKTKKARAAPAKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ89	DNA base excision repair N-glycosylase 2	0.879	336-345	VPRKRSTRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ89	DNA base excision repair N-glycosylase 2	0.665	76-80	KKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN34	Uncharacterized protein	0.692	214-223	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUK0	Camp independent regulatory protein	0.703	160-165	KRKRKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ37	Uncharacterized protein	0.95	545-597	KKRKQEKKMGSERSRSKSSKTRDRDDSTEGMKIKRASHILRFKLRLRDLFRKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZU7	ATP-dependent DNA helicase	0.744	841-852	LLKHSKIRAKRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZU7	ATP-dependent DNA helicase	0.615	61-63	RRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0V7	Protein kinase domain-containing protein	0.794	762-777	VAAPKKEVKKETPKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1D2	Uncharacterized protein	0.65	574-583	KNAARGRSLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1M4	Regulatory protein cys-3	0.769	178-194	KRRRNTAASARFRIKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5D0	Uncharacterized protein	0.701	444-450	RRKRSLP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5T4	Uncharacterized protein	0.647	571-578	PGANKRMK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Q4	Uncharacterized protein	0.992	40-57	RRLRERRKKRKTRKEPDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8Q4	Uncharacterized protein	0.781	469-474	KKKKRF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA20	Zn(2)-C6 fungal-type domain-containing protein	0.729	21-30	RPAPDRRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAZ7	DNAJ domain containing protein	0.988	473-497	KKDAKHDKHHHDKKEKEKDKKKEKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDE7	Uncharacterized protein	0.847	154-163	SKHKKKKTIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDK9	U2 snRNP auxiliary factor large subunit	0.977	26-48	DRGDRRRRRSRSPRHGGGGGGGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDK9	U2 snRNP auxiliary factor large subunit	0.951	79-152	RRDDRGERGGERGGWGDSYSRRDRPRDRDRDDDRGHRRERGAERNERGGDRFGGEDRRGGRGGRDGGFGGGRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFI8	Uncharacterized protein	0.974	89-132	KKKGMTAAPKKGIKSLNTKKGKSTPGGDAGKRPGQGERKALRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFI8	Uncharacterized protein	0.678	224-227	KKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJI2	TRUD domain-containing protein	0.972	243-266	PPAERKNKKGKGGGRDREDHSRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJI2	TRUD domain-containing protein	0.621	190-194	RESKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKB2	DNA repair and recombination protein RAD26	0.976	121-160	KERKTLKRKRAAAETNRIRAEKKSKVKAAVSVVGRKPRPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNQ3	Uncharacterized protein	0.991	370-386	IPKKSKKAKKSKKLPKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPE8	Uncharacterized protein	0.999	190-221	GKANKEGMKHGKGKGKKHGKKHGKKHGKGKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPE8	Uncharacterized protein	0.967	535-560	RSPKGKGKGKGKAAAPAAAPAAAAPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPE8	Uncharacterized protein	0.84	496-509	SPKGKGKGKAAAPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPE8	Uncharacterized protein	0.728	451-458	KGKGKGKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM0	Uncharacterized protein	0.749	11-21	KKAKHQAKRPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV91	Integrase catalytic domain-containing protein	0.968	1167-1184	QPRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV91	Integrase catalytic domain-containing protein	0.667	549-557	RGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV91	Integrase catalytic domain-containing protein	0.642	524-536	SRGGGGFRGGSRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVM7	Uncharacterized protein	0.609	175-176	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWJ3	Uncharacterized protein	0.692	165-172	KEKKERPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWZ0	BZIP transcription factor (MeaB)	0.773	40-49	KRKGGRKPPI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W072	Uncharacterized protein	0.871	206-216	RRKPERKSRKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W072	Uncharacterized protein	0.828	295-325	RRKMAEAKKQRAERQKQEEEKQLREEERRRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0R2	Peptidyl-tRNA hydrolase domain containing protein	0.998	102-125	TRVKAREKSKKKASKAKKARRKYR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1W3	Uncharacterized protein	0.972	20-37	AALARRRRSKRRIQKHRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W668	Bromodomain containing protein	0.998	656-700	KRASPKLPGKKKKGAAPPAKRKSLPLAVPPPAKPMKSSAVKKAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W668	Bromodomain containing protein	0.765	394-404	PVKPAKAKKPT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W668	Bromodomain containing protein	0.658	478-482	KPRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W985	Uncharacterized protein	0.999	710-727	GKGASKKKRKKRGKKKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAR2	Uncharacterized protein	0.999	24-56	KKRKREAEPEASKDSKKAAKKAKRKEKKKQKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX9	Uncharacterized protein	0.925	556-576	KPKPKVKKPSKPVTETPKRKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX9	Uncharacterized protein	0.77	504-522	KPKRKLSIGAKPYTPEPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX9	Uncharacterized protein	0.756	472-480	KRPRGRPPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX9	Uncharacterized protein	0.622	375-379	ERREA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBX9	Uncharacterized protein	0.617	381-383	SKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC59	Protoplast regeneration and killer toxin resistance protein	0.63	639-647	KAGKVVKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCX1	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1	0.986	71-92	RRGSSIKVGKWGKKKPKTRRKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ66	Uncharacterized protein	0.934	669-686	PGKKKGPAVAPKRGAKKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ66	Uncharacterized protein	0.678	336-341	LEKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ66	Uncharacterized protein	0.602	549-550	PR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJS9	DUF4210 domain-containing protein	0.976	381-395	LRRKEKKKRRSTLPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMN1	Uncharacterized protein	0.664	207-214	RQKPGKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU08	RRM domain-containing protein	0.997	170-210	KKDKPKPATAEKAAAGAARGRGQTRGRGKGRGGRDARPKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU08	RRM domain-containing protein	0.901	18-36	KTSRRGRAGRRSGAGRPAT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXZ5	CBS and PB1 domain containing protein	0.874	60-90	KRDDAIRRKIESDLNKKKNHSGRVRLSKKAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W064	HRDC domain-containing protein	0.982	449-477	KKWKRMRDQGLEEGGKKKEPRRSTRKRSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3L5	CFEM domain-containing protein	0.816	537-547	RRKLSKRGRKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4K5	NIMA interactive protein	0.893	422-456	RASRQASRDGRAPRHTKKRLSSPHAHPDEPSPKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4K5	NIMA interactive protein	0.891	498-515	AARSPVRTRVGGRPKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4K5	NIMA interactive protein	0.628	27-31	RKNNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7A6	Uncharacterized protein	0.831	34-48	KGPFGKARKRGTSRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7E3	CCHC-type domain-containing protein	0.914	485-509	KPRTKPRTRSPNDRNPARKARSGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7E3	CCHC-type domain-containing protein	0.739	257-273	PRPRGDSHSRSRSRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U2	Uncharacterized protein	0.984	91-115	EKLEKKRMKSLGKEKKIKERAKGWE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U2	Uncharacterized protein	0.783	6-19	KVKKRLHSRAARRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U2	Uncharacterized protein	0.676	120-127	EGLKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7U2	Uncharacterized protein	0.67	63-69	KKQRKSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9Z6	Uncharacterized protein	0.937	103-120	RGEFRKKRKVWRKEDRHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC66	Transcription initiation factor IIF subunit beta	0.671	161-168	QKRSKYKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC94	Uncharacterized protein	0.713	316-322	KAKSKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCQ9	rRNA-processing protein UTP23	0.998	214-251	ARPKAKKRKGPKGPNPLSVKKPKKDKTSAPKKARPSAS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCQ9	rRNA-processing protein UTP23	0.99	260-279	RGDREDSAPKKRRRKHKSKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFI3	Uncharacterized protein	0.902	1341-1355	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGJ4	Vacuolar membrane-associated protein IML1	0.938	357-373	KPRKADKIVRKSRKKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHF6	Uncharacterized protein	0.948	236-245	KKPRKRRSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHF6	Uncharacterized protein	0.781	272-279	VKKTRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WI51	Uncharacterized protein	0.965	62-76	PRKRGRPKGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJA2	Uncharacterized protein	0.844	894-908	RAARLAKRKRDQKMG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJA2	Uncharacterized protein	0.79	489-505	PRPGEKQNRRGMRRPPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJA2	Uncharacterized protein	0.605	768-768	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJE7	Epsin-3	0.937	253-275	ARRKETAAAPPKKEVKKEAPKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJE7	Epsin-3	0.644	160-164	RKKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJN0	ATP-dependent RNA helicase DRS1	0.997	735-805	GSVKGKEKKKKLSGKDRKKLEAKDVRTEGKVWKKGKADRGLTTGKAKEKQAHQKAKSKKIAEKTKFKGFKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJN0	ATP-dependent RNA helicase DRS1	0.992	52-70	KPKEMASKKAKKDKKKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJN0	ATP-dependent RNA helicase DRS1	0.808	263-271	KIKKKKGAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJV2	Uncharacterized protein	0.686	584-591	RRGRKMAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK21	Uncharacterized protein	0.84	366-384	ARKKRMDDKKHRMLARRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WK21	Uncharacterized protein	0.633	143-152	RWPRGPQPHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNB7	Uncharacterized protein	0.952	411-428	PPPAPKAKSKSKKEKPQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNB7	Uncharacterized protein	0.943	523-549	ERADRRAAKEAKEAKARQREEKAARKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNB7	Uncharacterized protein	0.799	606-626	RTRRGTDAGKGKGRVGEHKIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP05	DNA-binding protein REB1	0.926	158-179	HRRPANKHQTARNKQRKKLKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP05	DNA-binding protein REB1	0.854	472-480	RRKRGRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP05	DNA-binding protein REB1	0.749	37-46	KTKLKRVKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP05	DNA-binding protein REB1	0.604	503-505	KPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRZ1	Serine/threonine-protein kinase RIO1	0.999	470-516	SRGKKHIDHDEKVAHKKAIKEEKREKRKEKMPKHMKKKLTSQTGRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS23	GYF domain-containing protein	0.739	249-263	KDMKKAKEAHEKREA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS23	GYF domain-containing protein	0.688	305-318	APKKRVTSNWAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT96	RNase III domain-containing protein	0.962	379-460	KQRRKEARKEREKMKLLQEQEKKERQKVREKEIALQSMKKQEIQKEKQKQKEQEAKKKELEAQEKKRLEDQRNKELKAQKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT96	RNase III domain-containing protein	0.806	768-782	SKRLERRAKLREQRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT96	RNase III domain-containing protein	0.729	273-282	RKKAELRRKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTA3	General transcription and DNA repair factor IIH subunit TFB4	0.981	340-348	PRKKKKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTP5	Ubiquitin conjugating enzyme 7 interacting protein 1	0.756	708-720	RRRAALATRARRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTP5	Ubiquitin conjugating enzyme 7 interacting protein 1	0.657	170-173	KKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU63	60S ribosomal protein L25	0.854	22-58	KAALRGSYANKKRAIRKNTSFHRPKTLELSRAGKYPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV96	HTH CENPB-type domain-containing protein	0.875	419-443	RRVERQRLKEMRELERAKKAAERAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV96	HTH CENPB-type domain-containing protein	0.612	402-403	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVF7	Uncharacterized protein	0.993	29-60	RNRQQKRIERLRKKRQDKARDKARVARRSRHR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZL3	Protein FYV4, mitochondrial	0.986	212-241	KRGHKVDGGERRKAEVRAKRRAAENKEKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Q1	Uncharacterized protein	0.99	117-182	ERRRRPQPFQKESEVARKKREEAEERQKAREEADRERQKKIAERERFRKTMAKARGGPNGKRKLGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3Q1	Uncharacterized protein	0.979	8-61	EKGGESSAWKQKKGFKIGPANLPDGTHRRKIEKIKKSLIEKAKIKKQYAKLKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7M8	Uncharacterized protein	0.796	44-64	PLKKHTRKATMKLREDKKSHP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAB6	Uncharacterized protein	0.996	209-238	KEGEKEKGGNGRRRNRRGGRRHGNKGKEGV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEK5	Uncharacterized protein	0.967	286-314	ERVRRERKEQIEKRKEMIRNKKKAIQAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEK5	Uncharacterized protein	0.628	182-187	REERRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG27	60S ribosomal protein L6-B	0.698	42-50	KKARKSVRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ55	DUF4604 domain-containing protein	0.983	125-149	KEGEKKNSDKSNTKAVKKPKKKAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ55	DUF4604 domain-containing protein	0.802	106-115	GNIKKRKAAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD8	Uncharacterized protein	0.999	671-694	KKKAKRKPTKKPVKKKVKKVGKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD8	Uncharacterized protein	0.983	636-661	RKNKKKTKKGKEPNSADSYKPSKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD8	Uncharacterized protein	0.898	366-419	KKADEAKKTAEAKKAQIQADEAKRLAEQKAKLVKRVAGQKAASEKAAKEKRAAE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD8	Uncharacterized protein	0.739	572-581	PKKPARKQPV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD8	Uncharacterized protein	0.726	470-488	KVAADKARKEEEARKEAAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD8	Uncharacterized protein	0.61	507-509	KRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNG7	Non-specific serine/threonine protein kinase	0.898	168-176	PKKKKEKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNG7	Non-specific serine/threonine protein kinase	0.763	140-147	KKPRKPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNG7	Non-specific serine/threonine protein kinase	0.631	374-378	RPRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNU9	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.946	513-556	RRGMGRGRGPWGDRGRGFRGRGAGGRGDFGGGGRGDRGGFGGAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNU9	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.912	661-677	GGKNKNRKQRQREKRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNU9	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.68	430-434	KAKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNU9	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.61	583-586	KGGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNU9	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.604	588-588	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRG6	Sfi1 domain-containing protein	0.712	931-936	PRRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTG3	U2 snRNP component IST3	0.999	194-294	RKLKKQKQKEKERVKRKDRHSRRDRSRDRDRHRDKDRKRIKEGEEYRDRRHRSDRTRDRSEDSRDRRDRHRKRERRRSHSDEDTKPSRAKGSRSPLPYRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTG3	U2 snRNP component IST3	0.615	142-143	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUP0	Uncharacterized protein	0.757	1621-1629	AKKAAKPKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ75	Small nucleolar ribonucleoprotein complex subunit	0.875	222-240	PRRTPKRLFWRKGNKNKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W200	Uncharacterized protein	0.783	30-40	RKTKSPRKRQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4D5	Uncharacterized protein	0.66	163-167	AKKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Q8	Peptidyl-prolyl cis-trans isomerase	0.993	454-509	YKRKRSRSPTRERRDGDDGRYNARRRERSRSPNRHRDSRRERSRDRYRRDDRDRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4Q8	Peptidyl-prolyl cis-trans isomerase	0.634	441-445	RRRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.998	70-154	AKKGLSRRAFQEVPRELRRRTASHNPQRVPKRLRVRARQEAKEDNTPISRGTSGSGIGKGKKKYLRKKGREKSRQDWEKRAKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.92	1154-1179	RRKIKKKSSYIKKADRDRSGNNGSGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.887	1217-1237	GGESPKKKKIKLSLSSGGGAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.807	607-619	RKHEWTKRPKGKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.7	6-24	KKRKQASHPGPGNNPKRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.681	189-195	RPRRKFP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.666	204-210	PSRFRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.625	1208-1212	GKRDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5Z8	SAGA-associated factor 11	0.621	1184-1188	KVKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7F4	Uncharacterized protein	0.999	452-578	DKSRGRSRSRSVARSTRKRSKTRSPSRGSRYDRQSSRYADDRRSRRDDDRHSYRPSRRDRDDRDDKHSRRGSRSRSRETHTSRRKSRYGSRSPSPPREERRRDRSRSRSRGGRRERERRRRHSRSRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7F4	Uncharacterized protein	0.999	664-703	RDRKPRDRSRERSRDRGRDDRDRRRRARSRTRSRSRDRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7F4	Uncharacterized protein	0.998	167-332	RRERREARREKELEEEREREREERAKKEERKRREREEDEAREKARQEEKERRRKEREEREKEDEERRRKDRERIDKEREEERLRLKKEREEHEKSREARLKKIREEDAERERRIQEELDRDRGGRRRGGRGRSRTPERDRDRRGRDRSRRRSRTRTRSPERRPSLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7F4	Uncharacterized protein	0.984	596-630	ASRKREDSRDRKREDSRPPRKRDNSRDRPRGYRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W884	BHLH domain-containing protein	0.996	317-360	RPAKKRKKSLAKGGKDTPKKAARSSKARKAVVAEESAKKKRTPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8R2	DNA polymerase epsilon catalytic subunit	0.798	1264-1274	KIQKEARKRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCF9	Galactosyl transferase GMA12/MNN10 family protein	0.993	300-395	PVLKGPKKQPKPPKEERPTEVENKKPPKEQHKKPTEEKKPQKEEYKKPTEEKKKPTEGEYKKPTQGEYKKPTQGENKKPAQGENKKPAQGENKKPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCX7	Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyldiphosphate specific)	0.893	46-64	KKKALRDRRQRASQKHRKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WER8	Uncharacterized protein	0.97	601-617	AKRLAEKRKRKGKVVRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG09	Myb-like domain-containing protein	0.988	266-293	KPDIAKKGGAAGGGDGGGGKKGKKGKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG09	Myb-like domain-containing protein	0.792	539-546	SEKGGRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG09	Myb-like domain-containing protein	0.65	442-449	KAPSKAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHM3	Uncharacterized protein	0.999	357-377	KKKGKKGKAAKKAKKSKPKPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHM3	Uncharacterized protein	0.996	441-492	KAAREKAEAEEAARKKAAREKAAREAAQQKKDAREREAREKKAARKKATKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHM3	Uncharacterized protein	0.969	622-672	RLRAAEAAKERLEKELRKKKAALEATERKAQEANKAREAKERRTRVAEEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHM3	Uncharacterized protein	0.936	798-813	KANKPKKRQSRKSRPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHM3	Uncharacterized protein	0.891	527-540	IREKKKREAKEARA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHM3	Uncharacterized protein	0.801	842-857	KKPSKKAQWEKGRARP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIV6	Zinc finger containing protein	0.858	663-669	KSKKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIV6	Zinc finger containing protein	0.836	516-533	SKSGKHGKPRAVSKSKSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIV6	Zinc finger containing protein	0.713	205-219	PGRGRRSVSASKRMR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ60	Reverse transcriptase Ty1/copia-type domain-containing protein	0.879	422-436	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM1	GPN-loop GTPase	0.905	327-366	RRKAEREQEKKETRQRELDKMMRDMKVGGAGTKPKPKPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTS0	ATP-dependent RNA helicase DBP4	0.987	653-669	ARAKRKEKLRKRKERER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTS0	ATP-dependent RNA helicase DBP4	0.926	735-744	KTKKRKKAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTS0	ATP-dependent RNA helicase DBP4	0.788	28-42	RPTKVKKRENLQKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTS0	ATP-dependent RNA helicase DBP4	0.644	720-724	KKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU15	Origin recognition complex subunit 1	0.758	230-238	RKGAGRPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU15	Origin recognition complex subunit 1	0.75	261-266	PRKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV48	ATP-dependent RNA helicase DBP9	0.958	570-605	KPNRRTYVKGRGRKVVRRNGKVDPLKTFNARGKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV48	ATP-dependent RNA helicase DBP9	0.883	371-379	RPKKKKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT5	Exosome complex exonuclease Rrp	0.995	743-756	KKKKKKDKKKKSAG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT5	Exosome complex exonuclease Rrp	0.941	697-710	EKAARKAARKQKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT5	Exosome complex exonuclease Rrp	0.675	655-659	RKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYD8	Oxysterol binding protein 1	0.698	225-230	KKRRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W277	Phospholipid-transporting ATPase	0.935	283-296	RNSQKKKRLRKQRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W654	SPX domain containing protein	0.618	192-194	RRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8J7	Threonyl-tRNA synthetase	0.961	30-44	KENKAPKAKKEKKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA98	Uncharacterized protein	0.994	3-22	RKGPVRVRKVEKKRKRKGKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBT7	Uncharacterized protein	0.709	135-150	HKRGERKMTAAEARRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX9	Mannan polymerase II complex ANP1 subunit	0.829	405-423	RKKKEAEEEAKKAKESKIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX9	Mannan polymerase II complex ANP1 subunit	0.634	477-480	GKRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX9	Mannan polymerase II complex ANP1 subunit	0.621	457-459	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGY7	Uncharacterized protein	0.749	62-72	MRRKARSASRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHG9	Polynucleotide adenylyltransferase	0.9	1211-1221	RKKGKNKKPRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ75	Palmitoyltransferase	0.791	671-681	GKKSGRRSPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL06	Uncharacterized protein	0.991	502-530	KAERRRAELKRKNGEAAKKLAQAKKKKRF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL06	Uncharacterized protein	0.726	440-450	KARKPFKIGGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNL3	ATP-dependent RNA helicase DBP3	0.984	96-114	KAAKKAARKAEKKRAKALA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNL3	ATP-dependent RNA helicase DBP3	0.929	63-80	AKAERKAAKKAAKAAKEA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNL3	ATP-dependent RNA helicase DBP3	0.915	23-34	RKKSKKDKSKKL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS21	Zn(2)-C6 fungal-type domain-containing protein	0.915	66-76	RGGRRERKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWD8	F-box/WD repeat containing protein 7	0.784	180-195	KRAEFREKERKTRHRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWD8	F-box/WD repeat containing protein 7	0.71	203-211	KPSHKKRVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXK2	Uncharacterized protein	0.841	287-296	GKKKKLRANK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW3	Eukaryotic translation initiation factor 2A	0.981	536-556	ALKNKKKREAKKAREAADKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW3	Eukaryotic translation initiation factor 2A	0.652	572-580	RSPERRQRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZW5	Uncharacterized protein	0.988	10-64	RRRKKDPDRERSSPRTKDKDKDRDRDRDRDRDRDRDRERHKSSRARKTRSSASKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZW5	Uncharacterized protein	0.879	884-895	RRRKAHRARERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1R2	DNA-3-methyladenine glycosylase	0.682	156-160	KKRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W554	Uncharacterized protein	0.956	25-44	PPKRSRAKPRPKDPNVPRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W691	WD domain containing protein	0.788	894-921	SRKNKNPNRSPSPPSPRSSQQGKRRASV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W710	WD domain containing protein	0.959	1322-1334	PTKTKKKGKRKVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDR7	Uncharacterized protein	0.692	213-222	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDS2	Uncharacterized protein	0.953	122-138	KGAKGEKKHKKKTSKTI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDS2	Uncharacterized protein	0.679	168-173	RRKNRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDS2	Uncharacterized protein	0.656	283-291	KRREGQRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFJ9	Uncharacterized protein	0.994	168-200	IEKRRKQKPRRLRRSPTGGFQRHDPHAKKRRSM
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIG7	Uncharacterized protein	0.728	99-107	VGSRRRRAV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIG7	Uncharacterized protein	0.603	92-93	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJW7	tRNA-dihydrouridine synthase 3	0.952	381-396	PPKKKRKQMSKSEKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJW7	tRNA-dihydrouridine synthase 3	0.655	521-525	KEKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKR7	F-box domain-containing protein	0.777	240-245	PKRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM32	Mitochondrial export translocase Oxa1	0.779	564-569	ARKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ99	Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment)	0.963	90-106	PRRRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS45	Nucleolar GTP-binding protein 2	0.93	654-668	KKHFKANKRRAKKVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSM3	Uncharacterized protein	0.892	533-573	NRRIRGRSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYQ2	Transcription elongation factor Spt6	0.995	83-94	RRRRRKKKRKNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYQ2	Transcription elongation factor Spt6	0.915	121-137	KTRFKRLKRGHKERVKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W643	Synaptic glycoprotein SC2	0.769	280-297	KKERRYRKEFGDKYKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7C3	Eukaryotic translation initiation factor 4C	0.935	3-16	KNKGKGGKNRRRGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7M5	Methylitaconate delta2-delta3-isomerase	0.995	445-500	KKEKEKKLKSLEEMVRMVKSKQRKTTLKAKDKKKQMEDNAKKAKAGKGNKGKQGRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBU1	WD domain containing protein	0.647	503-510	KKRADRAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCA7	Casein kinase II subunit alpha	0.894	75-85	KPVKKKKIKRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGI7	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	0.91	102-118	KAKKGPKTVKGRKTQKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP4	BRCT domain-containing protein	0.903	557-568	SKGKMKRGRKSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP4	BRCT domain-containing protein	0.823	252-268	RNPSPKVKIPPRSARKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJA7	ATP-dependent DNA helicase PIF1	0.619	198-200	KRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN03	Membrane-associated tyrosine	0.892	99-129	AKKKFSLRRPAGPFRSSPRTRSSNSKSPRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN50	Uncharacterized protein	0.76	557-562	KRRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPS5	HTH_Tnp_Tc3_2 domain-containing protein	0.611	152-153	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD8	Uncharacterized protein	0.997	132-153	AKKGKAKAVAKPKPKGKRAAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD8	Uncharacterized protein	0.756	85-98	SKAAASRTKGKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUD9	WAPL domain-containing protein	0.981	123-154	RKGPKKLAKAKRPSTKPEPTKATVIAKKLPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUD9	WAPL domain-containing protein	0.874	251-277	KAPRQMPVGKRKESAKEHQTKPREGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUL0	F-box domain-containing protein	0.629	286-288	KKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYR4	Uncharacterized protein	0.943	38-48	PKSKSKKKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZB7	Nod factor export ATP-binding protein I	0.803	1601-1618	KKTKKSGGWRKVLPFGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2Z5	Uncharacterized protein	0.866	310-319	KFKPKRGRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W9	ATP-dependent RNA helicase A	0.836	560-570	KRRAKGGRARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W9	ATP-dependent RNA helicase A	0.773	32-38	KPKKKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W9	ATP-dependent RNA helicase A	0.64	272-276	KKTRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6W9	ATP-dependent RNA helicase A	0.629	222-226	KAREK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W712	Uncharacterized protein	0.712	204-213	RAKKEERRMR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7Z7	Uncharacterized protein	0.649	44-50	GKTKKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9H4	Uncharacterized protein	0.872	105-116	PPPKPVRKRRRL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFU9	Uncharacterized protein	0.655	101-108	RKTSREKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGI4	SNF7 family protein	0.934	449-488	EAERTRKRLAELEAAEKKRRQRDAEQARKNEKEAEEARKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGI4	SNF7 family protein	0.829	29-41	RHKRKRALFRPKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGJ9	Ectonucleoside triphosphate diphosphohydrolase 1	0.917	409-437	KRKAAAQTFAKFFKPKHGKDPLHRRRGRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGJ9	Ectonucleoside triphosphate diphosphohydrolase 1	0.653	244-250	KGIKKNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQY4	37S ribosomal protein S5	0.727	34-40	RQARKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUG0	Striatin Pro11	0.618	359-363	RPIKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN8	Uncharacterized protein	0.999	365-394	PAKKTKKHRTPEEEKRKAEKKARKEKKRAQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN8	Uncharacterized protein	0.975	64-94	GVAKKKTKPSKKDAPALKPTPKAKVAPVKPA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN8	Uncharacterized protein	0.663	349-353	KQKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1I4	Uncharacterized protein	0.999	116-146	EEKQKIKREKRKGKDKEKDKEKEKEAKKKED
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W276	Protein transport protein sec16	0.965	1835-1848	ARKGPGPKKKKGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W276	Protein transport protein sec16	0.714	974-980	KAKGKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7I5	J domain-containing protein	0.777	154-168	KRRRRELTERREKQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7I5	J domain-containing protein	0.756	83-92	RARRREKALK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7I5	J domain-containing protein	0.636	99-104	RRRAMK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7I5	J domain-containing protein	0.611	427-429	KKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W913	Dibenzothiophene desulfurization enzyme A	0.985	3-28	KRKRENGSEAAKNGRRRSGRGKPGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W960	Calpain-B	0.987	567-604	KIERKKLEMKQSYERGKRLRKRAELREQKKAAKETRRL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB3	Uncharacterized protein	0.849	631-652	PKPKIRYRTLPAPSNPPKRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB3	Uncharacterized protein	0.734	463-483	KQQKSKTPPAKPIRSGFRQPG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB3	Uncharacterized protein	0.693	532-548	KPRVQKTKNDEKKSIRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB3	Uncharacterized protein	0.637	487-495	IARRVDRRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB3	Uncharacterized protein	0.631	667-672	PRKNAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBB3	Uncharacterized protein	0.605	674-674	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDB8	Uncharacterized protein	0.994	127-163	ARKPRRKTRPEHYEPGAHAPPLQKGKSKKTRRKKSKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDB8	Uncharacterized protein	0.904	229-238	PGVAKKKRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDB8	Uncharacterized protein	0.72	76-83	KRKVSRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE50	BTB domain-containing protein	0.783	13-30	KDRSGKITKQPKRSHRDA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGB9	Uncharacterized protein	0.994	212-227	KKTGKSRRRKKNKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHQ1	BZIP domain-containing protein	0.961	90-120	RPKPGRKPAKTEPESKRKAQNREAQRNFRQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ12	Integrase catalytic domain-containing protein	0.967	645-661	PRKRGRPPGSKNKRKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL93	Uncharacterized protein	0.789	29-41	KRPNSIQKKKKTG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLX0	WSC domain containing protein	0.912	471-486	KRRRHAHKHRRDREHG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNI0	C6 zinc finger domain containing protein	0.628	114-118	RQHRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQR1	G-patch domain-containing protein	0.756	171-189	GIDKKDHQKRRELGGASRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQR1	G-patch domain-containing protein	0.619	199-203	GKVRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQR1	G-patch domain-containing protein	0.603	167-167	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQR1	G-patch domain-containing protein	0.602	192-192	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR55	Phosphopantetheinyl transferase	0.717	64-73	GRKRDPKHGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSG3	Zn(2)-C6 fungal-type domain-containing protein	0.725	170-178	RHKKEIKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVJ7	Uncharacterized protein	0.994	83-106	KSRGKSPPKKKRTAAESKKFNKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXK5	Transcription initiation factor TFIID subunit 5	0.854	612-622	RRKKRMRGHGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W251	Uncharacterized protein	0.993	120-141	RMKKQEKRAKKRKKLAAQRAAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W251	Uncharacterized protein	0.849	275-306	NRKSTSKKKLTRAVSFKEPEKPSPKGSKQSAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2E1	Uncharacterized protein	0.939	126-153	RMRTRQRGERKRNGHSHASSKRRPSWKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7D4	Meiotically up-regulated gene 190 protein	0.783	1165-1201	KRAEERKHRGLMQWKPARNVKFAKDEAKIGLSKLKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB13	Glycylpeptide N-tetradecanoyltransferase	0.991	53-72	EKKKKSRKRKIKDALSGKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDF3	Uncharacterized protein	0.786	35-48	KSKKRRLQEERRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDF3	Uncharacterized protein	0.751	179-187	KTALRKKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGR7	Pre-rRNA-processing protein ESF1	0.986	481-501	RKERERKARRKERWQAKKAGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGR7	Pre-rRNA-processing protein ESF1	0.981	593-605	SEKAKKKGKKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGR7	Pre-rRNA-processing protein ESF1	0.975	538-553	KASKPESKKSKKAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGR7	Pre-rRNA-processing protein ESF1	0.908	654-701	GRKKRKQGKEGEEVEVERETKKSKKDVGEGEDDVRKLAKKIKAKSRGL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGR7	Pre-rRNA-processing protein ESF1	0.866	423-437	GKSSKTKKKSSAKRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH28	Uncharacterized protein	0.992	301-324	QAAKREREEKKAKKLAKKAAKEAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH28	Uncharacterized protein	0.969	429-460	REHWLKGRQVDKKNKKGLKPSARFGKMERRPH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH28	Uncharacterized protein	0.831	41-56	KRQRKAPAPRSSQKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH28	Uncharacterized protein	0.787	148-157	KRGRGRPRKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH28	Uncharacterized protein	0.7	288-294	AKRKARE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH28	Uncharacterized protein	0.694	381-403	EKLNRHIKFLERTEKPAKDVKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHP5	Cobalamin synthesis protein	0.726	5-20	KRRKTSGAEMKPKSKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJX5	Uncharacterized protein	0.887	322-354	GGRGGKNRKMGFPELKAILGPKEKQLAKRLKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK5	Autophagy-related protein 26	0.782	10-24	KISRRTSRKMKESRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK5	Autophagy-related protein 26	0.606	214-215	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRP7	PHD-type domain-containing protein	0.83	345-351	TKKKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRP7	PHD-type domain-containing protein	0.692	568-573	RARRRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV67	Uncharacterized protein (Fragment)	0.807	502-540	RIRGRSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVU8	Origin recognition complex subunit 2	0.985	165-186	SKRGRGRPKGSGKVGRPRKQRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWF2	5'-3' exoribonuclease 2	0.787	878-891	RGGFRGRGRGGRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWF2	5'-3' exoribonuclease 2	0.784	1063-1078	RGGRGGRGGRGGYRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXT9	Uncharacterized protein	0.694	155-162	PAKPAAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1G0	DNA mismatch repair protein	0.785	458-465	KKRKRLKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1G0	DNA mismatch repair protein	0.754	412-420	PRQPRKRRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2D7	Protein MAK16	0.999	300-325	NLKRKRPAGPPPKPKKKPSKGSKGPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2D7	Protein MAK16	0.938	132-161	EERLGERLVPRLAPKVRRREEGRERKALAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3N0	Ubiquitin	0.805	122-128	RPKKKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R5	Uncharacterized protein	0.665	97-103	KYRLKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7W1	Lethal(2)denticleless protein	0.662	35-40	KPKRPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W854	Phospholipid-transporting ATPase	0.99	486-508	KKKLIHKTRKKGKQPAKARKSFR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ0	Uncharacterized protein	0.62	1235-1237	KKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBJ0	Uncharacterized protein	0.612	2926-2929	RRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBL6	pH-response regulator protein palI/RIM9	0.953	308-367	PRGRGGPYRGRGGPPRGGPGGPGMYGPPRGGGFGPPRGGMRGPPPPGWNGGGRGGRPPNG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBL6	pH-response regulator protein palI/RIM9	0.863	688-703	GRGRGRGGGGRGRGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBL6	pH-response regulator protein palI/RIM9	0.658	178-182	KARKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCV0	IQ calmodulin-binding motif protein	0.833	470-509	EKKQSSFGRRIWKRLSRGGSEKDDLAPIEREAAKQKRKKW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGT7	Uncharacterized protein	0.986	46-214	KLKVDKREPQKLKVDKREPQKLKVDKRDPEPQKLKVDKREPQKLKVDKREPQKLKVDKRDPEPQKLKVDKREPQKLKVDKREPQKLKVDKREPEAEPQKLKVDKREPEPQKLKVDKREPEAEPQKLKVDKREPEAEPQKLKFDKREPQKLKVDKREPQKLKVDKREPQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH69	Uncharacterized protein	0.628	353-356	GRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH69	Uncharacterized protein	0.614	376-379	KLKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHF3	Uncharacterized protein	0.936	535-555	KLKAGARKKEMERREKKGGDA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL82	Uncharacterized protein	0.986	68-89	KGGKRDKKEGAKKEGGDKKKSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL82	Uncharacterized protein	0.93	7-33	KKSKAAAPKKPTQRVQRGARVIKPKKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM98	Uncharacterized protein	0.767	137-146	KSRKKPSPRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNF7	UBA domain-containing protein	0.942	294-304	EKKKRGRPKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNF7	UBA domain-containing protein	0.608	268-269	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNK8	Zn(2)-C6 fungal-type domain-containing protein	0.88	113-131	PSRRRGPPNRHAEAIKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ97	Uncharacterized protein	0.971	475-508	RPATKRRSPKQVPRNKPLAEKLPPRKRQKFLGPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ97	Uncharacterized protein	0.869	322-331	RRAKRGRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQP1	Pre-mRNA-splicing factor cwc25	0.999	165-252	EKREKEKKERERKHRHRDRSRDPEHKHRSRRDRERSRSRSPRRSEERAHHRRDRESHRRRSRSRSRSPYRNHNSRRHRSRTPRGRDDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTX6	U3 snoRNP protein Utp20	0.997	2564-2616	GLRERREERRRKRKVEAVVDPVKWGMEKRRRHDVKRVNRKEKGREERGKRRGW
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW83	Uncharacterized protein	0.821	26-36	RRRRPRPSRPQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWJ7	BTB domain and ankyrin repeat containing protein	0.958	1547-1569	RAAKAAARGRGQKGRSGRGGKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWJ7	BTB domain and ankyrin repeat containing protein	0.957	1608-1642	KHDGGGRAPGQENASRGGRGRIGRGGRPGGARGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWJ7	BTB domain and ankyrin repeat containing protein	0.639	1188-1191	RRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYT0	Uncharacterized protein	0.743	103-108	KRKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0H6	Ubiquitin/metalloprotease fusion protein	0.997	568-595	AKRIRTNEAKQEKKSKRRKVRAKRKTER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Q2	Sld7_C domain-containing protein	0.605	321-321	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W121	UDP-N-acetylglucosamine transferase subunit ALG14	0.87	38-48	RSKKRLPRKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W871	DUF4050 domain-containing protein	0.899	84-94	RDARRRRRKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDS3	Uncharacterized protein	0.921	477-493	RRKRRSFGGGRRRSSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEN6	Uncharacterized protein	0.961	9-24	AKKRNRAKNRQKRKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEU8	Dual specificity protein kinase pom1	0.974	55-111	PYRRKRTPSRSPSPYRRNRNADRSPSPYRRPRAEPAGSSSRGYKRKASPPRGHPDKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFG2	Uncharacterized protein	0.98	384-399	GRRRGRRRVMKKKKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFG2	Uncharacterized protein	0.881	423-445	PKKAKPAPKPATTAKGKNAVKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFG2	Uncharacterized protein	0.763	175-186	IRNKHIKRRTAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG50	Uncharacterized protein	0.971	162-188	RDKERKRRAEEREREKRETEAREARKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIL5	Uncharacterized protein	0.608	46-49	KTPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIW2	Zn(2)-C6 fungal-type domain-containing protein	0.707	618-625	GRDQKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIW2	Zn(2)-C6 fungal-type domain-containing protein	0.604	83-83	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNQ1	Uncharacterized protein	0.614	457-459	PRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WQ96	Uncharacterized protein	0.761	33-39	PREKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR29	Uncharacterized protein	0.692	213-222	KRERAIKRLR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD7	Serine/threonine-protein kinase bur1	0.897	526-559	RAYRDRAPNFGRDRRDGRTRSRSPDRRGDRGRDD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVE3	Uncharacterized protein	0.898	426-438	RPKNNRKPAKRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWU9	Uncharacterized protein	0.816	24-40	KRDKNGKKIIKIRQKPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXD3	Uncharacterized protein	0.8	244-260	KKGRAKSTKKPVSDKTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYD1	Defect at low temperature protein 1	0.882	137-149	RKEKEKSHKKKGH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W201	Uncharacterized protein	0.9	81-95	KAHPRRRGKGSVKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3U1	Zn(II)2Cys6 transcription factor	0.715	19-24	RKKQKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBR9	Zn(2)-C6 fungal-type domain-containing protein	0.7	299-307	PPRKDSKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBR9	Zn(2)-C6 fungal-type domain-containing protein	0.664	338-342	PKRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC30	Transcription initiation factor TFIID subunit 7	0.909	60-89	KRKYTKKPKIDESGNVIPPGKPGPKKRVRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC30	Transcription initiation factor TFIID subunit 7	0.872	318-329	KWARKRRFRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC30	Transcription initiation factor TFIID subunit 7	0.751	98-105	AAKRKPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEG7	Topoisomerase 1-associated factor 1	0.994	954-987	GPRKKLKRRRRERTPRELDDDEKERRAEARRKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEG7	Topoisomerase 1-associated factor 1	0.979	1045-1062	SKKRKADAPAKKTKRRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEG7	Topoisomerase 1-associated factor 1	0.959	566-580	RSKRRARNIKKKKAD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEG7	Topoisomerase 1-associated factor 1	0.807	336-347	KKWNKPRRPGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF45	60S ribosomal protein L7	0.985	21-49	KKRKSQEKAREERAIATREKRDKNKKKRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGA2	Multisynthetase complex auxiliary component p43	0.986	242-259	EKKKKEKKEKQPKPQKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGA2	Multisynthetase complex auxiliary component p43	0.88	159-169	KAEKERKKKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH81	Lipase_3 domain-containing protein	0.933	9-29	RKSRKKQSSKTSRKRSSSRKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH81	Lipase_3 domain-containing protein	0.606	462-463	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKH3	40S ribosomal protein S25	0.948	8-23	GKKQKKKWSKGKVKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD0	Uncharacterized protein	0.612	22-25	RPSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLF2	Nucleolar complex-associated protein 3	0.982	347-372	GKKLKQKREFRTKRTRKELKEKKAIE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLF2	Nucleolar complex-associated protein 3	0.821	49-60	PRKLKKQKENKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNA2	Uncharacterized protein	0.789	15-25	RRRKSRATKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQL0	C2H2-type domain-containing protein	0.84	486-504	RKHEWDKHKIPDTKPKKRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWD4	Uncharacterized protein	0.824	370-388	GGQPRPKRVRNPVPPARKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW7	RNA exonuclease 3	0.999	153-174	KKLGDGKKRKKRKKRKKLEDGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW7	RNA exonuclease 3	0.937	241-261	KVRKAKRLVRRNNPPGTRRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW7	RNA exonuclease 3	0.921	762-770	PKKKKKPKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZX2	Uncharacterized protein	0.986	46-60	PAPKSKKKKQKERRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZX2	Uncharacterized protein	0.964	162-185	KLRESGAGKNAIRASRRKKKAEIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3B6	Translocation protein SEC62	0.994	320-346	KAKKAAKKEKKAAKLAAKAASAKNKKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W565	HMG box domain-containing protein	0.994	187-205	KGKKRKREKKEKDPNAPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W565	HMG box domain-containing protein	0.994	446-476	EKAEKAEKAEKAEKAEKASKEKKRDRTKRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W565	HMG box domain-containing protein	0.874	388-398	KKDSKKKKEKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W565	HMG box domain-containing protein	0.817	421-430	GGKKKKSSRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W565	HMG box domain-containing protein	0.623	332-334	PRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W966	Uncharacterized protein	0.986	350-399	TKRQARKPDAASKSTKALKPAVPKTSSRKAPAKVAPPRPKAPTKPQPSKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA10	Mitochondrial Rho GTPase	0.97	405-416	TKARKRRRKPGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAM4	Mating-type protein MAT-2	0.977	193-208	PRKPGEKKKRQSRKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAS8	Heat shock protein 90	0.787	246-255	KKEKKTKKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF22	Uncharacterized protein	0.969	502-520	ARRIANKARKKRARSGQKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG55	DH domain-containing protein	0.613	1188-1189	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIW4	Uncharacterized protein	0.99	19-32	VGVDKKKKKKKAKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIW4	Uncharacterized protein	0.855	83-112	GRHKTEAERRYDEMRRKRLEERMRKEGVKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJL9	NOL1/NOP2/Sun domain family	0.913	338-348	KADKGKKRKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJL9	NOL1/NOP2/Sun domain family	0.875	543-551	KWKNKKRKH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM01	Histone acetyltransferase	0.888	377-391	PRRRKISQRRKEAKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQK6	DNA polymerase	0.835	114-129	KPRSGLAAKGKGKLKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTL8	CCAAT/enhancer-binding protein zeta	0.967	17-43	PSPDKNRVSAKGDKKDKRKPVEEKKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTL8	CCAAT/enhancer-binding protein zeta	0.965	857-871	KKDKDGRKSKKRKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTL8	CCAAT/enhancer-binding protein zeta	0.958	721-738	AGKAKQADKKTKKKDRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTR9	DNAJ domain containing protein	0.98	193-212	KKPEAADGTKKKKKKVKALG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTR9	DNAJ domain containing protein	0.906	145-169	KAAMREEGRAQKKEEEEMKERKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUK1	Uncharacterized protein	0.695	17-21	RRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVK8	Uncharacterized protein	0.978	4-20	KKRKRGEKNGERPKKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVK8	Uncharacterized protein	0.764	431-439	GPRAKKRSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVW3	Membrane-bound O-acyltransferase domain containing protein 5	0.921	195-208	KAPPTRKKRKIPRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW93	RAC-alpha serine/threonine-protein kinase	0.909	522-537	RKKGRDRSPKAKERGV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1F6	Uncharacterized protein	0.979	296-307	PKKKKAKSKKKQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W407	Uncharacterized protein	0.927	632-644	RKKRGPYKKKIKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W426	TatD DNase family Scn1	0.956	235-255	SKREQKKRRLEHPKAKAKVEA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEC9	Uncharacterized protein	1	87-100	KKKKKKKKKKKKKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEP0	Uncharacterized protein	0.988	221-241	KKGKGKAKAAPSKPKKADKRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGL1	Uncharacterized protein	0.841	189-208	KTLREKRGKLAREVREIRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGL1	Uncharacterized protein	0.663	583-589	RTRRWRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJS2	Uncharacterized protein	0.946	18-32	PRKRRRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLD2	40S ribosomal protein S24	0.989	103-134	KASRQQRKQRKNRMKEFRGTAKTKGGAKKDKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNS3	DNA damage-binding protein CMR1	0.951	49-76	VSSKSKTKKSAPKKIKQEEAAPRRTSSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTU7	Integrase catalytic domain-containing protein	0.958	1080-1096	PRRRGRPPGSKNKRKAH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTU7	Integrase catalytic domain-containing protein	0.807	434-472	RIRGRSRGGGGFRGGSRGAYRGGEQRDDNGRGFKPRWRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTU7	Integrase catalytic domain-containing protein	0.698	1236-1246	KAEFRSKPKAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUA0	DIL and Ankyrin domain containing protein	0.949	487-512	RSKPKAKPVEPLEKRFRPPSPKRRAQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VUE4	40S ribosomal protein S1	0.952	5-19	KNKRLSKGKKGLKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV93	Uncharacterized protein	0.669	553-561	RVEKKPGIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWY1	Pre-mRNA-processing protein 45	0.823	217-231	KFKHKRIPRGPPSPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXM3	Peptidyl-tRNA hydrolase domain containing protein	0.853	178-196	RRLKHKKQQSAKKTSRRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ82	Uncharacterized protein	0.97	171-223	APPRGPRSKVSHHERTSSRHAAPVPDPPSRHESHSRSRSRSKLERVRRPRRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ82	Uncharacterized protein	0.897	912-921	PARKDTKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ82	Uncharacterized protein	0.784	651-678	EEIRKAHEKAREEAEKKAAAEAEELKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ82	Uncharacterized protein	0.636	553-557	RAKKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5W5	XPGI domain-containing protein	0.877	331-340	PAKKRGRPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC73	Uncharacterized protein	0.806	99-112	RQRSRRRELRGRPT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC73	Uncharacterized protein	0.622	601-604	KKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHF2	GRAM domain containing protein	0.97	70-87	SHRRRMSKLFKGRKKRRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHF2	GRAM domain containing protein	0.942	1048-1063	TAKMPGKGGKGKKRSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJZ7	Protein SDA1	0.991	692-755	KRKEKKEAEGKSTTNKEKARKKNFLMTLGKAKSKNKRSLGDVKKTLLGHVERKKRGGKRGNKGN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJZ7	Protein SDA1	0.99	259-287	GINKKSKKKARDLKHAAVSLKKKEKKKHA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL02	Chitinase	0.722	816-823	KKKPKPTS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VV79	Poly(A)-specific ribonuclease	0.917	406-423	KVKRNQRRHKSKAKSESK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYT1	Nucleolar protein 58	0.999	500-571	KTAKVDPKKAAKEAEKAAKKARKAEREAKREAKKAKKAAKESKKSDTKESKKRKADGGDDGEKKKKKKKSKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYT1	Nucleolar protein 58	0.697	460-467	SKKAKAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W285	Uncharacterized protein	0.836	4-19	KRKPKAAKAVSATPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W285	Uncharacterized protein	0.666	235-243	GRRLPGRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W285	Uncharacterized protein	0.638	179-182	KKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W372	Mitochondrial chaperone bcs1	0.711	636-641	KKKGKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5B4	BTB domain-containing protein	0.805	17-35	KHRASKSKSSKKNPSFKES
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6D2	Uncharacterized protein	0.606	410-410	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6E2	Nascent polypeptide-associated complex subunit beta	0.875	18-31	GKGTPRRKVKKVHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z4	RRM domain-containing protein	0.998	1292-1305	APKKKKKPKKKKTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z4	RRM domain-containing protein	0.995	1108-1140	KSKSQSKKEKEAKKKHQKKEADRIAKAKAEKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z4	RRM domain-containing protein	0.889	284-300	KKRTGTRKNNKRTRPRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Z4	RRM domain-containing protein	0.8	789-805	RQQKSPTKNSKAKSKRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8M1	HUN domain-containing protein	0.997	54-104	TARGEPRKKPGPKPKNKDPAAPEPEKKTRKPRKSEPKDPNAVPVQRKRRTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8M1	HUN domain-containing protein	0.969	525-564	RRGRGRGRGGTLRGETSGRGRGRGGGPGSRGGSTVRKPRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8M1	HUN domain-containing protein	0.934	465-473	GGKKRRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8T9	DNA helicase	0.995	1341-1408	AKAPAARGGSKASGSGYRKKGPSRKRASGSFGKSFGGVKKRAPKESGSRASGGASAATKKPPAGGSKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8T9	DNA helicase	0.948	356-379	KSRERSHRIPETPERRRSPKKPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8T9	DNA helicase	0.935	1036-1055	SSPRKARAKAPVVKKTKKQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9F5	ATP-dependent RNA helicase MAK5	0.985	697-713	EAKGKRGRGSGRKKKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9F5	ATP-dependent RNA helicase MAK5	0.967	137-156	KTEKKKRAKEAKLKKLEEEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH57	Uncharacterized protein	0.999	209-245	KDKSKKSESGSEDSKKQKKKTKKEKRKEEKKEEKKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM07	Uncharacterized protein	0.744	200-208	RRQKKEKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WN92	Integrase catalytic domain-containing protein	0.899	779-793	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNX9	Uncharacterized protein	0.821	234-260	EKKTPVKPGQPKPFKPPVESKKLDPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VS16	Protein yippee-like	0.701	120-125	KRRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWN7	C3H1-type domain-containing protein	0.871	475-494	PRPKVHRGKYNKLKGGKHGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWN7	C3H1-type domain-containing protein	0.652	373-380	RIGRRPAD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN9	Anucleate primary sterigmata protein B	0.888	154-163	KPKKKPKKLE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZR9	Uncharacterized protein	0.944	76-106	KDKRRTRARPAARPAPAPAPRIEAPVPRPIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1T3	Acetyltransferase	0.706	625-632	RRRRLAKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1T3	Acetyltransferase	0.613	636-640	PKLPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8M2	Uncharacterized protein	0.829	163-176	KKTAKRPAKQAKKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9R4	Zn(2)-C6 fungal-type domain-containing protein	0.814	18-28	SSPKRKKVRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WEA6	Uncharacterized protein	0.796	183-202	GKGSARTPKPSSPKVPRPKI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF41	Cyclin-dependent kinase G-1	0.947	17-31	RRKKEKEEKKRLKLQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF41	Cyclin-dependent kinase G-1	0.934	401-418	KAGQEKRRKKSPTAPKRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ93	BRCT domain-containing protein	0.941	87-116	RRYKWEVLTKERRTRKELKRLGKAADGKKF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ93	BRCT domain-containing protein	0.814	138-146	KRKPRKNKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL80	Uncharacterized protein	0.998	152-187	APRGRGRGGRGSRGGRGRGGRGRGSRGGRGRGGIAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL80	Uncharacterized protein	0.92	599-625	RKRGRPAGSKNVARRSDYGIKKGPRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL80	Uncharacterized protein	0.916	746-776	WWAERKAKKREQDEKEGKPVKPTSRSNSSSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL80	Uncharacterized protein	0.882	727-742	GSRRKPRVKSEKRSQS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL80	Uncharacterized protein	0.784	523-538	KKHNGWGGARKKGVSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WL80	Uncharacterized protein	0.677	501-507	KRQRKAT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM20	Uncharacterized protein	0.999	610-629	RRKAREAVMAKKKKKKKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMA5	Uncharacterized protein	0.864	87-99	KPKKTRGKKPEDP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQX5	Asparaginase family protein	0.909	411-423	IRRHKKTKSGSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSS5	Uncharacterized protein	0.771	283-291	KKRAPKRLL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZK5	NEDD8-specific protease 2	0.707	229-238	IEGKRRSSRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M5	Uncharacterized protein	0.986	403-452	GGRGRGHSGGDRGGYRGRGRGGPRGEYRGGRGRGRGEFRGQRGGYRGPPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2M5	Uncharacterized protein	0.775	18-25	SARKKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7F9	Rho-GTPase-activating protein 5	0.87	807-825	KRRHEHRDRADKKERAKSP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8G9	HAD_SAK_1 domain-containing protein	0.984	449-509	RGGRDKDDRPGGYRGGNRDRGRGGNRNPPFIPRGGARGGHRGDRGGGGGGGGGGRGRGRGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAB4	Uncharacterized protein	0.631	139-141	RKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBI6	Zinc finger protein 585A	0.92	379-392	RKELRKAAKSKKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDD7	Helicase SWR1	0.92	458-467	KGKKKARKPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDD7	Helicase SWR1	0.781	334-349	PRKRGRLVKGTDRKGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDW9	Uncharacterized protein	0.968	317-332	REDRRRRRREEKGAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF95	Brr6_like_C_C domain-containing protein	0.922	170-204	PTKDRDKESPQKPYSKKAENRIVKRRSERSQSKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF95	Brr6_like_C_C domain-containing protein	0.609	154-156	ARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG06	Uncharacterized protein	0.995	738-754	TKKKRTKGKGKGKGKKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG07	Uncharacterized protein	0.815	214-226	LYKKKGEERRKSI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP9	Pex24p domain-containing protein	0.914	509-531	LRRAWEDSKPSRKGEWRRRRWVR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIP9	Pex24p domain-containing protein	0.853	485-500	KAKLKKRGSSKGGSKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM68	Uncharacterized protein	0.917	1137-1154	ERKRRKQLAKKSMKNIRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM68	Uncharacterized protein	0.759	1071-1080	GRRSRHKRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM96	Uncharacterized protein	0.785	200-212	QRRRPRGPSWRAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMU2	Origin recognition complex subunit 4	0.97	169-194	AKRAKRTPAAPTRKPAASRANARKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMU2	Origin recognition complex subunit 4	0.914	7-37	SSKRRKLDTPKRIESKAAAKASTRKASGRLA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMU2	Origin recognition complex subunit 4	0.892	124-147	KPIAKRGKGRPTKAETASRNAAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMU2	Origin recognition complex subunit 4	0.761	219-234	PKPRSTRKPAASTRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMU2	Origin recognition complex subunit 4	0.73	54-63	KPAPARKGRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPI7	Uncharacterized protein	0.612	157-160	KGHR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTZ1	Uncharacterized protein	0.886	8-47	KRAKQRRRDLMKQKSRIYNQVEPRILRPSAKKRLKLERSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU34	DNAJ heat shock family protein	0.666	181-189	KGGRFRGGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W159	Uncharacterized protein	0.973	164-221	FSPGERGRRRTRSRSRTRSARTQRSQENVRGRLPRNMSGSLRSRSRSARRHHHERPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W159	Uncharacterized protein	0.968	108-138	PSRSRSPPRKKHDGPRHRANDDKTVRKRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W159	Uncharacterized protein	0.881	252-293	KWGASPPLKREPSRSPPSFRGSRNRSPSPYSKRKAAAAAVAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W159	Uncharacterized protein	0.652	80-87	KKEEERKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1S5	SAP domain-containing protein	0.784	347-355	KKKTPRRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1S5	SAP domain-containing protein	0.613	291-294	PPRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1T5	Uncharacterized protein	0.743	277-285	NPRRRQRKD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1T5	Uncharacterized protein	0.63	293-296	RSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2X0	MMtag domain-containing protein	0.999	127-247	TKTKKREKKERSRRHRDDDGERRRRHRSRSHSRDRERRHRHRERSRSRDRRRDGDRDDGRRHRSRSREHKRREDRPDRSKRPERRRERDVDEKRSQSRSRDHRRRVTRSRSPYERSERRRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6B8	DNA-binding protein SMUBP-2	0.984	1929-1954	KAKAKIRRRPRPPQDPFIKNKKPKSG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6B8	DNA-binding protein SMUBP-2	0.787	945-967	KRKRIQEKERAEKERAALVAKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R4	Uncharacterized protein	0.985	212-223	GKKKKAKKNKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R4	Uncharacterized protein	0.692	158-166	ERRLKRLQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R4	Uncharacterized protein	0.689	241-247	KKKRGER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R4	Uncharacterized protein	0.659	71-74	PKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R4	Uncharacterized protein	0.655	39-43	KGKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6R4	Uncharacterized protein	0.606	85-86	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9M7	Uncharacterized protein	0.98	14-45	KKVKGLKDHKKAQKEKNAAKRLAAAEKAKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB49	Integrase catalytic domain-containing protein	0.902	994-1008	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCY0	Uncharacterized protein	0.981	358-381	RLKKLKEERKKKLAAMAAKMKRKF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCY0	Uncharacterized protein	0.849	186-227	KDATKPLAPPIKHEPTKILSRKERLALKAEASAGAKGKKAVG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDX1	Mitochondrial genome maintenance protein MGM101	0.636	288-291	KKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF16	NADPH oxidase regulator NoxR	0.768	434-452	KSSRRRSPARSTRSGGSTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WF16	NADPH oxidase regulator NoxR	0.743	353-371	RSDRSQRGSQRERERSRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFC6	Uncharacterized protein	0.834	47-55	KKKRRAARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJ48	Uncharacterized protein	0.893	169-187	KKKRKSGLRNVFRKMFGRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKV4	Uncharacterized protein	0.786	897-904	KEKKAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNA6	Uncharacterized protein	0.698	121-126	KKKAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPU1	DNA repair protein Rad7	0.998	389-419	RVRKRKRNQEDAIAKIKKGKAAKKVPKKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPU1	DNA repair protein Rad7	0.944	480-498	DAKAEKKASKPVVRKGRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VT56	60S ribosomal protein L27	0.754	55-67	RMSKNKQAKKSKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK7	SLD3 domain-containing protein	0.718	445-450	KKRKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK7	SLD3 domain-containing protein	0.708	553-562	KEPEIKKPRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK7	SLD3 domain-containing protein	0.665	536-543	KRKAMKPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK7	SLD3 domain-containing protein	0.623	356-358	KKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTM5	Integrase catalytic domain-containing protein	0.902	1034-1048	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW96	Amidohydrolase	0.774	794-805	PALKRQRPSRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VW96	Amidohydrolase	0.75	671-677	PKKRRRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0H3	Uncharacterized protein	0.716	18-29	PPDKRSRPPEPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W122	KOW motif domain containing protein	0.842	9-39	GRNAARQAKKLKEIQKVKHAIQWHERERKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W122	KOW motif domain containing protein	0.604	426-426	R
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4D7	Clr5 domain-containing protein	0.988	99-120	RAKRTDGRVKKTKPKKKAKVMP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4D7	Clr5 domain-containing protein	0.926	202-213	WRTRKRRRRTRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAP5	Uncharacterized protein	0.879	335-358	RSTRLKLAKQLKEQEKGKGKGKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WE52	GTPase-activating protein GYP3	0.948	1051-1071	KAIGHGLRRRASRKFRKMGMK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFU6	Uncharacterized protein	0.98	930-946	GKFGGRLEKKKKKKTRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFU6	Uncharacterized protein	0.937	853-871	KQRKKIERREKRQQRKTER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFU6	Uncharacterized protein	0.8	67-82	KRSKTKQRTGVRKRIK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTV4	Phospholipid:diacylglycerol acyltransferase	0.8	52-59	KGKHKKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXQ4	Transcription factor RfeD	0.93	224-251	LKPNRPRKSSVGQHARRGKHERQRSREF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ33	U1-type domain-containing protein	0.967	183-197	EKRRLRNEKRRAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZ33	U1-type domain-containing protein	0.72	29-45	KKAKDREAKERDEGKER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2F2	General transcription and DNA repair factor IIH	0.886	84-94	RKRKRLRKDTK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W412	ISWI chromatin-remodeling complex ATPase ISW2	0.969	150-171	TPKRGRGRPKKQDNKGNAKLKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7Z1	Uncharacterized protein	0.876	578-603	QIPRREAQKWLHEEARPKRERKIQRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCM5	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.977	732-748	KGHKKKRSTKRKGPRVL
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCW1	Uncharacterized protein	0.859	104-115	RNYNRKRRARKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFQ1	60S ribosomal protein L36	0.98	66-90	RNSKDKRARRLAKKRLGTFGRSKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFQ1	60S ribosomal protein L36	0.623	32-34	RRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH67	AAA domain-containing protein	0.991	966-981	KDRKKRKAVKKGKSRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH67	AAA domain-containing protein	0.984	923-941	RRKKSKEESKKSKSKAKKT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH67	AAA domain-containing protein	0.805	894-902	KGRRRDKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH67	AAA domain-containing protein	0.701	803-808	KKKSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJM8	Poly(A) polymerase	0.982	528-545	RPKPSKDKKKKKDAKSVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLK4	Uncharacterized protein	0.854	356-364	KKKKSKKSN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLK4	Uncharacterized protein	0.692	136-148	PKNKRLHAISKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPY4	Reverse transcriptase Ty1/copia-type domain-containing protein	0.899	69-83	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRL1	Uncharacterized protein	0.812	544-573	KKMKHAPVPTPKKPASASKLSGHTPGRRTN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSC5	Uncharacterized protein	1	451-520	KSLKRQQKQKDKSKQEWKERLTNVDQGKAAKQKKREENLRKRKEDKGQKGKKKAVKKPGKKVKRPGFEGT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSC5	Uncharacterized protein	0.997	143-172	AKAELKAEKRREKRKEKQAKNKQKLEAKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSC5	Uncharacterized protein	0.982	290-328	RAARKADGPDGRPARNRAELIETRRKKEAERKAAKKAQR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSC5	Uncharacterized protein	0.69	392-396	KKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSC5	Uncharacterized protein	0.602	522-522	K
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSX3	C6 zinc finger domain containing protein	0.916	6-17	RPKKKRRGGTRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWB5	Uncharacterized protein	0.948	421-435	GRKKKAKKPTANPKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWB5	Uncharacterized protein	0.92	376-398	IGSAPMRKKTKSQAKKDRQERKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2C5	Spindle pole body component	0.733	64-98	ERRTEKKEVRERETETRRTRSPLKHSSESRNARTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA11	Catabolite repression protein creC	0.727	172-178	SKRRKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC70	Nucleolar complex protein 4	0.971	12-36	VKRKRDPSKPERSESKSKSKSRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGM4	Uncharacterized protein	0.867	410-418	KERRKKKVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRF5	Transcription initiation factor TFIID subunit 8	0.864	259-268	GKRKRSRRMK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRQ9	Uncharacterized protein	0.645	56-67	PPSRKLVPPPSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSG8	Uncharacterized protein	0.917	490-502	RGERSKKKRRFRS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVI2	Pre-mRNA-splicing factor prp1	0.718	116-122	KRRRARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXR1	Structural maintenance of chromosomes protein	0.976	100-119	RRAASPSKAVPKKRGRKPRA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXR1	Structural maintenance of chromosomes protein	0.938	52-79	KTGRGRGRPKKAPAQDAEATPKPAARRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1S3	SPX domain-containing protein	0.609	529-530	KR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W3R4	Uncharacterized protein	0.766	231-238	RRRKRKDR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6B3	Phospholipid-transporting ATPase	0.94	228-243	RAIKSAKGKKGGKGKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6B3	Phospholipid-transporting ATPase	0.705	32-47	KAENKRHSLKERLHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6X8	Translation initiation factor eIF4B	0.818	383-403	LRQKKEADDKAREEKKAKEAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7G5	U1 small nuclear ribonucleoprotein 70 kDa protein	0.774	66-76	RDRKKLEKKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7Y6	Urb2 domain-containing protein	0.888	163-172	KPSKKRKRGT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC64	54S ribosomal protein L49, mitochondrial	0.719	200-211	TKRRQRHTKHVK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDS7	Uncharacterized protein	0.793	40-47	KKDKKKHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJG9	Histone deacetylase	0.892	489-504	SRRKKERNVGGRGERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJR5	Autophagy-related protein 27	0.844	212-225	KKEGKLRRREEKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLJ4	CID domain-containing protein	0.866	397-417	RPRRSRSPRDRTRNRGMASPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQL5	Uncharacterized protein	0.884	167-188	KSLPRRRNKRPATGVPPGLEKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VQL5	Uncharacterized protein	0.748	51-69	RRQLKKHRNIIPPVKSRKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU48	Uncharacterized protein	0.684	468-474	PGPKPRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU48	Uncharacterized protein	0.653	25-37	NKTPGRQSQRKPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU48	Uncharacterized protein	0.608	15-16	GK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX13	Uncharacterized protein	0.981	44-67	RNPARRTKRRKIHRGRNLRLVHRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXL3	Histone H1	0.997	209-267	GKTKSGRVTKTKAPATASPKAAKATKKAPAAKKAAPAVKKATTPKKKATPKKATPKAKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXL3	Histone H1	0.989	84-193	PKGTSGPVKLAKKEAKPAAAATTKKAEPKAEKKTTEKKTVEKKTTEKKVPAAKKATATKAKAATTTKAAAAPKKAVGRPKKVTAAAATTTTKAAPAAKPKANASKPRKAA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXN3	Histone H2B	0.986	12-46	GGKAPAGKAPAEKKEAGKKTAAPSGDKKKRTKTRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4R1	Uncharacterized protein	0.652	65-69	RRRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W687	DUF262 domain-containing protein	0.723	783-789	SKPRKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8U1	Uncharacterized protein	0.944	37-46	HKKKHRKKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W8U1	Uncharacterized protein	0.841	91-116	KRVERQRLKEMREVKRAEKAAERARK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WA42	Integrase catalytic domain-containing protein	0.902	839-853	PRKRGRPPGSKNKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAK6	Phosphodiesterase	0.836	571-579	ERHRKRKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB55	Uncharacterized protein	0.961	421-450	RVAKARQERRKEKRLQQAAKAKEDEKKRQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WB55	Uncharacterized protein	0.683	552-560	KKKAAEKKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX3	DNA repair protein rad5	0.989	327-362	PSGRAKGKAAAKPANAKAAPRKAANSGGRGTAKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX3	DNA repair protein rad5	0.882	972-984	RGTRGGAKKKKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX3	DNA repair protein rad5	0.78	310-316	RKKKKGA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFX3	DNA repair protein rad5	0.731	829-838	KKKTKNKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIZ7	Beta-N-acetylhexosaminidase	1	716-750	KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WLQ2	ULP_PROTEASE domain-containing protein	0.838	379-390	KNKNKRKPVPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WP30	ANK_REP_REGION domain-containing protein	0.729	480-489	VRKVERKARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VR85	Branchpoint-bridging protein	0.795	58-66	PRQRKKRNR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVY9	Uncharacterized protein	0.978	138-150	RKKKEKPAKRRRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVY9	Uncharacterized protein	0.757	505-511	ARKRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVY9	Uncharacterized protein	0.654	68-73	KLGKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VZM0	SAM and PH domain containing protein	0.973	269-289	RNNRSKSKGRKASRRDKSRGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W192	Methionyl-tRNA synthetase	0.998	573-604	ARKAKEEKARKAAAKKADKERKKAKKAAGPEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1I8	Uncharacterized protein	0.937	444-462	IRKAIRESRSLRPKKKPAG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1I8	Uncharacterized protein	0.881	187-208	EKLAEAEKRRLEYKRNPRRPRT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1I8	Uncharacterized protein	0.718	163-183	AKKIAEDMKERKAAEERRYRV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2J4	Uncharacterized protein	0.994	116-140	KRKRYRYRNLNRKKMEKRKERKKAS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7M9	Uds1 domain-containing protein	0.906	359-372	RGRPKRRNSKRERS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W9W7	Chromo domain-containing protein	0.992	102-122	GGRPEPKGRKRKGRRSIAGPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAR8	37S ribosomal protein Rsm22	0.982	795-809	RKIRGSKGRKGRKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAR8	37S ribosomal protein Rsm22	0.952	729-753	PRNVRLGRPSDEFDKKGRKVKKAKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW8	Uncharacterized protein	0.998	1392-1411	VKKKKGKARPAAGKKKRKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBW8	Uncharacterized protein	0.994	1244-1298	AKARAAKAAKQAAKRRGEESTEPTSRLRSGPLQARKAATGKPGRKKVTKPRGKGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WER7	Uncharacterized protein	0.976	190-206	KLERRRQRLEKKRAKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFQ4	Uncharacterized protein	0.999	319-351	KKKKKKKKKAMDADTKPRDKRYEKLQKKLGKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGI0	Uncharacterized protein	0.935	8-26	AANKRQPDKKMPRKRGVKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WH58	Uncharacterized protein	0.707	456-467	KKLSAKAAGKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD2	Uncharacterized protein	0.981	51-71	PRKERRRRRRIPQPETRNKRI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VSD2	Uncharacterized protein	0.882	110-120	KAKGKKQKRKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTB8	U1 snRNP-associated protein Usp104	0.846	576-619	EKESDRRDRSRRDDRDRDRDRRDRDREYRNGHSDSHRRHRTRTR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTB8	U1 snRNP-associated protein Usp104	0.68	375-382	RIKRRIER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTK1	RNP domain containing protein	0.991	13-49	RSPRRRSRSPRRSRRSYSPRSRSRSREDYRRTERRSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VU23	BRCT domain containing protein	0.717	608-615	NKRAKKDK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVV8	Myb_DNA-bind_7 domain-containing protein	0.981	313-327	PAAPKRAKKPRKPKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVV8	Myb_DNA-bind_7 domain-containing protein	0.962	354-364	RRKPKPRKRRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVV8	Myb_DNA-bind_7 domain-containing protein	0.947	683-694	NGKGKKKRGKNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVV8	Myb_DNA-bind_7 domain-containing protein	0.911	288-302	RKRPGIKSRTKKKAT
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVV8	Myb_DNA-bind_7 domain-containing protein	0.87	247-259	RKPRQPPRPRAKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVV8	Myb_DNA-bind_7 domain-containing protein	0.859	383-393	REKKRRGRPPR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VVV8	Myb_DNA-bind_7 domain-containing protein	0.854	31-46	KKFAPKAARRRPGAPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWB4	Uncharacterized protein	0.995	337-367	KAPKPAEAPKRKGKDKEKEKEKDKSPRPTKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWB4	Uncharacterized protein	0.927	750-760	KSKKKGKKHRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWI5	Uncharacterized protein	0.999	64-137	RKAQIRERVKHQEEEAEKPQKAQKRELKVANTLYKRKMAEEAKALREKVRKKPGQKSAKRRLKPPRGGPKKSKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VWI5	Uncharacterized protein	0.916	33-42	RKKHKKRSKP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5J6	Uncharacterized protein	0.978	204-219	GRRKKPRRGKMSQEKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P3	Uncharacterized protein	0.997	291-305	KMKKPKKKKSKKSKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P3	Uncharacterized protein	0.964	75-99	LAKLRREERAAKIKKEREKASRFAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P3	Uncharacterized protein	0.902	364-374	QKALKKRKKIR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P3	Uncharacterized protein	0.779	121-130	SKKRQKKIAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5P3	Uncharacterized protein	0.691	428-432	RKRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD98	Restriction of telomere capping protein 4	0.971	60-101	KPPPPKELKPILAPKAKAKEDTELERPPKRPAKKGVIRAPAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD98	Restriction of telomere capping protein 4	0.919	147-173	RKGYGSKPKNIHAPPPRKFGKPAPKIA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD98	Restriction of telomere capping protein 4	0.622	231-233	KKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDY5	Uncharacterized protein	0.819	495-505	KIKRKKASAPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WFL5	Uncharacterized protein	0.955	3-21	PRKKANKRAVKPPNPRKRH
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WGC6	Vacuolar ATP synthase subunit D	0.826	35-49	KRKKITRRIDEAKRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRV2	Uncharacterized protein	0.636	795-799	RRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXE7	Kelch domain-containing protein 4	0.994	3-35	KDKKKAAAGGKAAAKAAKAAKQEKKAGKKDKKV
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXJ5	Uncharacterized protein	0.606	140-142	RAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXR3	Transcription factor TFIID complex subunit Taf111	0.778	446-453	VKRKHKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXR3	Transcription factor TFIID complex subunit Taf111	0.674	957-965	RREGREKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYK9	CTR1 suppressor protein	0.813	715-729	RRLKDGVKQRTRKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYS7	Transaldolase	0.927	494-513	EEKREEKEEERKHRKHRSSR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VYS7	Transaldolase	0.632	292-296	KSHRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0M4	SNRNP27 domain-containing protein	0.996	8-122	RDRYRERDNRREPREARERGGTPTERRNRSRSPRERGGRRDAPRYRSRSPFRRDDHESGGRGSDRSRGGHDRGRGRDDRRGGRDDRANAGDRSPQPPKGPRGGIRGPFGGAAKPP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1P3	Transcription factor 25	0.999	86-105	KPSKKSKKKKKKAKNKGKEK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5N4	Uncharacterized protein	0.702	65-70	KKPRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6F1	Uncharacterized protein	0.616	286-292	APPPARR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6V5	Elongation factor 2	0.611	1075-1076	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7I6	tRNA pseudouridine synthase B	0.98	416-459	AKKKGRLAEEREEDRERSYRGGGRNKWNKGKGKYSRGGGGGRRD
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W7I6	tRNA pseudouridine synthase B	0.765	238-245	RKGRKRER
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WAC1	EF hand domain containing protein	0.632	53-56	RRRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WD99	Uncharacterized protein	1	15-44	SANIKKKKKKKKKKKKKKKKKKKKKKKKKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDI7	Uncharacterized protein	0.947	21-51	RSAMDRGSKIPDKRTKVIKKQKKGVTPHKTS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDQ2	60S ribosomal protein L3	0.955	17-39	LPRKRAARHRGKVKSFPKDDPKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDQ2	60S ribosomal protein L3	0.671	238-245	KLPRKTHK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDR8	Pre-mRNA-splicing factor cwc26	0.974	208-233	AKKRAEAQKKAEEEERKKREKEKAAR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDR8	Pre-mRNA-splicing factor cwc26	0.97	19-29	KKSKKRKRKNK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WDR8	Pre-mRNA-splicing factor cwc26	0.83	84-91	KKSKKKPK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHD0	SCA7 domain-containing protein	0.999	125-207	KKQEKLKKKKEAKEAKDAALRKEKGEDDEGGKSRKSAIKGASIDGDGAKKGKKRKLDGDAEKAPNAKKKKKDEPKQKGAKPKG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WHD0	SCA7 domain-containing protein	0.906	34-51	EKTRIKLKIKKPVPKPSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WJN4	Uncharacterized protein	0.86	81-100	SRRSSFRRRSRSRSMHRSRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM89	Uncharacterized protein	0.985	421-456	RVRQRQAAGKLASPKATKKPTRGKKAASKAAQKASK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM89	Uncharacterized protein	0.913	361-374	AKAKRGAKKKAEQK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM89	Uncharacterized protein	0.733	8-23	KVASRVAKPPARKQQA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WM89	Uncharacterized protein	0.605	338-339	RR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPB8	Multidrug resistance protein fnx1	0.786	387-403	ARRWLARHPKYRRVKAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WPL2	Uncharacterized protein	0.731	118-126	KQAKRDRKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTQ9	Nucleolar GTP-binding protein 2	0.998	4-48	GKPKSKRVPVRLRHKIEKASAAKQKKAKKLAKKDPTWRSKTKKEP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W1G1	Uncharacterized protein	0.652	17-21	TRKRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Y9	40S ribosomal protein S6	0.946	153-202	VRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRIALKRRRAE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Y9	40S ribosomal protein S6	0.817	131-149	KRLGPKRATKIRRFFGLSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Y9	40S ribosomal protein S6	0.656	230-233	RKRR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W6Y9	40S ribosomal protein S6	0.641	91-94	ERKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC08	mRNA 3'-end-processing protein yth1	0.994	245-273	GHQGGRGFRGNWDRKKRGRGRGRGGRGRG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WC81	Ubiquitin carboxyl-terminal hydrolase 2	0.975	534-566	GKGKEEKERKAHEKELEKAAKQKRKEMEQKRRE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WCT6	MRS7 family protein	0.76	129-141	KRAIAKKEEAKKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG68	Nucleolar protein 4	0.995	689-756	KGRKRKRDSSAVGKTGRGKPDAKGKQQGSGADAGADSAAGKTKDGKLAQRTRIIAKKRQARKAKRAGK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG68	Nucleolar protein 4	0.861	557-566	KMRKKKGKGI
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WG68	Nucleolar protein 4	0.741	122-136	REGEEKRPRAGDRAK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WIG6	50S ribosomal protein L4	0.648	127-132	RRKVRP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WKW9	Uncharacterized protein	0.94	65-82	HKKKKKAKSSQAGGPIRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNM4	Uncharacterized protein	0.747	326-342	KSRKRPVGDGPRGSGSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNM4	Uncharacterized protein	0.735	346-356	AFEKRRKVVGR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNM4	Uncharacterized protein	0.631	211-215	RRERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WNM4	Uncharacterized protein	0.603	279-280	KK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRH2	Helicase SWR1	0.889	600-610	AQKRRKKSRHG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRH2	Helicase SWR1	0.779	242-249	LKRKAKKN
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VRH6	TAFII28 domain-containing protein	0.916	69-77	GKKRRKKGG
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTR5	ATP-dependent RNA helicase DBP10	0.986	840-892	KKRVAEAKEKRIGAFKDGGAKNELRDVDAVRKNRRVKEQRQAKNARPSKKRKF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VTR5	ATP-dependent RNA helicase DBP10	0.824	329-344	AKEDAEKASNSKKRKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VX92	Homeobox domain-containing protein	0.964	197-216	RAKRRRTSKSSSRNGKKKRQ
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW8	SprT-like domain-containing protein	0.917	355-390	KKRSPRKAPPVSRPGTPPLAPPGPTKLVSPSKKKSA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW8	SprT-like domain-containing protein	0.875	461-476	PKKKPTSRGPVKKKAP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2VXW8	SprT-like domain-containing protein	0.798	110-117	EKKKRERR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z8	Uncharacterized protein	0.997	45-69	KTPGKTPGKKTKGKGRVKKGKKGKA
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z8	Uncharacterized protein	0.974	703-746	DRIEKEARERERREKEEAAKRARAEAAERGRIASREWAEKQRRK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z8	Uncharacterized protein	0.77	488-520	RQKREAEGVAPKARPLSMPPPPKSNKPLTKPAF
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z8	Uncharacterized protein	0.768	585-610	KLRIKREERLKRMEEAEAAKKEAALK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W0Z8	Uncharacterized protein	0.684	523-541	PGEKIAEKLRAQKEEREKR
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2V9	ASXH domain-containing protein	0.989	209-272	PKRPSKEATAAANGKRAIKKASPSQTPAPKKPMAKKTATKKAISAPPAPSSRPSRTRKAPERLE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W2V9	ASXH domain-containing protein	0.638	277-281	KAKLK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W4M8	Meiosis-specific APC/C activator protein AMA1	0.857	105-120	TKAKKEKKEGVIRARP
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5W1	Uncharacterized protein	0.893	117-128	RSRRHRERRRKS
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5W1	Uncharacterized protein	0.755	672-685	ERKKAHAKYVRNKK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2W5W1	Uncharacterized protein	0.613	338-339	RK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WBF0	Ubiquinone biosynthesis protein coq4, mitochondrial	0.898	260-279	PPDLRAMRKAEREARKKEKE
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMX0	Uncharacterized protein	0.953	71-85	GKKPRRTPKKKNTSK
UP000001471	Pyrenophora tritici-repentis (strain Pt-1C-BFP)	B2WMX0	Uncharacterized protein	0.693	16-20	KRKRK