ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RC98	Uncharacterized protein	0.944	333-362	RPKGGSSRPTKRKREEGDTPTAKGSRKKNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RC98	Uncharacterized protein	0.84	32-45	PVKRSWRRKYRKMR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFE5	Homeobox domain-containing protein	0.671	167-172	AKRKMK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG02	Zn(2)-C6 fungal-type domain-containing protein	0.872	57-66	KPPRKSRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH15	Uncharacterized protein	0.902	558-574	APKEPPKMRKVKKQQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH15	Uncharacterized protein	0.644	542-545	KRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH92	HTH_Tnp_Tc3_2 domain-containing protein	0.833	188-210	KRGTKRSACRSKHKPVPAKRTRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH97	EVE domain-containing protein	0.873	33-46	KRNAKKTTRRKRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI40	AdoMet-dependent rRNA methyltransferase SPB1	0.997	774-835	RLMSRAAKKKPKQKVSVIVAKGGNKGIKNRPKGTKGKYKMVDARLKKDVRGEKRAAKKNKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI40	AdoMet-dependent rRNA methyltransferase SPB1	0.988	718-754	KEKLRALNARPIKKVREAQARKKFKAAQRLEKLKKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI40	AdoMet-dependent rRNA methyltransferase SPB1	0.959	374-393	KEKESKSKKKQRRAENERKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI40	AdoMet-dependent rRNA methyltransferase SPB1	0.669	6-22	KHGKGRLDKWYKLAKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI40	AdoMet-dependent rRNA methyltransferase SPB1	0.629	237-240	KKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL64	Uncharacterized protein	0.978	150-200	NSRKNKDKSQSRKQLRRKPQNKVSFPASRGKGALKPFTGGRSGGRVSKRPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL64	Uncharacterized protein	0.651	10-16	KKANRTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL74	USP domain-containing protein	0.994	827-864	KDRKDSGKIKKEKKDRLRSKSRDPGAALEKGKHKDKNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL74	USP domain-containing protein	0.696	11-21	REKHHEKRASK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN39	CENP-T_C domain-containing protein	0.791	57-104	GRTPRGGPATRPIPSRRVAPTTPHAIRALRERANAARTPGNNRRRSGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNR4	Uncharacterized protein	0.884	13-34	KRKVGAVTVKKPYRKRQKTKPT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNZ9	TruB_N domain-containing protein	0.957	306-348	RKLAQDREDRPKQRFRGEWVAETKKERIKQQGGKFKGKWGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQH0	Avl9 domain-containing protein	0.81	742-755	KEKEKEKEKEKEKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT52	Signal recognition particle subunit SRP72	0.993	633-652	QEKKAGVDKGKGKKKGKGKW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT52	Signal recognition particle subunit SRP72	0.977	560-614	RSAPTKEAPSRAKRLRKARMPKDYEEGKKVDPERWLPMRDRSYYRPKGRKGKKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWW8	RNase III domain-containing protein	0.999	410-441	SHVKKRKKEDDSASPDKKKHKKEKKDKRDKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX11	Uncharacterized protein	0.79	720-732	QRKVRKKLGNLRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYE7	Uncharacterized protein	0.944	355-392	RALEKEKKTKTKAMDADAKTRDKLYKRLQKKLGKRKLV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYE7	Uncharacterized protein	0.774	287-305	KALEREKKKSIGLELEKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYG3	Uncharacterized protein	0.627	135-144	KPRPNLRTKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYM8	Rab-GAP TBC domain-containing protein	0.798	408-432	RRRRLGRSSSRAPSSRSADPRSGSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZJ9	Lipase_3 domain-containing protein	0.964	9-30	RKSRKKQSSKTSRKRSSSRKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0E8	Stn1 domain-containing protein	0.904	195-226	KKIKHSIKSEKKKLHEYERRKAEYEVKKEEHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3W8	Uncharacterized protein	0.971	170-201	SGKKAKRKARERQLEESRRLALLQKRRELKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3W8	Uncharacterized protein	0.809	270-278	DRKKKKDEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S530	Uncharacterized protein	0.983	157-185	AMRDKERKRRAEEKEREKRESEAREARKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA14	Uncharacterized protein	0.638	196-200	ERAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAY4	Uncharacterized protein	0.614	128-129	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHD4	RING-type domain-containing protein	0.781	80-89	RPHRRRREKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHH4	Calponin-homology (CH) domain-containing protein	0.987	440-470	RLQEKKVRSRSKSRTRERSKSRARPAPPPRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHN6	Uncharacterized protein	0.699	177-190	RAPSARSSRKGHNH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU6	Spindle pole body component	0.967	890-909	PERRRRKGSQKREREKDAPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU6	Spindle pole body component	0.89	176-190	IAEKPEKPEKRKERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNI0	Uncharacterized protein	0.642	298-301	VRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP95	Uncharacterized protein	0.773	496-503	RRPAKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSF7	Uncharacterized protein	0.903	405-413	KRRGKKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVL3	Uncharacterized protein	0.997	252-289	GEGKGKSAKKFANGVRRNRRGGRKHGNKGKQGVKREPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVM8	Uncharacterized protein	0.946	22-34	IRVKKREKKRTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVM8	Uncharacterized protein	0.664	81-88	KKKSQARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S001	Uncharacterized protein	0.86	35-60	RRRADDSRRLRRVKDSKEQLKRRTTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1E0	Uncharacterized protein	0.703	197-202	KRKRKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1L4	DUF2235 domain-containing protein	0.766	577-594	PPKRSNTKVERPRSRSRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2E7	Uncharacterized protein	0.963	148-180	PPKGPPSRGGKKEKSEPRTLNDRHHGRGRGRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3G9	Uncharacterized protein	0.958	570-605	KPNRRTYVKGRGRKVVRRNGKVDPLKTFNARGKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3G9	Uncharacterized protein	0.922	371-379	RPKKKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S538	Uncharacterized protein	0.77	18-39	RKAKVRKADIKTWRPSNTRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9B8	Uncharacterized protein	0.981	232-277	RRKSKGMKRGEERKGSKAYIMKKKEQMERQGKVVKASSKYTGRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK23	UDG domain-containing protein	0.915	92-102	PPPKKKRKPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK23	UDG domain-containing protein	0.613	310-316	RAERGFK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLW4	Uncharacterized protein	0.727	625-643	EKKAGVRPGEGRGRWTDKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN29	Uncharacterized protein	0.997	577-641	RGRRKDISKKRSPLPSPKRLRSPPPAKRGAHRSPPPRKLFGNSPPNRLHSPPPPMRLRSPPPTRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN29	Uncharacterized protein	0.997	710-744	LEKKKQRRKEKLYRKQHRKGTKEKRPAPGRGAERM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN29	Uncharacterized protein	0.821	473-482	KPSKRRKSKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQG3	Uncharacterized protein	0.963	151-171	PKKGRGRPKKQDTKGSAKLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR58	XPG_I_2 domain-containing protein	0.978	517-533	KKKKRQAREADRKKRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR64	Uncharacterized protein	0.947	286-310	ERVRRERKEQIEKRKEMIRNKKKVI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR64	Uncharacterized protein	0.628	182-187	REERRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT40	Uncharacterized protein	0.827	755-768	AGKKGTRKRNVPGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUA3	Uncharacterized protein	0.707	395-401	RRRGRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVU5	Uncharacterized protein	0.941	34-43	NKPRRRRKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S043	Uncharacterized protein	0.923	9-29	AKRKAQRESTKPGKPRAERRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0F1	J domain-containing protein	0.993	351-366	PKKSKAKPKARKRGRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0F1	J domain-containing protein	0.985	216-253	KAKEAEKKRREDFDKRQAKEEAAPANGKSKAKPKAKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0F1	J domain-containing protein	0.89	308-323	NRKKQKTNSRSKKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S139	Uncharacterized protein	0.834	215-227	RGKKATKRPKGAI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1V3	Uncharacterized protein	0.95	510-584	HRAPRPSSSALRPRSRDSQRRREREDKRAPTDPNPMNKHRATAHSAGLPVKKILKAGKRTLSGRIDKKPGIRQKI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4A6	G-patch domain-containing protein	0.853	30-47	RAARKRKEGEARAHQKTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4A6	G-patch domain-containing protein	0.617	115-117	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8M7	THUMP domain-containing protein	0.924	8-31	PKKRKAESGGAHDGGNKRAKGKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9P8	Methionyl-tRNA synthetase	0.998	573-604	ARKAKEEKARKAAAKKADKERKKAKKAGGPDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCV9	Uncharacterized protein	0.883	950-977	KVGAVKKKVEDGDGVVKRPVLKKSKFRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA5	Uncharacterized protein	0.899	754-774	KNGKKKPARRYVMSRIKFQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA5	Uncharacterized protein	0.899	901-919	NKRKKVMANTKHRPKRIKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG77	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.976	111-126	RDGPRKGKNKKEKKQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGN4	Uncharacterized protein	0.827	503-518	RVAKHHKTKKSALRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGN4	Uncharacterized protein	0.618	661-664	KHKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLP6	Uncharacterized protein	0.897	40-52	KTAKPPKRAKKHH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPQ6	J domain-containing protein	0.905	264-290	DRKRAEERRVEEARARAVARREKKAQT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPQ6	J domain-containing protein	0.669	128-131	KRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT12	AMP-binding domain-containing protein	0.672	637-643	DKQRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT42	Uncharacterized protein	0.612	22-25	RPSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTG2	Ubiquitin carboxyl-terminal hydrolase	0.815	571-582	PLRRKSKKAHNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV19	Uncharacterized protein	0.993	28-61	KKAAPLKKKKKKKNGTILTFFKQRSPSPPPRKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV19	Uncharacterized protein	0.662	303-307	KRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ80	Uncharacterized protein	0.828	403-421	RKKKEAEEEAKKAKESKIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1A5	Mediator of RNA polymerase II transcription subunit 16	0.834	904-909	KKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S448	Uncharacterized protein	0.96	550-567	PKPSPAKPKKKAKADARV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S448	Uncharacterized protein	0.608	676-677	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHP0	Uncharacterized protein	0.848	172-199	PRYPKKKTPEEKQAEKEKESAEQPKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ77	Uncharacterized protein	0.875	131-152	KLARRRQIKAGRGRNGQGKVKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRT9	DNA ligase	0.933	641-653	PKKPKKKAAKSSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRT9	DNA ligase	0.664	6-10	KRRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSZ7	Branchpoint-bridging protein (Fragment)	0.795	58-66	PRQRKKRNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUB9	Bms1-type G domain-containing protein	0.863	15-33	TKKDKKGFKSRHATKGALK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUQ5	C2H2-type domain-containing protein	0.991	279-309	KSVKVKKEQRRSRVTKEKGKDKGRERERRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY93	Signal recognition particle subunit SRP68	0.829	379-401	KPRRQRKDGKEWAEREEPTGRKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZR9	Uncharacterized protein	0.663	143-150	KKRSRTKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2G7	Uncharacterized protein	0.733	273-278	PPKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2G7	Uncharacterized protein	0.633	287-289	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2Q5	Non-structural maintenance of chromosomes element 4	0.61	66-68	RGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S533	Uncharacterized protein	0.949	24-38	RKRRKTAKAARKLRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S559	Ribonuclease P protein subunit	0.993	46-78	ARAVRRRALNDRKEISRKRSKNKPRPLSAAKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S583	Uncharacterized protein	0.916	146-158	KAPGKPKARSRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S583	Uncharacterized protein	0.821	171-194	RSKRYRRRNTSGSRSRSRSTSPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S717	Uncharacterized protein	0.986	283-305	KKIERNDIKKARGKERKGKEKRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAI6	Uncharacterized protein (Fragment)	0.816	34-51	KHPKSRRLIRAPKVQKAH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE46	PNPLA domain-containing protein	0.643	30-40	RKLPFKIRNGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RET7	Kri1_C domain-containing protein	0.997	645-659	EKKKKKRSRKRKAGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RET7	Kri1_C domain-containing protein	0.984	560-583	FRDPVKKKKDKKFLSKKARIRQWR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RET7	Kri1_C domain-containing protein	0.98	313-344	DKSGRRKAREAARAKREAERREKEQDLARLRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RET7	Kri1_C domain-containing protein	0.951	412-422	GKKGKKPKKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RET7	Kri1_C domain-containing protein	0.871	472-494	PKKSSKQRKQERAEAKSAARRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RET7	Kri1_C domain-containing protein	0.646	7-14	KKHAKGVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF27	Uncharacterized protein	0.766	282-307	RRKWSHDVKGQEKERKRVMSWGRLRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKY8	Uncharacterized protein	0.858	131-141	FKKKRKVAAKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLY6	Uncharacterized protein	0.785	242-273	GRGGKNRKMGLLELKAILGPKEKQLTKRLKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST2	Uncharacterized protein	0.786	46-54	KKKRKTKST
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUJ3	Uncharacterized protein	0.998	231-299	EATREAKEVKDPKKEAKAKEMRARERMRKAKAAEKETARKEAAEAKARKEEQKAEAKRAKEEQKKSKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUJ3	Uncharacterized protein	0.923	160-173	RGGDGRKQKKKHRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUJ3	Uncharacterized protein	0.699	455-473	SRPRPSGSRSRPTSESPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUJ3	Uncharacterized protein	0.615	443-448	RARSSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUJ3	Uncharacterized protein	0.613	436-438	RAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW33	Uncharacterized protein (Fragment)	0.723	409-420	HRKPIKSSKRTE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW67	Uncharacterized protein	0.992	10-36	EKMAAAKKRVEQLKKQRAKKAGGKKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWD0	Formyltetrahydrofolate synthetase	0.686	471-476	PKKGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWS0	Uncharacterized protein	0.967	45-69	ARAREAEERRKAAKKKSEEKEVKEA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWS0	Uncharacterized protein	0.879	104-115	KKRKEEEKRKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYG0	Aa_trans domain-containing protein	0.972	332-341	GKRRRRKPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYW4	Glycylpeptide N-tetradecanoyltransferase	0.989	53-70	EKKKKSRKRKIKDALSGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYW4	Glycylpeptide N-tetradecanoyltransferase	0.879	1405-1427	GGRGGYDGRGGRGGRGGRGGRGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0G7	Uncharacterized protein	0.732	205-214	KRQKPGKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G9	DUF3591 domain-containing protein	0.821	526-535	SVKRKHKKNL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G9	DUF3591 domain-containing protein	0.717	1037-1047	ERREGREKAKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Q6	RRM domain-containing protein	0.941	446-504	RDRDRRFRDRDDYRPMRSPSPRALPRSVRSRDRSRDRFDTRYRSRSRTPPRRHRSPSPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Q6	RRM domain-containing protein	0.841	398-420	KPQRNTKKIEPQNPPPRRRSRSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S741	C2H2-type domain-containing protein	0.819	460-472	GKGERSKGKGKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S983	Uncharacterized protein	0.699	192-197	NKKPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD97	Uncharacterized protein	0.949	612-624	PLKRAKPKKGRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD97	Uncharacterized protein	0.771	178-188	KRKVRRRAITS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD97	Uncharacterized protein	0.725	66-72	AKKRKTA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD97	Uncharacterized protein	0.626	190-193	DKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REC7	WD_REPEATS_REGION domain-containing protein	0.89	66-92	RRRSYSRSRSRSRSRRSSSSPSSRRRL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHB5	Uncharacterized protein	0.639	160-164	KRAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHW7	LigD_N domain-containing protein	0.954	259-271	RKRPVARRKGRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIH3	Uncharacterized protein	0.858	104-112	KRTGRKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ13	Uncharacterized protein	0.969	81-99	VARSKLKRLRKQKRLLKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ87	Amine oxidase	0.978	52-69	DGKKGKKGKESKGSKKTG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB5	Uncharacterized protein	0.992	72-108	ARKPRRKTRPEHYEPGSHAPPMQKGRSKKTRRKKSKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB5	Uncharacterized protein	0.863	177-183	AKKKRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB5	Uncharacterized protein	0.832	21-30	RRKVPRKRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB5	Uncharacterized protein	0.719	297-314	RYKRKTDREKDQSKRPAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT77	Rho-GAP domain-containing protein	0.888	809-827	KRRHEHKDRADKKERAKSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYM2	RING-type domain-containing protein	0.974	54-81	RRRRHATPIPARPPPKIKKPALRRAEAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ75	Uncharacterized protein	0.82	171-179	RKKKAFKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ75	Uncharacterized protein	0.706	393-400	PKRKSGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ92	Uncharacterized protein	0.821	146-153	KKKKKGIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S1	RRM domain-containing protein	0.916	547-588	KEKVARNPRFNGPPTGPARGGGRANFAPRGGRGGRGAGARGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S1	RRM domain-containing protein	0.843	193-233	REKKANRDKPSTKANRQGRGEGKEDVVERGEKKILAKPGKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S1	RRM domain-containing protein	0.69	362-373	RKERPTRAERRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S1	RRM domain-containing protein	0.605	243-243	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S8	Uncharacterized protein	0.965	281-301	GRKRKRRTMRTARPEKVPRAG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S8	Uncharacterized protein	0.945	228-240	SRRRRRRKGAQEP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S8	Uncharacterized protein	0.933	184-203	RRRRGPQRTMKRGTRRGRPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S8	Uncharacterized protein	0.887	1352-1361	GKKNRKRKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1D7	Uncharacterized protein	0.937	288-301	RGRRGNKRRKGEPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S416	Uncharacterized protein	0.657	335-344	FSKRSWRVRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4E4	DDE-1 domain-containing protein	0.871	339-366	RLKRAEEAAAKEAKANAKGQGKRGQKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4E4	DDE-1 domain-containing protein	0.72	384-389	RGRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4X7	Uncharacterized protein	0.998	206-222	KKTGKSRRRRRRKGKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6X8	Uncharacterized protein	0.999	234-258	SKKKERKKKRQEKRKEEKKEEKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9T2	Uncharacterized protein	0.897	482-518	ERARQERRKEKRLQHAAQIREDEEKRKAEEEKRKEEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9T2	Uncharacterized protein	0.726	556-564	ALKKHKRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGD6	Uncharacterized protein	0.988	80-95	SPPKPKRRKGKKSQPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGM0	HTH_Tnp_Tc3_2 domain-containing protein	0.973	84-102	SGGQRPRRRRRRQLSRLKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIQ4	Uncharacterized protein	0.917	341-355	KKEFPKPKTRPRRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQY4	Pinin_SDK_memA domain-containing protein	0.753	59-71	KPAPVRREKGRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQY4	Pinin_SDK_memA domain-containing protein	0.649	120-123	ARRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRB1	Uncharacterized protein	0.933	38-50	GKARRKPKTKRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRB9	CID domain-containing protein	0.844	394-412	PSRPKRSGSPRDRTRNRRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRB9	CID domain-containing protein	0.777	362-384	GRWRHRSPSDPRRYSRSRSRHSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRX3	Pescadillo homolog	0.984	601-676	KKLQVKKPTRKEENAAIRRKAEEKKRAEEEERERQKMMLSNKKRKLLKRIEYGENKRDNESENLRRKRARVEKAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUI8	Uncharacterized protein	0.996	86-128	PKKQTPKPRAKPAEKKTKAASETTRGVKRKAAAPAKKAKKRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUI8	Uncharacterized protein	0.995	214-239	KRKKATAAKGKKEKAPAKQKAAPKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY40	Uncharacterized protein	0.971	129-149	KDEKKKLGIGAGGKRKRGAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY40	Uncharacterized protein	0.929	16-28	KAKKPLRKRPKNA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S007	Uncharacterized protein	0.749	37-55	KSKLKQVNKPRTPVAKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S007	Uncharacterized protein	0.689	471-477	RKRGRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S007	Uncharacterized protein	0.649	500-506	KKHGKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6E6	Fungal_trans domain-containing protein	0.837	13-24	KRGKHVRKPRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6I0	J domain-containing protein	0.855	64-76	RKKQKRMERRIKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S769	Uncharacterized protein	0.804	39-69	KKARDELAKTVGKGKGPLNTGSQGIKKSGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S769	Uncharacterized protein	0.663	15-19	KKPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S791	Protein transport protein sec16	0.908	1842-1853	RKGPSAKKKKGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S791	Protein transport protein sec16	0.741	976-982	KAKGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REF1	Developmental regulatory protein wetA	0.856	483-498	KTKARREKEAADKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFI5	Uncharacterized protein	0.866	172-182	RSRKTRRPKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFL8	Sister chromatid cohesion protein	0.977	1739-1770	RGRKRKSNVTLGNTPKKARSRASGSKKKGRNS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ0	Uncharacterized protein	0.64	202-205	RRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ0	Uncharacterized protein	0.617	211-214	RERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIA5	5'-3' exoribonuclease 1	0.985	1367-1388	GRGGRGRGRGRGGRGRGGPRGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIX5	Uncharacterized protein	0.803	59-69	KKKAKSIKPKI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLQ8	Uncharacterized protein	0.989	784-836	VGVSRKGKGKAKAAGTKRGTVAKPNQVGARKKTKVEAKVEVKKRAKSVVVKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLQ8	Uncharacterized protein	0.744	771-780	GKRKSRVRTE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN57	Uncharacterized protein	0.607	322-323	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNG5	HTH_Tnp_Tc3_2 domain-containing protein	0.973	84-102	SGGQRPRRRRRRQLSRLKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN9	Origin recognition complex subunit 4	0.954	170-195	AKRAKRMPAASTRKPAASRANARKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN9	Origin recognition complex subunit 4	0.873	125-145	KPIAKRGKGRPTKAETASRNA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN9	Origin recognition complex subunit 4	0.827	8-38	SKRRKLDTPKRIESNAAAKPSTRKASGRLAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN9	Origin recognition complex subunit 4	0.71	223-236	KPRSSRKPAVSTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU5	Replication factor C subunit 1	0.996	1041-1058	KQPKKKAAPKKGGKKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU5	Replication factor C subunit 1	0.992	1069-1085	KPKGKSKVKAAPKGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU5	Replication factor C subunit 1	0.991	249-293	STPKKPTASKKRKSPESEDEDEEKPKKSRAKATPAKSPAKKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU5	Replication factor C subunit 1	0.99	94-144	KNKPKRTEPVKKKAAETPKATPKKAPAKATAKTSKKVTPASPAKTSGRTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU5	Replication factor C subunit 1	0.97	60-75	KKASPKKPPPKKVKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU5	Replication factor C subunit 1	0.925	28-41	GPTPKKAAPKKKGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ61	Uncharacterized protein	0.611	667-669	HKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR51	Hva1_TUDOR domain-containing protein	0.999	248-290	TKPAPKKGGRPKKEKKEPAKKKKEPKKAATADGQPRRSGRNKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR51	Hva1_TUDOR domain-containing protein	0.614	121-122	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT28	Cysteinyl-tRNA synthetase	0.922	774-790	PKARSKKLKKEWEKQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0D8	Uncharacterized protein	0.999	665-746	LSKRAATRELKQRRRELKRQHKQKKRELRAVHDRKGKGKAKKSREWKEAKKEFKEKKKELRRERMAIRKQWREGRSERSRGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0D8	Uncharacterized protein	0.749	845-853	KVKQKKRHA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0D8	Uncharacterized protein	0.672	395-406	HRGRGHHHHPRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0J7	WD_REPEATS_REGION domain-containing protein	0.959	1590-1602	PTKTKKKGKRKVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2Y0	GYF domain-containing protein	0.843	303-319	KAAPKKKAISNWAKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2Y0	GYF domain-containing protein	0.725	250-262	DMKKAKEAHEKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3T5	Uncharacterized protein	0.992	10-127	RRRYSPRRDRSRDRRDRGDRYGGPGGGRYGPDRRDRDRRDDRRDDRRDDRRDDRRGDRRDVRRDDRREYRPRSRSPARRDRSRDRTYRRDDDRDRRNRSNSYRPGSRSSGRPGSRSSA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3T5	Uncharacterized protein	0.781	144-175	DERKKDPETLAKEKLADRAAKLAEWKKRNAER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3T5	Uncharacterized protein	0.665	464-467	KKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3T5	Uncharacterized protein	0.649	943-951	KARALEKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6H5	Protein kinase domain-containing protein	0.652	661-665	EKKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L3	Uncharacterized protein	0.634	10-13	KKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Y8	AAA domain-containing protein	0.993	1017-1032	KDRKKRKAVKKGKPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Y8	AAA domain-containing protein	0.991	973-993	SRRKKSKEESKKSKSKAKKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Y8	AAA domain-containing protein	0.874	846-861	RKHWRVNEKKKSRRWN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7R8	AAA_16 domain-containing protein	0.876	358-384	KRKNKRRAPSAASFSVTGKRSGTKHRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Q5	Vacuolar membrane-associated protein IML1	0.938	568-584	KPRKADKIVRKSRKKGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ8	Uncharacterized protein	0.64	162-165	RKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ2	Uncharacterized protein	0.783	649-658	RKKDKLKRKF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE32	CBF domain-containing protein	0.964	5-28	KRKRDPSKPERSESKSKSKNRRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK1	Uncharacterized protein	0.828	274-284	NPLPSRRKKKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK1	Uncharacterized protein	0.69	260-270	KKRGRTRSTNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RID5	Uncharacterized protein	0.633	1903-1906	KRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RID5	Uncharacterized protein	0.612	473-477	RERDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI6	Ribosome assembly protein 3	0.959	11-21	EKKKRSKKRRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI6	Ribosome assembly protein 3	0.723	67-72	KKEKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNX0	HECT domain-containing protein	0.956	62-92	RGARNKRSKVEEKDAPAQPPGRSKRAKGKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNX0	HECT domain-containing protein	0.915	110-131	QPSKRTKSARKSRGDSARRPTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPY9	eIF2B_5 domain-containing protein	0.987	140-152	KKKKKKSTKKKEG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPY9	eIF2B_5 domain-containing protein	0.965	164-175	ALKKKKKSSKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVN8	Uncharacterized protein	0.958	91-108	RKTSRTRRKLSKRHRRPT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY24	SCA7 domain-containing protein	0.999	125-207	KKQEKLKKKKEAKEAKDAALRKEKGEDDEGGKSRKSAIKGASIDGDGAKKGKKRKLDGDAEKAPNAKKKKKDEPKQKGAKPKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY24	SCA7 domain-containing protein	0.913	32-51	KSEKPRIKLKIKKPVLKPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U4	Uncharacterized protein	0.999	134-166	GKKGKKGKKGKKVGKEKGNEEKGNKEKETAAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U4	Uncharacterized protein	0.987	615-635	KPKRPIAKKKPTNKKAKLSKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S238	DNA helicase	0.991	1679-1739	RSGSKASGSGYRKKGPSRKRASGSFGKSFGGVKKRAPKASGSRASGGVSAAAKKPPAGGSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S238	DNA helicase	0.968	683-708	SLKPRERSHRIPETPERRRSPKKPKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S238	DNA helicase	0.869	1366-1382	SPRKARAKAPVVKKTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S238	DNA helicase	0.854	193-219	TPKARKRKSDEFEADMRHKKSPRPVRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S238	DNA helicase	0.727	428-433	PKKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S321	ATP-dependent DNA helicase PIF1	0.623	192-194	KRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5V5	Uncharacterized protein	0.917	490-502	RGERSKKKRRFRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S742	Protein kinase domain-containing protein	0.909	539-554	RKKGRDRSPKAKERGV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7D0	Uncharacterized protein	0.977	191-216	RRPKTRKPKDGAERRRSSTRSKSRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7J7	Uncharacterized protein	0.998	969-1049	RRLREAEVRRREEEKKRAEEEALEKKRKYAEEQERLIRRDRELMEKRNEEERRRMEEDEDKELRKAERKARGPKGPKRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7J7	Uncharacterized protein	0.987	1085-1103	RPREKKKRKLARKSEPAGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T8	SRP40_C domain-containing protein	0.927	151-163	AKAKKGTKKPKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T8	SRP40_C domain-containing protein	0.913	101-114	KPKKTKKASPKKAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T8	SRP40_C domain-containing protein	0.762	406-418	KGFTKEKNKGKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T8	SRP40_C domain-containing protein	0.758	222-231	KKVKKTKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T8	SRP40_C domain-containing protein	0.703	271-277	KAKKGGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S806	Diadenosine tetraphosphate synthetase	0.93	138-146	PKKKKKKVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD70	Uncharacterized protein	0.998	166-266	SSLKKRRRSRSPHDRTHRHEDKDREGRRSRKSEHEERKDRRHRHRSYSRTRSRSRSSTPRSDRHDRRRKHRDRSLSPRGHSKSTRRKRDSHKDPSSSKRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD70	Uncharacterized protein	0.982	113-157	KRRHHRDDGDRHGKRARQGERESSRDVPVRRHRDRSRDRQRRKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD81	Bms1-type G domain-containing protein	0.994	1115-1176	KVERRRQKQEERKDPYKRKVKENEEKRTEREKREKQEYWAREGKKRKGDAGEGGGGAAKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD81	Bms1-type G domain-containing protein	0.972	8-42	RPHRPKKEKKPHSGDKNPKAFAYAAPGKLKRQAAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD81	Bms1-type G domain-containing protein	0.772	316-324	ASGKKKRTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGD0	WD_REPEATS_REGION domain-containing protein	0.85	179-186	KKRKRKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH14	Uncharacterized protein	0.744	364-373	NKKTKARGKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHB0	Uncharacterized protein	0.994	912-940	RKELEKKAKEKEKKGGKLSWWKKKKTDKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIJ5	Protein kinase domain-containing protein	0.852	755-774	TRKVIAAPKKEVKKETPKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK70	Uncharacterized protein	0.807	1279-1293	KKKAKKTCKSKAAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK70	Uncharacterized protein	0.769	1195-1208	PSGKKKGTGATGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK70	Uncharacterized protein	0.728	547-556	RKSKRPVKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK70	Uncharacterized protein	0.718	1245-1249	RRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK70	Uncharacterized protein	0.632	92-96	KSRRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF0	C3H1-type domain-containing protein	0.828	17-36	RSRLPPPRRPPDSNRRRNHD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF0	C3H1-type domain-containing protein	0.741	188-205	ALGVREKIVKRREEALRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSD5	PHD-type domain-containing protein	0.995	192-215	EPVKAKSKPKPKKSKGSRSSKRQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT00	Chromo domain-containing protein	0.722	119-125	RKRRGRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWD5	Uncharacterized protein	0.66	95-99	KGKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWG3	Uncharacterized protein	0.712	103-109	GSRRRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWG3	Uncharacterized protein	0.619	448-450	KRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZG3	Mago-bind domain-containing protein	0.978	121-163	DKTKPSEPKAKVVDREAEKEKEAKKLTKKLRQARELKDKKDKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZG3	Mago-bind domain-containing protein	0.931	85-102	NPAANKNAKRREARKKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S256	Uncharacterized protein	0.978	24-45	RARRKQEKKEMKEMRRRKKEAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S256	Uncharacterized protein	0.973	74-103	KKGRYGPRNPYKKREKGPDGKPVSSMKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S256	Uncharacterized protein	0.942	157-169	KAPKKKGKGRPPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S375	PPIase cyclophilin-type domain-containing protein	0.98	241-294	KAPEPDRAIPIRKPSRKSPLRSPSPKPMPKVDAEPPPKPKARTPPRELSPESEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S375	PPIase cyclophilin-type domain-containing protein	0.971	468-489	EAKRHKAEGKGKKEWDGKKLKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S375	PPIase cyclophilin-type domain-containing protein	0.962	191-203	TKKVKKPKRKAGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3G5	Uncharacterized protein	0.611	646-647	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S495	ATP-dependent DNA helicase	0.998	1081-1132	RAKPVSKAKAKEPAKAKKTAAPKAKQKPGPKPKKDISPMAPKTPAPRPRKNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S495	ATP-dependent DNA helicase	0.957	898-910	PKKGRRTKKPPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S495	ATP-dependent DNA helicase	0.778	36-44	RPAKRRKIS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S495	ATP-dependent DNA helicase	0.749	54-63	PSNARHRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S495	ATP-dependent DNA helicase	0.722	99-105	PASRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S495	ATP-dependent DNA helicase	0.648	1247-1253	RPKRTPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Z8	Uncharacterized protein	0.65	113-116	RRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA13	Uncharacterized protein	0.902	274-285	RSRRHRERRRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA13	Uncharacterized protein	0.755	1019-1032	ERKKAHAKYVRNKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFE9	BZIP domain-containing protein	0.962	74-129	PKPVKKRKSWGQVLPEPKTSLPPRKRAKTEDEKEQRRIERVKRNRLAAHNSRERKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFJ9	Uncharacterized protein	0.998	82-110	EEKQKIKREKRKGKDKEKDKEKEKEAKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH59	TRUD domain-containing protein	0.989	238-262	TPPAERKKKKGKGGSRDPEHQARRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHR6	Uncharacterized protein	0.994	480-507	LRKKVEKRNTRVVKASKKGKGKGRVKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLR7	G-patch domain-containing protein	0.918	105-125	EKKERKAKARGETRTTAPRPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM05	Uncharacterized protein	0.989	216-254	KPATPLAAGQPSRAPRRAPARPAPKPAPKPAPARPVRAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM05	Uncharacterized protein	0.952	184-209	RKIAPKSKSKNKSKGKSTESRSSGGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN2	Uncharacterized protein	0.999	225-247	PRRRPPPPKKKMKRGGPGRGRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQY6	Kinesin motor domain-containing protein	0.955	606-620	KAPKPKPKPKPKWAT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQY6	Kinesin motor domain-containing protein	0.893	656-669	PKAAARKPKKTTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSN1	Uncharacterized protein	0.624	30-33	ERRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVB2	Non-specific serine/threonine protein kinase	0.87	848-861	RKARAEERRKKGGL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVB2	Non-specific serine/threonine protein kinase	0.672	213-223	KKRLSGGAKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVN4	Uncharacterized protein	0.869	477-501	KQVPRNKPLVEKLPPRKRQKFLGPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVN4	Uncharacterized protein	0.652	378-383	RGRPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY05	TLC domain-containing protein	0.807	74-86	AMRRSKRRTTRRY
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYX7	Uncharacterized protein	0.755	235-246	RNRKGHRNNKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1D2	Uncharacterized protein (Fragment)	0.855	315-329	RKRKPKPVRWNEKRQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S226	60S ribosomal protein L29	0.937	14-60	KKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALKEVKEG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S357	Helicase C-terminal domain-containing protein	0.734	568-575	KSKRRREK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S552	Uncharacterized protein	0.985	341-360	PTRKAKKRRSEEKNRPKSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S552	Uncharacterized protein	0.736	648-668	KRTSAKKRWSHPDLPQKAEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B2	Uncharacterized protein	0.993	492-508	NRRRKRRKLRERREKEA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B2	Uncharacterized protein	0.99	236-284	SRSRSRAPGRDDSRSRSRSRSRARSRSRSIFGRSRSRGRSRSASEDGGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B2	Uncharacterized protein	0.855	142-159	RYGSRSRSRSRGGRKSEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B2	Uncharacterized protein	0.773	307-319	VRSKSRSRRERSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8W6	Uncharacterized protein	0.996	502-530	KAERKRAELKRKNEEATKKLARAKKKKRF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8W6	Uncharacterized protein	0.777	439-451	KKARKPFRIGGKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDR1	SCD domain-containing protein (Fragment)	0.927	24-38	IKKLSKRPRKAPIRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDR1	SCD domain-containing protein (Fragment)	0.768	1008-1023	RKVTKKTAKPGKQAEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REX9	Uncharacterized protein	0.991	13-49	RSPRRRSRSPRRSRRSYSPRSRSRSREDYRRTERRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI72	Uncharacterized protein	0.743	1043-1061	RKRKAVSSSAREQRAAKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMB6	Uncharacterized protein	0.874	111-128	RARRNRSRGRFSKRLNRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMX1	Uncharacterized protein	0.854	612-622	RRKKRMRGHGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNN1	Fibronectin type-III domain-containing protein	0.997	941-980	EDKAKKAAEKEARKAEKAEKKEEKEKRAKADKAEKALRKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPM3	Uncharacterized protein	0.953	437-452	WGKRGGRGKGPKRERG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI3	Uncharacterized protein	0.621	591-594	RLRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQM3	Uncharacterized protein	0.899	162-171	AKPSKKRKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSD0	Ribosomal_L7Ae domain-containing protein	0.998	8-41	KRLKKDKKEKKEKKRAETDGVSKSKKDKKDKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSD0	Ribosomal_L7Ae domain-containing protein	0.898	91-119	KKILKTVKKSAKSKTLRRGVKEVVKALRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUC1	Uncharacterized protein	0.998	111-142	RTRKRKRNQEDAIAKIKKGKAAKKVEKKKKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUC1	Uncharacterized protein	0.946	202-220	DAKAEKKASKPVVRKGRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUV2	HRDC domain-containing protein	0.994	753-765	KKKKKKDKKKKSA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUV2	HRDC domain-containing protein	0.934	706-720	REKAARRAARKQKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUV2	HRDC domain-containing protein	0.684	665-669	RKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ74	Uncharacterized protein	0.993	301-336	PSGRAKGKAAAKPVKAKAAPRKAANNGGRETAKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ74	Uncharacterized protein	0.802	958-967	RGSAKKRKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ74	Uncharacterized protein	0.761	805-821	KKTAALEAKKAKNNGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ74	Uncharacterized protein	0.748	284-289	RKKKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4E2	Uncharacterized protein	0.713	627-634	KPVKSRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD51	Uncharacterized protein	0.926	336-371	QPRKKGRLVKGTDRKGKIAFSPSPEASPKRPQPPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD51	Uncharacterized protein	0.914	461-470	KGKKKARKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDQ2	Uncharacterized protein	0.986	302-346	RARNRHGDTNGSRRTSPAGPAAPVQNPRKRRRDEKRERDEKRRQQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE5	Uncharacterized protein	0.998	570-684	KPRQKTSLKLKIKNLPPVAPAKESKKAHKRKHHHRELTPEEPVPKKVKLKVKDAAKSKEAAARVSTKEPKAHKERKEPKEAKESKEKDAIPSKEPKEPKEPKDKGKAPAKTPAKI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE5	Uncharacterized protein	0.986	313-330	GREDKRDKKKKRDRRSAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE5	Uncharacterized protein	0.869	758-776	KRKGPGRPPKDGIMSKRQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE5	Uncharacterized protein	0.719	805-812	KPKAPKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REZ6	Uncharacterized protein	0.997	437-457	KKKKKDQKKGKKEEKKDEKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLJ1	Uncharacterized protein	0.857	368-378	ARRRKSPRIRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNH6	ANK_REP_REGION domain-containing protein	0.706	638-646	KSNLRKRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQL8	Uncharacterized protein	0.667	12-22	KPRSKQSRSRN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRV5	Uncharacterized protein	0.986	498-518	MKLKQEKKRRKNKKENGHVKM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRV5	Uncharacterized protein	0.639	209-215	KEIPKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS18	Uncharacterized protein	0.733	298-304	RIRRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV04	Uncharacterized protein	0.968	66-84	AHKKKKKAKSSEAGGPIRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM3	Cir_N domain-containing protein	0.921	73-88	RVGEKHEGGREKKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM3	Cir_N domain-containing protein	0.68	159-163	EKRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM3	Cir_N domain-containing protein	0.639	252-257	KEDKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM3	Cir_N domain-containing protein	0.636	283-286	HKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2V7	CP-type G domain-containing protein	0.93	654-668	KKHFKANKRRAKKVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4H9	Uncharacterized protein	0.93	224-251	LKPNRPRKSSVGQHARRGKHERQRSREF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4Y8	Uncharacterized protein	0.966	738-750	AKKKRTKGKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4Y8	Uncharacterized protein	0.65	669-675	RERRNRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8R2	Reverse transcriptase Ty1/copia-type domain-containing protein (Fragment)	0.856	30-42	PRRRGRPRGLKNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAU0	54S ribosomal protein L31, mitochondrial	0.697	85-94	VKRYRKGIHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG89	Uncharacterized protein	0.985	73-91	PRKKKKKRQQVKRELEKEI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU2	Tryptophanyl-tRNA synthetase	0.939	467-492	NAQKKAAKMAEVERKKKEKEAAAAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJT8	ATP-dependent DNA helicase II subunit 2	0.83	568-584	DVKKVPPKVKGRGQRQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPU4	DUF4050 domain-containing protein	0.915	83-94	ARDARRRRRKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT07	VEFS-Box domain-containing protein	0.936	437-447	SRPRRRKKRFA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS2	Uncharacterized protein	0.949	322-347	KKQRSSLQAKPEKPEKPAPKPRSRPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS2	Uncharacterized protein	0.692	223-228	KKRRES
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVW4	Uncharacterized protein	0.622	171-173	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXJ7	Uncharacterized protein	0.836	407-427	RRTSVGTRRVTRQEARRRRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1K0	Uncharacterized protein	0.627	77-80	KSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2R3	Uncharacterized protein	0.737	175-183	RSPRKRQRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3A2	Uncharacterized protein	0.912	427-440	KKSRMPRRRPRPDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3S4	Kinase	0.924	1387-1401	RKAPKKKKTSKDKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3S4	Kinase	0.782	365-372	RKPRKKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3S4	Kinase	0.689	999-1006	KKREGKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3S4	Kinase	0.62	99-104	RNRHSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5I9	Uncharacterized protein	0.976	316-335	RPNKKNRKKKAAAAAAAAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9J0	PWWP domain-containing protein	0.991	99-128	PKKTTNGKRKSGAGVPEHKKKTPAKKGKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9J0	PWWP domain-containing protein	0.991	329-366	ENDKRAKTPKTKLKLTTKTPKEASAVKPKKEPKSKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9J0	PWWP domain-containing protein	0.961	313-325	KKKATKKRKKTDE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9J0	PWWP domain-containing protein	0.76	279-290	KKEKAEKSAKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGV4	Flap endonuclease 1	0.997	306-342	KASLKRKADEKLEEKKKKQKADAKAKKQAKAKPRTAG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK68	Uncharacterized protein	0.969	590-622	KPQPKPKVKKPSKPLTKTRSSILPEKKNTGRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK68	Uncharacterized protein	0.736	496-504	KRPRGRPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK68	Uncharacterized protein	0.656	529-533	IKRKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK84	Uncharacterized protein	0.651	16-23	KPPKTRPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.995	552-571	KKKTKAAAAAKPKKAKKAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.967	7-26	KSKKRKGASEAAPKAKKARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.892	459-470	PAKKGKKGAKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.882	492-501	KKSKKDKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.864	69-78	KPKKGKKSKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.807	431-439	KAKKGKKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.795	125-134	KEKAKKTKKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.748	103-111	PKKQGKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.72	158-166	PKKAKAAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD1	RRM domain-containing protein	0.65	525-530	RKSKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB8	Uncharacterized protein	0.636	414-419	PRNPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRD1	Zn(2)-C6 fungal-type domain-containing protein	0.698	834-842	KHARKNKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW8	Uncharacterized protein	0.978	545-579	WKWKGKAHTLAAHEKPGTDKNKSKAKSRIRRGKHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW8	Uncharacterized protein	0.787	206-217	KPKEKGKEKSKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW8	Uncharacterized protein	0.735	2232-2249	KKYLRRLRHTKSRISSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW8	Uncharacterized protein	0.657	344-347	RRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTD7	Uncharacterized protein	0.748	102-114	KGQKAKEKRLLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX69	Uncharacterized protein	0.705	62-71	RSRGRPNKPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXT4	XPGI domain-containing protein	0.695	96-102	PWKRGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S033	Uncharacterized protein	0.669	180-190	KKDGDKPKDKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S033	Uncharacterized protein	0.6	165-165	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I3	Uncharacterized protein	0.722	17-25	RNPKKRPAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4P1	BRCT domain-containing protein	0.821	26-34	PKRGGKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4P1	BRCT domain-containing protein	0.809	204-234	PTPRARKPAVPKASEAAPIGAARATRGRHAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4P1	BRCT domain-containing protein	0.784	241-252	PLKAPARKPAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4P1	BRCT domain-containing protein	0.624	97-102	KRATRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5H3	Spindle pole body component	0.869	514-526	AILKRRRQRAAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6N6	Uncharacterized protein	0.868	257-267	PRKRIKRSKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7B2	Deacetylase sirtuin-type domain-containing protein	0.988	34-68	RKHKGHRQQAQQDRPWRNAEKGRKGTGKGKGKRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7C2	Uncharacterized protein	0.923	562-585	SGKILRRLLRDREKEKRRQAGGKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7L6	Uncharacterized protein (Fragment)	0.995	33-49	EKPKAKKKRHAKKGSKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z0	NUC173 domain-containing protein	0.993	1205-1282	KAKSGSGMGRGALKNGRGGQKPQRRALGQEKSRGGNVSGGEGRGGAKGRVEKTKSPRGRGGHGGFRGRGMGGKWSGPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z0	NUC173 domain-containing protein	0.878	998-1009	RKTREQRKKKKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z0	NUC173 domain-containing protein	0.719	205-213	KSRKNKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAV1	Peptidylprolyl isomerase	0.946	376-426	APKPEAKKEAAKGPRNVSGVIVDDKKEGKGKAAKKGDRVEMRYIGKLKSGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAV1	Peptidylprolyl isomerase	0.875	319-345	KLSKKQAKKLKKNDGQATEPEKKAEKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG3	Dolichyl-diphosphooligosaccharide--protein glycotransferase	0.977	732-748	KGHKKKRSTKRKGPRVL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGE3	Uncharacterized protein	0.983	243-274	KRKELEHRGRDDASLKSSRSPKRIRSKSKERK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRH4	Uncharacterized protein	0.624	106-108	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU32	Reverse transcriptase domain-containing protein	0.848	607-616	KRRVRARKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVK8	Uncharacterized protein	0.68	53-57	RRRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS1	60S ribosomal protein L27	0.707	56-65	SKTKQAKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVV7	Uncharacterized protein	0.866	284-292	QRRGKKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVV7	Uncharacterized protein	0.745	381-391	TRTSRSNKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVV7	Uncharacterized protein	0.607	371-372	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWJ3	Uncharacterized protein	0.943	592-604	EDRPKKPKQKRKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWJ3	Uncharacterized protein	0.924	336-360	KVKAQPPAIWRRAEREERNEKRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWJ3	Uncharacterized protein	0.917	458-467	KKRGRPPKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP8	Spc7 domain-containing protein	0.941	87-101	KKRREARRKSLARRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP8	Spc7 domain-containing protein	0.914	681-714	PKKSQTPQKQQTPKQKTPTPKKATPRKSMSPKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP8	Spc7 domain-containing protein	0.877	1222-1233	RLKKTGRKGERK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP8	Spc7 domain-containing protein	0.792	33-45	SPKKSSRKTRSKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP8	Spc7 domain-containing protein	0.687	374-381	RRKSLKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWR7	Uncharacterized protein	0.835	528-550	GKIKRKLMKEWAKKDAEKMNRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWZ8	Uncharacterized protein	0.999	169-233	KERKRTRKGKKARIAIRQKLQASKEKQTEQARLAQEKAEAEREKRTRRNREKKLKKKAKGQAKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY62	Uncharacterized protein	0.988	690-730	RARRRRDKDRRGAGDRDRERERERDRERDRYSKKSHTGRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S040	Uncharacterized protein	0.695	405-411	KSKKHRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0G2	Transcriptional adapter 2	0.973	156-174	ARKKRRIEKKKEEAAAREP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S9	SpoU_sub_bind domain-containing protein	0.678	219-228	RNGRSPRPRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S9	SpoU_sub_bind domain-containing protein	0.648	86-92	KRSPKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3R3	Uncharacterized protein	0.944	279-293	KRRGRKKSSSGKARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4H1	Structural maintenance of chromosomes protein	0.976	100-119	RRAASPSKAVPKKRGRKPRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4H1	Structural maintenance of chromosomes protein	0.938	52-79	KTGRGRGRPKKAPAQDAEATPKPAARRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCJ8	Uncharacterized protein	0.876	56-62	PKKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ3	Transcription initiation factor IIF subunit alpha	0.964	511-523	GKKRKKDKKEKNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ3	Transcription initiation factor IIF subunit alpha	0.959	467-483	SGNESSRKKHKKKHSEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ3	Transcription initiation factor IIF subunit alpha	0.75	453-462	KSKKRPGSPN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ3	Transcription initiation factor IIF subunit alpha	0.664	128-137	GTKKPPAFHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ3	Transcription initiation factor IIF subunit alpha	0.61	114-115	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDV4	Uncharacterized protein	0.602	518-519	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA4	Mitochondrial GTPase 1	0.963	315-332	KKMERERRRERNKARGEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG31	Uncharacterized protein	0.938	39-50	PSKKRGRKPKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG31	Uncharacterized protein	0.703	545-551	KPKRSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI08	Uncharacterized protein	0.98	189-206	AKIERRKQRLEKKRAKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKS2	Uncharacterized protein	0.981	195-218	SKEKEKIGKRRRKSRSHCAILRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLC3	Thioredoxin domain-containing protein	0.983	252-276	PKEKKSKPKKDTKKESKSSSKFAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN18	HMG box domain-containing protein	0.941	192-206	SPRKPGQKKKRQSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP42	J domain-containing protein	0.661	277-280	KRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSH5	zf-primase domain-containing protein	0.763	34-45	RKKYERRRERNS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSH5	zf-primase domain-containing protein	0.647	206-215	NREKEREEKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT35	Uncharacterized protein	0.612	582-583	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUP4	Uncharacterized protein	0.662	519-535	SGPPAPPPPPPPGGAPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUP4	Uncharacterized protein	0.64	461-474	PPPPPPPPPPMPGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUP4	Uncharacterized protein	0.616	286-292	APPPARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWC5	Uncharacterized protein	0.999	146-178	VRKGKSKGESKGKGKGKRKPDRPKAIDKKQRIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWC5	Uncharacterized protein	0.73	308-315	RTRKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S025	RNase III domain-containing protein	0.939	379-468	KQRRKEARKERERMKLLQEQENKERQREKDKEIALQKAKKQEIQKEKEKQKEHEAHIKELEAQEKRKLEDHRNKELKAQRQKELKAQKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S025	RNase III domain-containing protein	0.697	729-740	KRLERRVKLREQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8A8	Uncharacterized protein	0.908	137-156	VDRKKLEKAERKLRAKQDRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8P3	Uncharacterized protein	0.892	9-43	PRRSIRQRRPPERARASPSSEQVIPRKRRVKQEPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S979	Palmitoyltransferase	0.689	580-588	KKSERRPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAS0	Uncharacterized protein	0.909	118-130	PKKTLKRKKTKPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCJ6	WD_REPEATS_REGION domain-containing protein	0.862	255-272	RRTPKRLFWRKGNKNKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCM7	Uncharacterized protein	0.964	84-97	LRWAAKRKAKKRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDF7	BZIP domain-containing protein	0.765	185-200	RRRNTAASARFRIKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG13	HECT-type E3 ubiquitin transferase	0.847	2752-2779	AEVARKIKEEQEKKEQKEREEREKREAQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG13	HECT-type E3 ubiquitin transferase	0.782	3195-3206	RANRKGKAKESK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG15	Cutinase	0.789	233-242	IKARKAKREA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI66	Uncharacterized protein	0.909	616-628	IRRHKKTKSGSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIS6	Ubiquitin carboxyl-terminal hydrolase	0.684	84-91	RTRKRVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT3	Uncharacterized protein	0.889	461-472	SSAAGKKKPKKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTA2	Uncharacterized protein	0.841	38-52	KPASKPRPQRRSPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVJ0	Uncharacterized protein	0.997	81-109	ARHAHQRTRKYSKRKDSRRKRRGLDKKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW17	Uncharacterized protein	0.787	86-110	KQRQREQAERKAAKKDPMENMGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX89	Zn(2)-C6 fungal-type domain-containing protein	0.648	586-589	RRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYM9	Uncharacterized protein	0.996	1110-1133	GRRGAEIAKGKKKSARGGRGSKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYM9	Uncharacterized protein	0.923	901-915	TPLPRGKRAKAKKQA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYM9	Uncharacterized protein	0.67	189-194	KKAKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYM9	Uncharacterized protein	0.626	343-348	KKLEKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ09	Uncharacterized protein	0.982	96-114	KAAKKAARKAEKKRAKALA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ09	Uncharacterized protein	0.924	63-79	AKAERKAAKKAAKAAKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ09	Uncharacterized protein	0.915	23-34	RKKSKKDKSKKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1A4	Deacetylase sirtuin-type domain-containing protein	0.997	484-511	ANKGLPKRPKAQPKKAAAGKKKSKKEPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1A4	Deacetylase sirtuin-type domain-containing protein	0.657	80-83	KRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1U5	Uncharacterized protein	0.928	332-345	KRRKARSSRRRERL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Q7	Uncharacterized protein	0.977	10-22	PRKRRRRRRLDRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8S5	Uncharacterized protein	0.912	665-686	KKKGMSRWARVKAGWKRRFGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9I7	Uncharacterized protein	0.999	140-171	SKAKAKRKRDKYAKRRKEKRLERGLPRRRGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REU7	Uncharacterized protein	0.953	534-566	PPKKASKKAAQPKVKALAPAASSKANAKPRKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REU7	Uncharacterized protein	0.873	636-642	KKKKRKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REU7	Uncharacterized protein	0.731	611-620	NGAPKAKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REU7	Uncharacterized protein	0.725	414-430	TKEKLKEKEAKLERADR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI20	Integrase catalytic domain-containing protein	0.737	208-215	GHKRKREA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI20	Integrase catalytic domain-containing protein	0.663	381-386	KRGPKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP92	Uncharacterized protein	0.798	44-55	RRRRKTIWRRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW10	Uncharacterized protein	0.994	474-505	AVKKKRKRPASPSASDKKIRPKTPVSRSKKRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW60	PCI domain-containing protein (Fragment)	0.745	206-212	KEKKKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW60	PCI domain-containing protein (Fragment)	0.669	818-827	NRGGRGGGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S234	MPN domain-containing protein	0.673	104-109	RIKKRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3C4	H/ACA ribonucleoprotein complex subunit CBF5	0.999	447-492	KKSKKRKSRGDGEEEADEDKAERKKKKKEEKAAKKAAKKDKRKSKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4D7	Transcription initiation factor IIE subunit beta	0.952	233-245	SGRKKKGPRRGGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5V7	Uncharacterized protein	0.871	279-296	RKREEKREEKREEKRGMS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9R5	PH domain-containing protein	0.689	446-458	KRRKSDKDVFKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAL8	BZIP domain-containing protein	0.945	44-74	PRKKPKKVNSEIRKQQNRIASRNYREKRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR8	Enhancer of mRNA-decapping protein 3	0.975	240-261	GKKTRRGGKSRKKELAAQERKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLN0	CUE domain-containing protein	0.992	582-613	GRGGRGGGRGRGRGRGRGGPGGGRGGASVAGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLN0	CUE domain-containing protein	0.892	620-649	QISRQRKEANKSSSANHNRKAQRGKKMARA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLN0	CUE domain-containing protein	0.829	292-305	RPKRLIRRKVDKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLN0	CUE domain-containing protein	0.603	617-618	KG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNR0	Uncharacterized protein	0.949	1083-1108	ARSAHDVRSRNKLKKEKEPRFHRRSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPM9	Uncharacterized protein	0.901	168-176	SKKKKEKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPM9	Uncharacterized protein	0.744	140-147	KKPRKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPM9	Uncharacterized protein	0.632	374-378	RPRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU46	Uncharacterized protein	0.932	444-462	IRKAIRESRSLRPKKKPAG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU46	Uncharacterized protein	0.82	194-208	KRRLEYKRNPRRPRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUW3	Uncharacterized protein	0.961	34-64	AKRKRAPPPPRPDMRQRFPKERHELETKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUW3	Uncharacterized protein	0.734	637-652	TKKSQKPKTDKDKMEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUW3	Uncharacterized protein	0.693	594-599	RRRKNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1V8	Uncharacterized protein	0.737	107-115	GKGKGREKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S338	Uncharacterized protein	0.78	254-263	KKRAPKRLLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K0	Dihydrolipoyllysine-residue succinyltransferase	0.921	198-241	QKPQPTKESKPQPPKKESKPQDEPKPATPGSREERRVKMNRMRL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S841	Uncharacterized protein	0.992	702-713	AKRAKRKGKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8K8	Uncharacterized protein	0.654	44-50	GKTKKVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAI8	Hydrolase_4 domain-containing protein	0.997	429-463	RPERHEKPEKPEKPEKESKEKKEKKSSSRRKHGGS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDA1	Uncharacterized protein	0.976	1531-1561	RAAKAATRGRGNKTRSGRGGKAKGQEKKDGV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDA1	Uncharacterized protein	0.927	1596-1625	GGRAPGQENAGRGGRGRIGRGSRAGARGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDA1	Uncharacterized protein	0.614	1566-1568	RGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF98	Uncharacterized protein	0.826	97-103	PKKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI14	GRIP domain-containing protein	0.987	509-525	AKKRARNKKNKKGGKGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ53	Uncharacterized protein	0.829	457-470	RKKMKKLFKVKQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ53	Uncharacterized protein	0.72	610-623	RARKLRDLQRIKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPK2	Uncharacterized protein	0.748	662-667	KKKRRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQU1	Uncharacterized protein	0.965	137-175	PKLPPRKRAEIRTKPVKSSTREAPRRRDAHQKHGERRGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU52	Uncharacterized protein	0.774	337-370	RPPPSRSESQRDRGDRSDRSQRGSQRERERSRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU52	Uncharacterized protein	0.756	433-444	KSRRRSPARSTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXL2	Zn(2)-C6 fungal-type domain-containing protein	0.769	4-15	PKKPGVEPKKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4P8	Uncharacterized protein	0.946	221-237	RETKERKKPRKIEVRKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6D3	Uncharacterized protein	1	105-140	VKEKKKNKNKEKNKRKKKKREKEKEKERDKGKKKRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6X3	Histone-lysine N-methyltransferase SET9	0.867	649-660	AKKKRVGRARKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA27	Mediator of RNA polymerase II transcription subunit 17	0.951	68-79	KEEEKKKKKKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCB6	Homeobox domain-containing protein	0.826	168-184	KRRRTSNSPSKTGKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCJ4	WD_REPEATS_REGION domain-containing protein	0.828	36-45	GSKKRKREGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDY1	Uncharacterized protein	0.819	1704-1710	KKKKKGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG4	Uncharacterized protein	0.741	309-316	ERRGRRRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG4	Uncharacterized protein	0.615	676-677	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFZ6	Uncharacterized protein	0.939	334-349	PKAAKRAKKGWRASKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHB4	Uncharacterized protein (Fragment)	0.814	9-34	KGGIPPGSSKNKKNSPKASSTLPKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHB4	Uncharacterized protein (Fragment)	0.778	166-180	LKKAKKDEQKRIFLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHP1	Uncharacterized protein	0.925	976-1012	RHHEKELEKEKEGEEKKKHGLLGFLHRDKSKREKKDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLR2	Uncharacterized protein	0.986	91-136	RAVKRRQHMSPKAMEKTASKLNGKKRAFKATRWDRRKSVLPRKKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLR2	Uncharacterized protein	0.926	746-765	PKKKKAKTSKDSTPKVRRVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLR2	Uncharacterized protein	0.831	609-626	RSSRRSSRTKKSRLPAPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLR2	Uncharacterized protein	0.784	40-60	GWERKQEVKRLGQGKEKKIWR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM71	Uncharacterized protein	0.694	176-187	RSRHGHRSRSPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN0	Glutamate decarboxylase	0.666	527-534	LKKEHKHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ48	Uncharacterized protein	0.874	365-378	ARDRKASRKAGRKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ48	Uncharacterized protein	0.815	171-180	PKRRRAPPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS29	26S proteasome regulatory subunit RPN2	0.694	934-944	RRRMVKERQKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS80	Uncharacterized protein	0.828	184-191	KKKKRRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY7	Uncharacterized protein	0.986	77-105	KAAREKKLGKKAPSKTGNSARTRKVRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVN1	DNA polymerase	0.699	772-782	GKQRKVAKSKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZD2	Uncharacterized protein	0.831	276-283	GPKKRKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U5	Myb_DNA-bind_7 domain-containing protein	0.989	345-356	RRKPKPKKRRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U5	Myb_DNA-bind_7 domain-containing protein	0.976	279-295	RKRPGAKSRPKKKATEP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U5	Myb_DNA-bind_7 domain-containing protein	0.963	304-318	PAIPKRTKKPRKPKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U5	Myb_DNA-bind_7 domain-containing protein	0.946	674-685	NGKGKKKRGKNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U5	Myb_DNA-bind_7 domain-containing protein	0.865	374-384	REKKRRGRPPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U5	Myb_DNA-bind_7 domain-containing protein	0.846	237-250	ARRSRQPPRPRAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U5	Myb_DNA-bind_7 domain-containing protein	0.805	31-43	KKFAPKAARRRPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S220	Ribonuclease Z	0.936	1091-1107	KANGKKKQKKQKDKCKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S220	Ribonuclease Z	0.623	202-205	RGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S374	Uncharacterized protein	0.907	210-222	KAPPTRKKRKIPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I9	INCENP_ARK-bind domain-containing protein	0.835	849-872	APLREPRKLAKPSSKDGIHKAKAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I9	INCENP_ARK-bind domain-containing protein	0.761	69-81	KLRGKTPRTARKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I9	INCENP_ARK-bind domain-containing protein	0.746	710-738	RTRSSTEREKQKERETREKEVREAKQEQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I9	INCENP_ARK-bind domain-containing protein	0.64	742-753	RLKQMREKEQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S635	Uncharacterized protein	0.999	157-220	KRKAAEAAAEESKKRVWTKAWPKNSDRLKKKKKKFRYETKTERKAERMKQGMKKRKQKEARTSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S635	Uncharacterized protein	0.883	35-65	KRKLARIKHAQEENAKREKEEKLKFRRELRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6A7	Uncharacterized protein	0.999	90-109	KPSKKSKKKKKKAKNKGKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S871	DUF1996 domain-containing protein	0.895	470-484	KRRRHAHKHRREHGV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDV3	CCHC-type domain-containing protein	0.963	339-353	KQPKKKGGKKAKAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM8	Uncharacterized protein	0.674	220-231	KKRINKIKIWRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ54	Uncharacterized protein	0.972	1943-1967	KGPKIRRRPRPPQDPFIKNKKPKSG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ54	Uncharacterized protein	0.608	947-948	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJW5	Uncharacterized protein	0.66	204-209	KRRQRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL88	Uncharacterized protein	0.727	263-268	RKKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM48	Zn(2)-C6 fungal-type domain-containing protein	0.734	72-82	RRRPAKARGDG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU57	Spindle pole body component	0.803	657-667	RARMRRSRKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUP8	Uncharacterized protein	0.755	114-119	KKRRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVP3	Uncharacterized protein	0.971	104-219	NKKEDRPEKGSGKLTKKDHTPPESKGKNARPQNPSSESSKKGEISPGSSKKKKNTLEKNSSKSTEKGETPPGSKGKNARPQNPSSEFSKKGGIPPGSSKNKKNSPKASSTLPKKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVP3	Uncharacterized protein	0.778	350-364	LKKAKKDEQKRIFLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX96	RRM domain-containing protein	0.999	194-290	RKMKKQKQREKERAKRKDRHGRRDRSRDRDRHRDKDRKRIKDGEENRDRRHRSERTRDRSEDSRDRRDRHRKRERRRSDSDEDTKPSRAKGSRSPLP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0S0	Serine/threonine-protein phosphatase	0.728	122-128	KRKMKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S363	ASXH domain-containing protein	0.991	108-168	TSPSQKPAPKKPTPKKIATKRATPAPPAPSSRPSRNRKAPERLENVQEKPKPKPVPNKKGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5C5	Uncharacterized protein	0.644	399-407	KKQKEIRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M8	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial	0.958	60-74	DAAKEQKKVKKKKRW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6H7	Choline_kin_N domain-containing protein	0.978	140-156	HERSRRHARRAKRKAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8D5	Uncharacterized protein	0.811	140-153	RKKRLDLKGKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9P4	GRIP domain-containing protein	0.896	19-29	SQKKKNKKKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCA6	Uncharacterized protein	0.706	39-46	QSKPPKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD78	Uncharacterized protein	0.998	113-150	KHKEELEKKDKEKTEKNRLKREKARLRKEKAKKGAKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD78	Uncharacterized protein	0.626	19-23	RPTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REW5	Uncharacterized protein	0.805	12-31	KKPIAKPTKTPTKKNMPKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG42	Uncharacterized protein	0.928	347-371	PRGTPAPESGPPKRKPRAPPVPAQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG42	Uncharacterized protein	0.794	274-282	AKKPQKRKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG42	Uncharacterized protein	0.703	307-312	NKRKKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKE2	Uncharacterized protein	0.942	542-593	GRGGGGRGGPTARGGQNQRGRGQQGGGRGGAPRGGGAPAARGRGNIARTGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKE2	Uncharacterized protein	0.603	37-37	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQM7	Importin subunit alpha	0.794	24-50	ELRRRREEQQVEIRRAKREENLAKRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRK9	Uncharacterized protein	0.777	418-423	ARKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ73	Zn(2)-C6 fungal-type domain-containing protein	0.923	17-35	AKKGRRGKREAGSDESKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1B9	G-patch domain-containing protein	0.804	164-212	KRDKLGLGIDKKDHQKRRELGGASRADVREARLDAGKVRKLAQVEKKRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S205	FACT complex subunit POB3	0.695	551-556	PKKKQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S434	Uncharacterized protein	0.913	435-449	AKPKKKGNKSRENSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8N6	DNA polymerase epsilon catalytic subunit	0.798	1284-1294	KIQKEARKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCW8	Uncharacterized protein (Fragment)	0.686	501-510	RPGGNKRMKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE1	Uncharacterized protein	0.673	11-15	KKRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK32	Uncharacterized protein	0.896	580-598	RAARSPVRTRVGGRPKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK32	Uncharacterized protein	0.843	505-531	RASRQASRDGRTPRHTKKRLSSPHAHP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK32	Uncharacterized protein	0.617	535-539	SPKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPX6	RING-type domain-containing protein	0.97	699-711	KKQAGGKKKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPX6	RING-type domain-containing protein	0.944	545-568	IERRRKKHTEKETKEEKARQRAEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPX6	RING-type domain-containing protein	0.704	349-372	IRVAKEKLKGIGNPPEEPAKPAEP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRJ5	Uncharacterized protein	0.969	26-73	TRSHKKHQDSRRRSRSPHRDGDNDNHRHKRRRTRSPVAKPVALPYKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRJ5	Uncharacterized protein	0.91	294-331	KKKKKEQERQKNEREIRREEIARARDAERDERLAERRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSY1	Uncharacterized protein (Fragment)	0.995	30-63	IKARRLRKVASVKFKDKKRKLIGLKLKDRARGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWM5	Uncharacterized protein	0.718	116-122	KRRRARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXL5	AP-3 complex subunit delta	0.99	1004-1041	VKKKKKKVKVDGDKEKAGEEVGEGEEEGKIKKRRKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXL5	AP-3 complex subunit delta	0.922	968-976	KKKKRKVRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Y5	PAN2-PAN3 deadenylation complex subunit PAN3	0.638	134-138	RRKTP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1I6	Uncharacterized protein	0.979	692-708	KPGKEEKEEKKKKKKLH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3M5	Uncharacterized protein	0.84	1071-1083	RIRRKKDDARRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S419	PSP domain-containing protein	0.88	7-24	KGKKQANKNAYRRAKKKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S419	PSP domain-containing protein	0.786	558-566	RKRAKREGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S730	Uncharacterized protein	0.8	95-106	KRARAKSRRPGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7N7	Uncharacterized protein	0.951	167-184	KVKKSSKRPPAKRANKSS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8T2	Uds1 domain-containing protein	0.906	335-348	RGRPKRRNSKRERS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGY6	Inheritance of peroxisomes protein 1	0.904	188-206	RPKSPPRKVVKRKPSGQAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP32	Nucleolar protein 9	0.979	3-21	KEHKKRGRREDQKKRKRDH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP32	Nucleolar protein 9	0.879	669-684	AKAAQAKDGKKPKKGS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT27	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.961	436-454	GEKGVKGEKKKKKMEGVPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT27	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.918	80-90	RGKSKKRKRDG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT27	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.872	203-211	PKKRKRKLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT27	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRM61	0.658	425-429	ARKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTD9	Uncharacterized protein	0.981	100-132	TPKKPPTPRKRAPKKQDVDGESSPKKKPTRGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTD9	Uncharacterized protein	0.789	77-88	KKTPRKKAAAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTE3	C3H1-type domain-containing protein	0.845	249-288	KARRKNFPAQKRIIEKAEEAARKRAAELDFLRKLHGKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTE3	C3H1-type domain-containing protein	0.845	306-328	KEDKAKREKEKQRQGELAALRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS0	WD_REPEATS_REGION domain-containing protein	0.981	386-439	PEIKRIDRHRHLPKTVKKAGEIKAEEIKSIKRKEENVRSHSKKGSVKRKAEREK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWR9	Zn(2)-C6 fungal-type domain-containing protein	0.623	727-730	RGRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZA8	Uncharacterized protein	0.961	1048-1073	NRKEGKRTKLKRVAKLGSKGRSVVFR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZH3	BTB domain-containing protein	0.742	15-29	RSGKITKQPKRSHRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S086	Uncharacterized protein (Fragment)	0.988	150-170	EGSGKRRGKEKKDKEKARFKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4B0	Serine/threonine-protein kinase	0.966	2009-2037	APPARPVNGAAGGKPKPPAPPAKRPAARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4B0	Serine/threonine-protein kinase	0.899	1824-1860	PTPKGKQIAAKPITKGKLLRPGGPGGGPSKLASRPAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4B0	Serine/threonine-protein kinase	0.747	489-508	RVPREARPTTRARAAKEPAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5J8	Uncharacterized protein	0.714	589-598	RRPKWMKRNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7J8	Exocyst complex component Sec8	0.663	130-136	KRRSGER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Z9	Uncharacterized protein	0.974	205-219	GKGKKKKKPIVPRPT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S988	Uncharacterized protein	0.933	669-686	PGKKKGPAVAPKRGAKKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S988	Uncharacterized protein	0.678	336-341	LEKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA31	Uncharacterized protein	0.988	83-97	KKAQKNKKKKKKGLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA31	Uncharacterized protein	0.772	481-505	RKDPKKRLGFNRAKDLQTIKKHRFF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCE8	Uncharacterized protein	0.977	930-945	GKFGGRLEKKKKKKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCE8	Uncharacterized protein	0.722	860-870	RREKRQQRKAE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCE8	Uncharacterized protein	0.699	69-81	TKTKQRTGVRKRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCR0	MCU domain-containing protein	0.969	494-508	LKKERKRKEDKKKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ88	Uncharacterized protein	0.963	135-166	KKAAEKLKAAVKPLNKAQQRTARKKERERKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ88	Uncharacterized protein	0.636	372-374	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM02	Uncharacterized protein	0.945	513-531	SEKSKKAARGRPLKPKNGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPD1	Uncharacterized protein	0.826	440-457	SPRAEARKRRSIHIPAPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI7	Protein kinase domain-containing protein	0.894	192-202	KPVKKKKIKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQF8	Uncharacterized protein	0.927	625-637	RKKRGPYKKKIKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQV4	Uncharacterized protein	0.855	1087-1099	AGRSAKSSKRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS5	SprT-like domain-containing protein	0.841	461-475	PKKKPTSRGPVKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS5	SprT-like domain-containing protein	0.821	110-118	EKKKRERRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS5	SprT-like domain-containing protein	0.633	386-388	KKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUX9	Uncharacterized protein	0.969	126-147	KVNHKKLKVVRKKDKKAEQRKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUX9	Uncharacterized protein	0.884	394-405	RDPARKRARPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY41	Uncharacterized protein	0.774	35-46	RKPKRPPPITPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1L6	Uncharacterized protein	0.998	319-335	RKRKAKGKKIKKARAKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1L6	Uncharacterized protein	0.839	364-375	KNRAAARKKAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1L6	Uncharacterized protein	0.731	249-256	PLPRKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S273	Uncharacterized protein	0.875	314-350	RGRGGPYRGRGGPPRGGPGMYGPPRGGGYGPPRGGPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S273	Uncharacterized protein	0.843	671-685	GRGRGRGGGARGRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S273	Uncharacterized protein	0.658	183-187	KARKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2E5	40S ribosomal protein S8	0.977	51-99	RHKRSASGAKRAYYRKKRAFEKGRQPANTRIGTKRVHLVRTRGGNRKFR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2E5	40S ribosomal protein S8	0.792	166-188	RRRQAKAGEKEEDKKKSNSVTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S301	Peptidase A1 domain-containing protein	0.69	468-474	KRRASKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3V7	DNA ligase	0.999	106-144	PSKRQRRKPSEEKEKPKKKTAVKPKAEKSPAKSKKATAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3V7	DNA ligase	0.963	160-177	KVAKGKKKAAAKPKAAEV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3V7	DNA ligase	0.864	180-196	GEAAAPAKVAKGKKKEI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4E8	Phospholipid-transporting ATPase	0.997	729-753	KQKKKPIHKTRKKGKQPAKSRKSFR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCL5	RRM domain-containing protein	0.921	17-36	SKSSRRGRAGRRSGAGRPAT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REG7	Uncharacterized protein	0.736	144-159	RRSRSRSRSPVRREAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REG7	Uncharacterized protein	0.659	170-182	RRDERRGGYGRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI4	DDE-1 domain-containing protein (Fragment)	0.994	229-314	SNRKLKQKLDTKKKAAAATRRKEAAERARLKREEVAKRKAERERQKQERDAAEAIQLPQRGKRKVSQSPAPRKKQNRGAAAARSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI1	Bac_luciferase domain-containing protein	0.989	3-28	KRKRESGSEAAKNGRRKSGRGKPGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJX4	Uncharacterized protein	0.99	266-283	RRANRAKPKAAPKRTRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJX4	Uncharacterized protein	0.77	206-222	AKGAKGARTAKTGKGAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKC8	Dolichyldiphosphatase	0.659	270-273	KKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLU9	Uncharacterized protein	0.615	118-119	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RND0	Uncharacterized protein	0.922	186-207	LKGKEGKVVKAKQRRASIKRPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RND0	Uncharacterized protein	0.685	22-30	LRKSARKQL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RND0	Uncharacterized protein	0.657	8-11	KKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNX5	mRNA cap guanine-N7 methyltransferase	0.984	9-50	KRTRSPSRSPSRSPPRQRKRPGAGARVSAADREAARKRQQAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUB2	Uncharacterized protein	0.821	4-20	RKKATKRTVKPSNPRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUL0	Uncharacterized protein	0.984	48-73	KEWGLMRHKPRKTHRRAKHSGRHRSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY96	Uncharacterized protein	0.617	204-208	RRHAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1H3	Uncharacterized protein	0.891	43-64	GSSKHPKSRRPLAAPKVQKRPH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1V2	Uncharacterized protein	0.694	52-57	RKRRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S493	Uncharacterized protein	0.721	135-145	RKQQKEERKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RID0	Ribosomal RNA-processing protein 36	0.984	266-328	REHKKKEKELVKEGKKPFFLKKSEQKKIALVDRFQSMKAKQRDKVIERRRKKVTAKERKNMPD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RID0	Ribosomal RNA-processing protein 36	0.914	115-136	KAEKLANGAQPSKKAKKSKTKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ21	GlcNAc-PI synthesis protein	0.946	494-506	PRKRSSRHRKPKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKN9	Uncharacterized protein	1	188-201	EKKKKKKKKKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF8	Uncharacterized protein	0.686	292-298	RRRPRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM61	BZIP domain-containing protein	0.892	100-118	QPPKRRGPKPDSKPALTRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNU9	Uncharacterized protein (Fragment)	0.763	48-60	PRTPSNRRGKGKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR17	Uncharacterized protein	0.878	3-11	KRKTRKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRM8	tRNA(His) guanylyltransferase	0.699	704-709	DRKKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS81	Uncharacterized protein	0.968	395-411	KSKERRRRRRIPTRAPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS81	Uncharacterized protein	0.833	229-239	RRRQKARPKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW9	Uncharacterized protein	0.836	39-46	KRKKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUN5	Nascent polypeptide-associated complex subunit beta	0.857	206-218	KGTPRRKVKKVHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUW9	Uncharacterized protein	0.79	24-56	LQRHLRKVASRQALKGGGKDAGTQRKASLKRPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVC1	CUE domain-containing protein (Fragment)	0.961	105-164	KKVKDRSRSKAKENIPIDGASSLRGRPDGARRGLDSGRGGRGGRGTDRGRGGIRGGRGGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW71	Uncharacterized protein	0.798	148-164	RLRRDPKLKLRMTKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWL3	Uncharacterized protein	0.814	262-274	KVREAKRLEKKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWL3	Uncharacterized protein	0.681	310-315	RKGKHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWV7	Uncharacterized protein	0.977	4-19	KKRKRGEKNGERPKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWV7	Uncharacterized protein	0.774	431-439	GPRAKKRSG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXX3	Uncharacterized protein	0.783	1139-1148	SKSRKKTRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX1	Uncharacterized protein	0.877	475-493	SPRRNRRSFGGGRRRSSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S118	Serine/threonine-protein phosphatase	0.669	566-571	RRVRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S337	Deacetylase sirtuin-type domain-containing protein	0.959	322-340	KPTRKRKRASNGNGSRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4W7	Reverse transcriptase domain-containing protein	0.711	1185-1214	RKRSHQPPPPTSRHHHIERSRAAQARLRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S743	Uncharacterized protein	0.865	445-460	KARRPRNSRFRHRRTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S743	Uncharacterized protein	0.734	916-926	LRERDEKGRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7A0	Uncharacterized protein	0.671	4-11	KRKSKAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7A0	Uncharacterized protein	0.666	238-246	GRRLPGRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7A0	Uncharacterized protein	0.626	182-184	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7X3	Uncharacterized protein	0.962	133-155	DKRVEREKKKEAREKEKAEKAAD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAA5	Tyrosine--tRNA ligase	0.848	397-410	PAVKKEKKVKNKGT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCS5	Uncharacterized protein	0.972	379-393	KHTKPRKGGRRGKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCS5	Uncharacterized protein	0.676	109-113	HRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF67	Uncharacterized protein	0.661	286-296	RSSRSPRSPRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFZ9	Uncharacterized protein	0.998	240-272	RKRSVRIKANEEKKRLRNAGKKNSKPKARKARA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG37	Histone acetyltransferase	0.968	377-410	KPKKKIVLPTREQERQERRRQRDRERRERNRRAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG37	Histone acetyltransferase	0.874	329-346	RLRPARARRGQPKRTDKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG37	Histone acetyltransferase	0.787	888-900	KRRPGRPFGSRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG37	Histone acetyltransferase	0.727	272-277	TRKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGN7	Uncharacterized protein	0.936	531-542	GPKRRKIRGRRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJX1	DUF4210 domain-containing protein	0.987	471-486	RRRKEKKKRRSTSPKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK98	Nitrogen permease regulator 3	0.983	191-203	KKLKRKKKKPSDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNF6	Glyco_transf_28 domain-containing protein	0.991	781-805	KSIRKREKLKTKKRIVQKRNERKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ71	Zn(2)-C6 fungal-type domain-containing protein	0.671	337-344	PPSNKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT30	Uncharacterized protein	0.747	45-55	KRPSRKAKLPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVK4	Uncharacterized protein	0.813	385-393	PKRPRRRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWT6	Zn(2)-C6 fungal-type domain-containing protein	0.659	80-85	PRKSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXV9	SET domain-containing protein	0.995	105-134	KQRLRREAHSIGERKGRPKAPAKNPKKRPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXV9	SET domain-containing protein	0.79	485-494	PKPRNKKMKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYI7	Uncharacterized protein	0.964	268-286	NRSKSKGRKASRRDKSRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S055	RRM domain-containing protein	0.774	66-76	RDRKKLEKKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1B8	Uncharacterized protein	0.766	373-395	KRRAFEKKQNEKADGKAAAPGKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1D4	JmjC domain-containing histone demethylation protein 1	0.963	338-374	PKPKKQQGWPKGKARGARSSTAAATSSRRKKTTPKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1D4	JmjC domain-containing histone demethylation protein 1	0.657	1487-1498	RTPSRGGRNSKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S404	Uncharacterized protein	0.888	7-24	KPRERKKKQTAKVAVREK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S404	Uncharacterized protein	0.714	335-342	KARTKKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M3	Uncharacterized protein	0.624	110-114	RRIKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5S1	Uncharacterized protein	0.746	60-76	KSRRAEKETGRRLLRRN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA1	BZIP domain-containing protein	0.837	53-64	AQRNYRKKLKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI5	SAGA-associated factor 11	0.996	70-154	AKKGLSRRAFQEVPRELRRRTASHNPQRVPKRLRVRARQEAKEDNTPISRGTSGSGIGKGKKKHLRKEGREKSRQDWEKRAKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI5	SAGA-associated factor 11	0.929	1152-1195	RRKIKKKSSYVKKADRDRSGNNGGGGGGGGGTLKVKLKTGSRPD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI5	SAGA-associated factor 11	0.898	1206-1239	RSEGKRDRENDDGGESPKKKKIKLSLSSGGGGAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI5	SAGA-associated factor 11	0.758	605-613	WTKRPKGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI5	SAGA-associated factor 11	0.622	1198-1200	RKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI5	SAGA-associated factor 11	0.601	8-8	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM6	Uncharacterized protein	0.993	360-409	SKGNAETAAFKKPTKPVGRPKANAEPKSKPASAEPKPKPVPKPKEKSKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM6	Uncharacterized protein	0.953	264-295	PRKRGRPAGAKATAPEKTGKKGAPAAAAQRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM6	Uncharacterized protein	0.932	506-519	RKRSKKSSSKSKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM6	Uncharacterized protein	0.867	238-247	EPAKRGRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM6	Uncharacterized protein	0.658	332-337	KRRGRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFX7	Uncharacterized protein	0.846	459-472	GGGRSAKDRRKRTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH55	Uncharacterized protein	0.947	352-371	GEGRGLGKKAPPPPPPKKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJJ0	Uncharacterized protein	0.987	825-846	ERKKETEREKEEGRIRKKRKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJJ0	Uncharacterized protein	0.95	218-238	PKKEGGEKKKETPKAAPKPKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUE1	ANK_REP_REGION domain-containing protein	0.663	512-519	KVERKARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S306	Endonuclease III homolog	0.939	76-92	KAPKAKKARAAPAKKTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S306	Endonuclease III homolog	0.914	381-391	KAPRKRSTRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S306	Endonuclease III homolog	0.666	47-51	KKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAA7	Uncharacterized protein	0.757	233-242	RLRRRVRGPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAA7	Uncharacterized protein	0.662	195-198	KKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE34	Uncharacterized protein (Fragment)	0.838	1146-1201	RPRPSTSRHSKATPEARKSHRPSHDTQTKERHSRKSIHSRTQSRHSGPIAPRKRHD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE34	Uncharacterized protein (Fragment)	0.775	1074-1085	KRKSKTSKRNSE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE34	Uncharacterized protein (Fragment)	0.707	586-593	RRRRLAKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE34	Uncharacterized protein (Fragment)	0.607	598-598	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REV0	Uncharacterized protein	0.971	1120-1131	SATKGKGKGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REV0	Uncharacterized protein	0.925	149-168	KKSKASKVRKGGAAAERRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFY2	Ras-GAP domain-containing protein	0.998	1408-1464	AIKEKKERGFRGVLPFQRKSKRKDKDKDKEKEKESRKEKEREKERDKENRKDKGKDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG1	Uncharacterized protein	0.873	134-149	PPARPPRLPGRRPRPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHA9	Uncharacterized protein	0.998	215-249	RPKAKKRKGPKGPNPLSVKKPKKDKTSAPRKARPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHA9	Uncharacterized protein	0.988	263-279	REDSAPKKRRRKHKSKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHA9	Uncharacterized protein	0.601	190-190	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJD6	Uncharacterized protein	0.792	35-48	KQKQKQKQKQKKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJE9	WD_REPEATS_REGION domain-containing protein	0.757	187-197	PKSKRLSRRQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKB7	Uncharacterized protein	0.992	312-335	QAAKREREEKKAKKLAKKAAKEAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKB7	Uncharacterized protein	0.965	438-470	VREHWLKGRQVDKKNKKGLKPSARFAKMERRPH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKB7	Uncharacterized protein	0.898	154-167	TLTKRGRGRPKKTP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKB7	Uncharacterized protein	0.731	395-414	RHIKFLERTEKPAKEVKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKB7	Uncharacterized protein	0.687	300-305	KRKARE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZG0	Uncharacterized protein	0.715	279-288	KKERGRMERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0E5	Uncharacterized protein	0.812	1118-1129	KPPKKKSVPKRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S154	Uncharacterized protein (Fragment)	0.967	47-63	PRKRGRPPGSKNKRKGH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7G4	Uncharacterized protein	0.8	166-183	ARWRWRSMKKSWKPSAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA38	Lysophospholipase NTE1	0.807	350-363	TKTRKSPSRPGKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA38	Lysophospholipase NTE1	0.715	773-778	KKKRTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCU5	Uncharacterized protein	0.678	328-333	RRRRRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REM1	Uncharacterized protein	0.957	117-136	KKPKTERRRSSGRKQRRTSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU0	Uncharacterized protein (Fragment)	0.764	1788-1801	KPERPERPKSLRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU0	Uncharacterized protein (Fragment)	0.742	1431-1443	RSERSERRKDRSN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU0	Uncharacterized protein (Fragment)	0.713	1446-1464	SSRESRESRESKRESRELK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIU0	Uncharacterized protein (Fragment)	0.613	1222-1224	KGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJB2	Uncharacterized protein	0.978	8-48	KLVTGGKGPAKNLAAKANRKPATKSARKTLPKVPSKRYKFK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS6	Protein kinase domain-containing protein (Fragment)	0.956	889-910	VRRGKIRRSKMSRSSRRTRPPH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMR1	Uncharacterized protein	0.728	244-259	KKGRTKSTKKPVSDKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT2	Uncharacterized protein	0.695	274-279	KRKQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNE7	Zn(2)-C6 fungal-type domain-containing protein	0.914	71-97	RIRRARGRPRIHPPRSPTTLAKQAKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG2	Uncharacterized protein	0.869	3-23	KGKPRGLNAARKLRNHRREGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG2	Uncharacterized protein	0.702	137-144	KEKKEKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPQ5	Uncharacterized protein	0.618	15-17	RRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ74	Uncharacterized protein	0.911	25-43	KKSRKPTFRRRIFRKSSHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSI9	Uncharacterized protein	0.619	389-391	KRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTE7	tRNA-dihydrouridine synthase 3	0.822	375-399	KRARVKEGALPESDNKAPREKRKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTI9	SH3 domain-containing protein (Fragment)	0.911	815-825	KDDKRKKEKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTI9	SH3 domain-containing protein (Fragment)	0.682	642-649	LKKAMRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV59	BZIP domain-containing protein	0.773	40-49	KRKGGRKPPI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW64	Carrier domain-containing protein	0.692	399-405	KKRGEKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXY7	J domain-containing protein	0.994	491-518	KKDAKHDKHDKHHHDKKEKEKKEKKEKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0X7	DCUN1 domain-containing protein	0.828	525-538	KKHVPIVKKHRKRF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0X7	DCUN1 domain-containing protein	0.762	554-569	RKPKGIDNRVRRRFKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S655	WD_REPEATS_REGION domain-containing protein	0.983	365-382	KSKKRKRGRGWEKRIRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9G2	NUC153 domain-containing protein	0.926	467-512	KINKERESKIRGNKKVAVKVNRKLAEKMLERQEEQERRRAKRVLKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9G2	NUC153 domain-containing protein	0.843	690-713	RKQKSKGDGGDKGERHDRRKSGDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REX5	U3 small nucleolar RNA-associated protein 25	0.781	66-71	RKKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REZ5	Uncharacterized protein	0.872	88-103	SRHRSRRRELRGRPTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REZ5	Uncharacterized protein	0.683	597-600	KKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI87	Uncharacterized protein	0.787	467-472	ARKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJU0	ANK_REP_REGION domain-containing protein	0.991	585-628	RSPRRVKKEAPSASSQRFKRKSPPRRERSSSPRTEPKRTHHAKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJU0	ANK_REP_REGION domain-containing protein	0.8	635-657	PQKSRRLMSGKEKATREGQRRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJU0	ANK_REP_REGION domain-containing protein	0.729	755-774	RKAVKNKIKYKTVEDKLRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJU0	ANK_REP_REGION domain-containing protein	0.712	732-745	KIRTKPAKPASAKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPB2	Uncharacterized protein	0.856	359-368	KRKGKGKDKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG4	Uncharacterized protein	0.869	9-41	GRNAARQAKKLKEIQKVKHAIQWHERERKKRQE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG4	Uncharacterized protein	0.764	414-429	AKKDAKKDPNAPRKIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG4	Uncharacterized protein	0.631	494-498	KKPYR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXI9	Uncharacterized protein	0.922	391-428	PKQRKKPRKLGQPAENTQKSGDGAPAPAPAAKKAPRKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ20	RED_N domain-containing protein	0.997	511-528	KGPKKQRKRGGKKRKGDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ20	RED_N domain-containing protein	0.838	199-224	REKAEKKGEKMRTPPPVAGVKRSRND
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ20	RED_N domain-containing protein	0.751	285-292	KEKRKVKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2U6	Uncharacterized protein	0.762	25-34	EKPKKKTQLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S659	Uncharacterized protein	0.697	525-533	RSKRKMPVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S659	Uncharacterized protein	0.612	498-500	KPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Z0	Uncharacterized protein	0.664	375-380	RKLKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B8	GPN-loop GTPase	0.98	331-370	RRRAERDQEKKETRQRELDKMMKDMKVGGAGKKPKPKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9E9	Uncharacterized protein	0.971	243-261	VHGIRKVRTGKKTKKGKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9N1	PUM-HD domain-containing protein	0.987	14-49	PDVKTKSKKVKVDKPTSKRESKHEVKPAKKPSKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9N1	PUM-HD domain-containing protein	0.892	676-710	LKALKKEKKALEAAANPPGAQNGEAKNKKQKKGDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9N1	PUM-HD domain-containing protein	0.874	135-166	HAKQKALAKERKAAKPNADIIERSKKLWEKLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ3	Uncharacterized protein	0.986	87-125	KTKAKVKKPVTPRKRKSKGDAAGEGEEVTPTKRGRKKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHJ1	Cytochrome b5 heme-binding domain-containing protein	0.991	192-254	EREKEMEKARKRKKLTKGELKNRHAQELKSARKQVAAGLDSWHKLFRGEKGKKYRRVGTVKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHU3	Uncharacterized protein	0.962	307-318	PPKKRAKKRRFE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ41	Uncharacterized protein	0.778	171-177	KPKRKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS4	Uncharacterized protein	0.954	413-430	RRQAKRGRPKKSRPDLEE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQJ8	Peptidyl-prolyl cis-trans isomerase	0.992	421-476	YKRKRSRSPTRERRDGDDGRYNDRRRERSRSPNRHRDSRRERSRDRYRRDDRDRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQJ8	Peptidyl-prolyl cis-trans isomerase	0.63	408-412	RRRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.908	566-609	REKILTAMEKKKKREEEERARIIAENTAKMEKEAREREAREKAM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.8	864-881	KGRKEYAFVRKRSRSRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.774	691-698	EEKKRKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.73	706-719	RKQREREEEEKRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.713	408-426	REERDRERRELEEEKKRAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.668	542-560	EERKHILAEARAKQAREER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.649	534-540	EKEKREQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.646	464-467	RKRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ8	Uncharacterized protein	0.604	472-472	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUB0	RING-type E3 ubiquitin transferase	0.978	19-80	HGGGRGGRGRGRGAHNGPEDSHDGVGSRGRGRGGSRGRGQGHGRGHRDGAGGRGGHAPEKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUB0	RING-type E3 ubiquitin transferase	0.789	785-794	GKKKGNKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUB0	RING-type E3 ubiquitin transferase	0.617	409-414	RREGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUT1	Eukaryotic translation initiation factor 2A	0.981	536-556	ALKNKKKREAKKAREAADKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUT1	Eukaryotic translation initiation factor 2A	0.671	572-582	GRSPERRQRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S108	U2 snRNP auxiliary factor large subunit	0.977	31-54	RGDRRRRRSRSPRHGGGGGGGGGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S108	U2 snRNP auxiliary factor large subunit	0.968	84-158	ERRDDRGERGGERGGWGDSYSRRDRPRDRDRDEDRGHRRERGGERNERGGDRFGGEDRRGGRGGRDGGFGGGRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S138	Uncharacterized protein	0.709	249-264	HKRGERKMTAAEARRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1D6	DRIM domain-containing protein	0.997	2589-2641	GMRERREERRRKRKVEAVVDPVKWGMEKRRRHDVKRVNRKEKGREERGKRRGW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S720	Uncharacterized protein	0.957	421-437	GRKKKAKKPTANPKPIA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S720	Uncharacterized protein	0.919	377-398	GSAPVRKKTKSQAKKDRQERKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E2	Protein kinase domain-containing protein	0.924	1209-1245	EKKKDEKTKKDEEKTKKNEEIKGEKKTGTMAGSRGPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E2	Protein kinase domain-containing protein	0.669	81-87	SRRGSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E2	Protein kinase domain-containing protein	0.658	1085-1098	KPKSISPPVRKPTS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S946	Uncharacterized protein (Fragment)	0.978	47-67	DKRSGSGRQNRSYRRWRRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9M2	Uncharacterized protein	0.998	1282-1330	RKAIRSKKRKASDGVDKPRKKTKGDRPIKEKKSRAERSTKTPKKKKRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD74	Methionine aminopeptidase 2-2	0.997	66-79	AKKKRKRNKKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD85	ULP_PROTEASE domain-containing protein	0.883	252-265	RISRKKPRRPTSSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD85	ULP_PROTEASE domain-containing protein	0.835	876-887	KNKNKRKPVPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD85	ULP_PROTEASE domain-containing protein	0.667	1012-1017	KVKRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD85	ULP_PROTEASE domain-containing protein	0.657	394-406	RQAKPLSKARQAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYF0	60S ribosomal protein L36	0.98	66-90	RNSKDKRARRLAKKRLGTFGRSKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYF0	60S ribosomal protein L36	0.623	32-34	RRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYT5	BAG domain-containing protein	0.998	925-942	GKKKSRKRGGRKGKKKGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYT5	BAG domain-containing protein	0.691	663-676	KKMKHAPAPTPKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3T7	HMG box domain-containing protein	0.992	130-160	SPRKTEGSPRPKATPKSKKAKAAKSDKHKTP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5A3	AAA domain-containing protein	0.984	20-51	KSKKDKKDKPKYEPPPQPTTRIGRKKKKAAGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E0	Uncharacterized protein	0.964	421-434	IRPKKDRKPAKRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X1	Chromatin-remodeling ATPase INO80	0.951	1502-1514	APPGKKRSKKKQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X1	Chromatin-remodeling ATPase INO80	0.925	311-325	KERKKDMQRKRRREK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X1	Chromatin-remodeling ATPase INO80	0.896	407-425	GKRKGNRGTGRLKKSKEQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X1	Chromatin-remodeling ATPase INO80	0.787	262-268	SKRKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCV4	F-box domain-containing protein	0.682	25-33	KKTERMKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDZ8	Uncharacterized protein	0.955	17-39	LPRKRAARHRGKVKSFPKDDPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDZ8	Uncharacterized protein	0.671	238-245	KLPRKTHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKX3	DDE_3 domain-containing protein	0.7	44-50	PKPRRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLY2	KRR1 small subunit processome component	0.999	311-334	GEKKKKKRKREEGEGKEKKKKKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLY2	KRR1 small subunit processome component	0.758	227-239	KKRSLSKRRVPHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQX9	Uncharacterized protein	0.91	539-561	GKEEQKSKLKKIFKGWIHKKEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR27	Uncharacterized protein	0.855	10-33	PATKKAIGPKSKVTKKPWTYKKYR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRA5	Telo_bind domain-containing protein	0.811	188-196	KKRRRKSFK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVF9	Uncharacterized protein	0.962	458-490	KRKRSHKSKKVAEVAAPAHNGVEKARKKARKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVF9	Uncharacterized protein	0.753	1043-1052	GRRPMKPGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVF9	Uncharacterized protein	0.654	78-84	RGRTPKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVV0	BUD22 domain-containing protein	0.913	342-390	RKNRRGQRARQKIAELKFGQKAKHLEKVQRNAGWDPKRGAVSDEKRQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVV0	BUD22 domain-containing protein	0.896	51-65	QKHSRRKKYATKKKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVV0	BUD22 domain-containing protein	0.85	3-23	KRKRSSPPPTKKVIAPPPAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYR6	Uncharacterized protein	0.904	52-70	TPRRTASRKPVEKKTRRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYR6	Uncharacterized protein	0.742	12-31	AKTERDEAKKARAAELAARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K4	Protein SQS1	0.91	541-550	LKPKKKGRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K4	Protein SQS1	0.892	573-597	RAKKRLKKAEREELRQQGLLGRKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K4	Protein SQS1	0.839	498-509	KKRQDRRGRGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S556	Uncharacterized protein	0.898	165-173	GKKKKSKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Y4	W2 domain-containing protein	0.993	144-165	EPKKGKKDKSSKKAERRARKEA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S807	Brix domain-containing protein	0.977	12-50	LKPKNKLRRQAAFLSIKKAREADKRDARLRRKREEEKNP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCW3	Fe2OG dioxygenase domain-containing protein	0.968	520-539	SKSKKKSSKKNGKASEPKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RET1	Uncharacterized protein	0.994	279-299	ISKRKQKKRRRGPSQAKAKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REX3	Uncharacterized protein	0.998	84-104	KKKSQKKKSQKKKKKANKLMR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFE2	Uncharacterized protein	0.666	251-258	LRKSKLAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFS4	Uncharacterized protein	0.926	76-103	KDKRRIRARPAARPTPAPKIEAPVPRPV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI16	Usp domain-containing protein	0.666	69-75	RPRERRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ11	Uncharacterized protein	0.724	276-295	APRPRTSPVPRPHSRPSIKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJW4	Ribosome biogenesis protein NSA2 homolog	0.989	21-67	DERQRKRIAREGHNASKKAQNFRGLRAKLHAEKRRKEKIQMKQKIRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJW4	Ribosome biogenesis protein NSA2 homolog	0.901	139-150	GKKTKKKSWKRM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RML0	Uncharacterized protein	0.995	640-675	SRQRKMTQKEKNRKKQMESKAKKLRARKDNKGKQGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPG8	Ubiquitin carboxyl-terminal hydrolase	0.976	588-620	GKGKEEKERKAHEKELEKAAKQKRKEMEQKRRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRW8	RING-type domain-containing protein	0.791	534-543	RIRRRRWRAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU75	Protein MAK16	0.999	300-325	NLKRKRPAGPPPKPKKKPSKGSKGPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU75	Protein MAK16	0.938	132-161	EERLGERLVPRLAPKVRRREEGRERKALAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY84	Uncharacterized protein	0.987	228-242	KKEKKDKKHKKHKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S511	Uncharacterized protein	0.951	190-207	KRAKLNKPIPKPKPKAKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S511	Uncharacterized protein	0.663	154-160	KRKRATP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S589	Uncharacterized protein	0.875	161-175	KSKKQRRLAAKRLRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L1	Separase	0.871	2108-2121	PGKTAAKKAKGKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L1	Separase	0.817	1363-1380	KAKAGTRGRKPVVKAAPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L1	Separase	0.751	2136-2144	GSAKKGKKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L1	Separase	0.652	132-138	RKPARPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6L1	Separase	0.626	1531-1534	RTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9C8	zf-LYAR domain-containing protein	0.999	327-403	QKQRKANVKAREKAEKKEKDAKEKEKKEKKEREAKEKEKKEKEKEKEKKDRGRDRDRKERKATTALVKIRPKKKRED
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFC4	MFS domain-containing protein	0.643	267-270	KRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKB4	ANK_REP_REGION domain-containing protein	0.709	570-595	ADRRKAETERVRKESEAAEAKRNETR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKB4	ANK_REP_REGION domain-containing protein	0.644	420-424	PKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL38	Uncharacterized protein	0.837	184-200	AGKSTNKKKSSVNKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMA8	Uncharacterized protein	0.68	319-324	PAKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RND7	Uncharacterized protein	0.754	441-448	RRKRKSRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNL3	SAM_MT_RSMB_NOP domain-containing protein	0.971	546-555	GKRKNKKRKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNL3	SAM_MT_RSMB_NOP domain-containing protein	0.928	341-352	PKPDKGKKRKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQA0	Uncharacterized protein	0.814	58-70	RIKKRPSRWRGPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTU7	Uncharacterized protein	0.979	52-77	LRRAPRASAFRKKSQRLKGKARKLAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU89	General transcription and DNA repair factor IIH	0.886	84-94	RKRKRLRKDTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU9	Uncharacterized protein	0.981	239-259	LDKKRKATKQKTGKKSKAAKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU9	Uncharacterized protein	0.84	115-139	PATTKKTAATKKTGTKKSATAKKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU9	Uncharacterized protein	0.679	103-108	KRRRLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX58	18S rRNA factor 2	0.761	295-301	KPKRRKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYR4	Uncharacterized protein	0.983	396-410	KKIKKAKKSKKLPKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ16	Autophagy-related protein 26	0.782	10-24	KISRRTSRKMKESRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ16	Autophagy-related protein 26	0.677	208-217	KGKSSGRKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S183	Uncharacterized protein	0.985	1181-1204	REYKGKIRKGRVGKRRGGGVGRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S183	Uncharacterized protein	0.907	1272-1290	KNGRRGKTAKDKLGRKAKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S183	Uncharacterized protein	0.692	131-140	RERRPTPPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2R1	Uncharacterized protein	0.988	8-31	RRRTEDQLRGKVPKKEKRKVKKQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2R1	Uncharacterized protein	0.639	117-129	PEPKFKASIPAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G1	ENDO3c domain-containing protein	0.831	473-485	KGGSVKKTKGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G1	ENDO3c domain-containing protein	0.816	137-146	PKKKTKAKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G1	ENDO3c domain-containing protein	0.806	37-48	RGNARKRKAVKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G1	ENDO3c domain-containing protein	0.775	105-118	VNKSKKPAKFAQPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G1	ENDO3c domain-containing protein	0.717	63-71	PKSTKRAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S795	Methyltransf_11 domain-containing protein	0.98	190-203	KQKKEKEAKRKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7H0	Lysyl-tRNA synthetase	0.994	30-62	KSELKRRQKQREKDEKKKEKEASLPARPKKEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7W8	Uncharacterized protein	0.92	91-115	RGGPKSTWRKPESRGFKRRVGGKGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9D3	Protein FYV4, mitochondrial	0.985	212-241	RRGHKVDGGERRKAEVRAKRRAAENKEKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9F1	VHS domain-containing protein	0.872	132-143	KRDKKDKKKSKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9R7	Uncharacterized protein	0.94	215-242	ARKSKRSTMKKSALRHKDTPRSRSSRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9R7	Uncharacterized protein	0.822	140-147	KKKKKLSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF00	DUF4045 domain-containing protein	0.873	561-573	KGRARGPKRRAPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFL6	SH3 domain-containing protein	0.795	462-469	PPKKKKPI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFL6	SH3 domain-containing protein	0.7	296-303	KEKPKRPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFL6	SH3 domain-containing protein	0.618	1189-1193	REHKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK7	Uncharacterized protein	0.988	455-480	VRAKRIKKIKSKAYRRVHRKERERML
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK7	Uncharacterized protein	0.949	207-216	RRERKKKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK7	Uncharacterized protein	0.877	145-156	KSHKGKAKKSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK7	Uncharacterized protein	0.803	768-785	KSKAQSKPASKAKEQKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK7	Uncharacterized protein	0.735	85-90	KRRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK7	Uncharacterized protein	0.73	742-750	AKKEKKAVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGK7	Uncharacterized protein	0.71	508-523	EERMGAKHRESKWAKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGY1	Uncharacterized protein	0.693	245-255	ATPKQQGKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGY1	Uncharacterized protein	0.604	243-243	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLV3	Uncharacterized protein	0.91	6-32	PADRRSDRNAKNGTKKAGATKESKKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS16	Phosphodiesterase	0.837	293-301	ERHRKRKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT73	Uncharacterized protein	0.998	166-331	ARREKREARREKELEEEREREREERAKKEERKRREREEDEAREKVRQEEKERRRKEREERDKEDEERRRKDRERIDKEREEERLRLKKEREEHEKSREARLKKIREEDAERERRIQEELDRDRGGRRRGGRGRSRTPERDRDRRGRDRSRRRSRTRTRSPERRPSL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW12	Rav1p_C domain-containing protein	0.761	1354-1365	KVVEKKEEKKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWY8	Uncharacterized protein	0.914	470-478	KRKSRKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY20	Uncharacterized protein	0.637	217-224	IKWFKKVG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G6	Zn(2)-C6 fungal-type domain-containing protein	0.909	78-94	SKKRRSSKSKGPGELRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5E2	Uncharacterized protein	0.972	11-44	QKDKLGDVIKRRKDVAKIKQRKQMDTKKKERKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5E2	Uncharacterized protein	0.972	90-102	KKKAKPKTGKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5E2	Uncharacterized protein	0.854	695-730	RKSRAAKAKMLDEARKMEDRKREEAEVEKRGGKKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9R2	Nucleolar complex-associated protein 3	0.975	347-371	GKKLKQKREFRTKRTRKDLKEKKAI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9R2	Nucleolar complex-associated protein 3	0.817	49-60	PRKLKKQKENKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCY4	60S ribosomal export protein NMD3	0.898	414-430	RSKKNKNKRNWRVKRMN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD71	Uncharacterized protein	0.99	19-32	VGVDKKKKKKKAKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD71	Uncharacterized protein	0.87	83-113	GRHKTEAEKRYDEMRRKRLEERMRKEGVKTH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDD3	Uncharacterized protein	0.9	135-152	KKRFPVDAKKQLKKAKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDM0	Uncharacterized protein	0.989	521-546	GAPSKRTSQRKKKPLPKPRVPRVKPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDM0	Uncharacterized protein	0.901	452-481	RRSQRNKRKRGPNVPSVDEEPRKPLRKKTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDM0	Uncharacterized protein	0.836	396-421	KKLVNAKRAGGRARDNHGRLMKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDM0	Uncharacterized protein	0.623	507-509	KRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE79	NADAR domain-containing protein (Fragment)	0.606	5-6	KP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP9	Uncharacterized protein	0.998	153-185	PRGRGRGGRGSRGGRGRGGRGRGSRGGRGRGGI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP9	Uncharacterized protein	0.92	598-624	RKRGRPAGSKNVARRSDYGIKKGPRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP9	Uncharacterized protein	0.904	747-771	WAERKAKKREQDEKEGKPVKPTSSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP9	Uncharacterized protein	0.868	728-741	SRRKPRVKSEKRSQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP9	Uncharacterized protein	0.825	522-540	KKHNGWGGARKKGVSRFAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP9	Uncharacterized protein	0.684	499-507	SKRQRKATR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIY3	Uncharacterized protein	0.616	14-17	KPKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQE5	Eukaryotic translation initiation factor 5B	0.998	110-180	KKKAKGGAAAAKAEEPAEEKTDDAPRVKTKAEKEKEKKEKEKQRKKELAAKKKATGPAKAEPEKPAESKPE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQE5	Eukaryotic translation initiation factor 5B	0.991	311-335	KKKKPKYDDRKKKKKQAETQKEKEA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQE5	Eukaryotic translation initiation factor 5B	0.97	248-285	QKRKEEAKALKKQKEKEKIEQLKKEGKYMTKAQKEAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQE5	Eukaryotic translation initiation factor 5B	0.937	56-66	AKRGKKKNKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQE5	Eukaryotic translation initiation factor 5B	0.824	197-208	AAGGKKKKLNPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQE5	Eukaryotic translation initiation factor 5B	0.688	218-222	ERKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTP3	ULP_PROTEASE domain-containing protein	0.637	290-295	RPPLRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZU1	Fn3_like domain-containing protein	0.846	55-67	IRRKKSKGDLKIR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJA6	Reverse transcriptase domain-containing protein	0.973	471-499	YRKSPTKRTKRYFEKRRKEANKLIKKLDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJA6	Reverse transcriptase domain-containing protein	0.789	448-463	RKVRKEPEALRRIKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPT6	J domain-containing protein	0.616	154-156	KRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSF3	Uncharacterized protein (Fragment)	0.901	263-311	APPPPKEEKKKVTTPISIIKKKERRSSSLSVSSIEKPKISKGDKKSKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX07	Armadillo repeat-containing protein 8	0.844	59-68	EARKGGKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYK5	Uncharacterized protein	0.944	71-84	SSRKRRRSRKGLDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3B6	HSF_DOMAIN domain-containing protein	0.969	764-773	RRRSPKRRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3B6	HSF_DOMAIN domain-containing protein	0.85	241-254	KPKNPPAGPKRKRN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I1	Uncharacterized protein	0.972	560-580	KKRDARRIGRPKTWKGGKRGL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3L5	DH domain-containing protein	0.676	1154-1159	KKEKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S441	PHD-type domain-containing protein	0.922	438-452	QKKRPAARPSHKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S441	PHD-type domain-containing protein	0.899	744-756	KRAQGSKNKKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S441	PHD-type domain-containing protein	0.86	208-224	PRKRKDRDRHSRPTGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S968	Uncharacterized protein	0.994	297-320	KHKKMEEKAAKEAGKKKKTRKEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S968	Uncharacterized protein	0.878	1091-1110	ANRSRRSSHSRRQKKSQKHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REN2	CBF domain-containing protein	0.964	857-871	KKDKDGRKSKKRKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REN2	CBF domain-containing protein	0.962	17-43	PSPDKNRVSAKGDKKDKRKPVEEKKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REN2	CBF domain-containing protein	0.958	721-738	AGKAKQADKKTKKKDRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REP7	Uncharacterized protein	0.986	344-360	RAKSKGKAKAKAKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REP7	Uncharacterized protein	0.735	378-386	KRRPGRPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV6	Uncharacterized protein	0.997	132-169	KRPRGRPRKSDIAASPNPKPKPKRKGTPVKRTARSRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV6	Uncharacterized protein	0.904	189-198	PKRRRGRPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV6	Uncharacterized protein	0.601	711-711	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGM7	Uncharacterized protein	0.985	48-169	KLKVDKREPQKLKVDKREPQKLKVDKRDPEPQKLKVDKREPQKLKVDKREPEAEPQKLKVDKREPQKLKVDKREPQKLKVDKREPQKLKVDKREAAPEPQKLKVDKREPVAEPQKLKVDKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI88	Uncharacterized protein	0.905	1015-1030	QARRKAERPGRGRPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP8	Uncharacterized protein	0.744	24-36	PKHAKGSRPPRQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKE3	Pre-mRNA-splicing factor	0.759	787-795	SRASKKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMK0	Uncharacterized protein	0.994	336-350	GKKKRKRRKPNKSGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMK0	Uncharacterized protein	0.712	14-24	EKSRPKSIKPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP44	Uncharacterized protein	0.724	11-19	KKITKKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRE2	Uncharacterized protein	0.987	322-340	KKVVKTKKPKKGGRKPGLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRE2	Uncharacterized protein	0.939	443-474	SRKAVKRKSEPTAPSSARKRGKYGGIVGRPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRG9	Double-strand break repair protein	0.923	655-683	KKATAKKAAAKTTKAPARAKSPTKKTTTA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRG9	Double-strand break repair protein	0.882	603-617	KKAAPAARGGRGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRG9	Double-strand break repair protein	0.706	532-540	KVRKSKTKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRG9	Double-strand break repair protein	0.662	582-590	KAAPRGRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRH0	Uncharacterized protein	0.709	78-87	PSIKRGKAEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRH0	Uncharacterized protein	0.633	861-865	RRSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUE3	Uncharacterized protein	0.783	1188-1224	KRAEERKHRGLMQWKPARNVKFAKDEAKIGLSKLKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0G0	Uncharacterized protein	0.973	28-47	RVETKEPPKKSPKKSPKKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2S3	CobW C-terminal domain-containing protein	0.92	4-24	AKRRKTKGAEMKPKSKTSERK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S497	Uncharacterized protein	0.854	1000-1018	KKKEKEKPVPAPKAPTPPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S497	Uncharacterized protein	0.711	611-625	KRYVKAAGNKKEGKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K2	Histone H2B	0.986	12-46	GGKAPAGKAPAEKKEAGKKTAAPSGDKKKRTKTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F5	Uncharacterized protein	0.81	2288-2295	RKGRRKKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F5	Uncharacterized protein	0.705	207-215	RKRSGRHRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5F5	Uncharacterized protein	0.625	259-262	LRKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5J7	Uncharacterized protein	0.891	534-558	RADRRAAKEAKDAKARQREEKALRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5J7	Uncharacterized protein	0.814	420-438	PPAPKPTKSKSTKKDKTQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5J7	Uncharacterized protein	0.789	617-636	TRRGTDAGKGKGRVGEHKIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y5	Uncharacterized protein	0.998	291-305	KMKKPKKKKGKKSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y5	Uncharacterized protein	0.964	75-99	LAKLRREERAAKIKKEREKASRFAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y5	Uncharacterized protein	0.901	364-375	QKALKKRKKMRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y5	Uncharacterized protein	0.779	121-130	SKKRQKKIAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y5	Uncharacterized protein	0.69	428-432	RKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S839	Uncharacterized protein	0.906	207-219	KRKKEGRKSKPVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S839	Uncharacterized protein	0.704	849-853	SKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDN6	Uncharacterized protein	0.952	560-578	ANPKKKPTKDAKKPANKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF30	BZIP domain-containing protein	0.961	90-120	RPKPGRKPAKTEPESKRKAQNREAQRNFRQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHE5	Uncharacterized protein	0.999	3-39	GRGRPPGSRNSKGVSKPAPKSVAKARAKKPKPRRKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHE5	Uncharacterized protein	0.845	209-227	KKNAKKWRAEWKHQKKHGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHE5	Uncharacterized protein	0.636	61-63	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJZ0	Ubiquitin	0.805	163-169	RPKKKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK27	Uncharacterized protein	0.999	781-808	EKRMKKERKKREKEEKKKHNKHKKHDDG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK27	Uncharacterized protein	0.989	812-844	DADKRRSGSGEHRRRSRSREHGHEHRRKKSGSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK27	Uncharacterized protein	0.63	760-764	RGKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD8	PINc domain-containing protein	0.639	36-38	KKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD8	PINc domain-containing protein	0.6	25-25	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN87	Calpain catalytic domain-containing protein	0.952	619-642	ERSKRLRKRDELRAQKKAAKETRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP24	Uncharacterized protein	0.908	632-647	KGKKKPPPTPKHRHGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP24	Uncharacterized protein	0.69	109-118	IFKKQGRPKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP24	Uncharacterized protein	0.634	102-105	KRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRJ8	Uncharacterized protein	0.617	314-317	RTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW2	Uncharacterized protein	0.733	63-74	KARKEAETRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVT4	Zn(2)-C6 fungal-type domain-containing protein	0.951	46-62	KPNAKDPLRPRRKKARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1I5	F-box domain-containing protein	0.781	1854-1872	KGKKASPSRSQRNGPGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3V5	Mitochondrial import inner membrane translocase subunit TIM54	0.868	261-273	PKEEQSKPKKKKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3V5	Mitochondrial import inner membrane translocase subunit TIM54	0.859	146-155	ERIRKLRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3V5	Mitochondrial import inner membrane translocase subunit TIM54	0.641	67-71	KKRIQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8P4	Uncharacterized protein	0.689	137-144	KKRVKGLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ2	40S ribosomal protein S30	0.974	14-37	VKSQTPKVEPQEKKKTPKGRAKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX9	Uncharacterized protein	0.967	21-32	LKKGKKRKRAQP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX9	Uncharacterized protein	0.933	83-121	RPEKSHKRKKSEVAPESTKPNLKPDQKVKPRSKQPEKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDN7	Protein kinase domain-containing protein	0.994	54-128	SPYRRKRTPSRSPSPYRRNRNADRSPSPYRRPRAEPAGNGSRGYKRKASPPRGRPDKRYHADRGRYGDSRRAAGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.972	256-282	GASSKPPKKETSLDKRAREKREKKERE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.971	587-596	KEKKKKKKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.923	504-524	KKKETTRQKREREAREKKEKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.917	51-58	SKKKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.905	142-152	GKKAKKGKKGL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.896	365-389	SKKKESTKEKRAREKEEQERLEKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.88	103-111	KKKKKDPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE49	Uncharacterized protein	0.814	236-248	KKKSKKDKESTKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REB0	Zn(2)-C6 fungal-type domain-containing protein	0.752	86-99	RARRRPAPGEQVKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLA2	Uncharacterized protein	0.996	71-93	RRGSSIKVGKWGKKKKPKTRRKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLV8	Casein kinase II subunit beta	0.87	336-347	RRKKAIRTRRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMZ3	Uncharacterized protein	0.965	128-146	RNKHQRKAAPPKNKRRSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMZ3	Uncharacterized protein	0.815	850-862	RGNGKARKGTKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMZ3	Uncharacterized protein	0.625	32-37	RKTVRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSH6	Ribonuclease H2 subunit B	0.994	373-419	REEKKRKKEEEEKRKKSEGRGVKQLKKVDTSGMKKMSAFFKKVEKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYM3	Cation_ATPase_N domain-containing protein	0.916	248-266	KGSRVREVKRKPNGKAKPH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Q0	DNA-directed DNA polymerase	0.7	106-115	KAKSNLKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Q0	DNA-directed DNA polymerase	0.614	216-219	KSKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z2	Uncharacterized protein	0.749	113-118	RRRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8J9	HET domain-containing protein	0.996	395-410	KQKRKKRKRNKGKQAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V4	Uncharacterized protein	0.971	336-369	RERRRRRRPRSQGDRTADEALRQPPKISRRKSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V4	Uncharacterized protein	0.964	414-426	PKPRRRRSRRRSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V4	Uncharacterized protein	0.908	236-278	GAGSGKGAKTSETAGKPKSPQLPKEKTEIVRMRPSRRRARTSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V4	Uncharacterized protein	0.858	537-550	RRSSSGSSRRRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V4	Uncharacterized protein	0.856	1324-1334	PKPRRKSTKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V4	Uncharacterized protein	0.693	216-224	KQRRPSKPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8V4	Uncharacterized protein	0.692	459-465	PSHRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9D0	Uncharacterized protein	0.968	26-40	QAKPEPRKRRNRKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE26	DUF1713 domain-containing protein	0.995	277-305	KRQRKLKMKKHKYKKLMKRTRLLRRKLDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHW5	ABC1 domain-containing protein	0.984	55-74	PKPRKRKIKPPFTRRKWVRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIZ8	Uncharacterized protein	0.996	906-942	KKMKHFKPPNQQKPKASKPKSKSAKGKKNDSKSKKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJU7	Uncharacterized protein	0.732	18-31	RRISDKRLERKEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS7	Uncharacterized protein (Fragment)	0.979	382-393	PGKKKKGKKGKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS7	Uncharacterized protein (Fragment)	0.96	267-285	DKGKKKTKKEKEEEERLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS7	Uncharacterized protein (Fragment)	0.837	212-224	HAKKKKTAGATKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLS7	Uncharacterized protein (Fragment)	0.759	530-537	KSKKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMI8	Uncharacterized protein	0.927	622-639	MPSSKRRSFGEPKKGKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMI8	Uncharacterized protein	0.902	945-966	RRSEKKEKKESHSSKKSSKTSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMI8	Uncharacterized protein	0.732	278-294	KVKLGPRPRPSLEGRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRD0	Spindle pole body component	0.78	104-133	PPAGSGERRTEKKEVRERETETRRTRSPLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTA3	Dimer_Tnp_hAT domain-containing protein	0.841	38-52	KPASKPRPQRRSPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTG5	1,3-beta-D-glucan-UDP glucosyltransferase	0.983	294-310	KANRRTRKARKAAKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU07	Uncharacterized protein	0.999	141-183	GEKGGKKPKVARRLLRPPKKVGKAGKEKRIEEEKARRSQAEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUA4	Uncharacterized protein	0.97	20-98	KAKREKEAAEAKPRFIPRAERERIALEKRKKEVEDAQKKREGLSRGGDGAWRPQHDTRPPTGPRSMREAPTGPRHERRN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUA4	Uncharacterized protein	0.825	142-148	KKKRKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUA4	Uncharacterized protein	0.821	219-228	ERRRKEKGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUA4	Uncharacterized protein	0.672	105-114	PVPDKRHGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY4	Uncharacterized protein	0.91	268-277	RKKKRAKRLS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY4	Uncharacterized protein	0.761	198-212	KPLASRPTLRGRKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S505	Prolyl-tRNA synthetase	0.913	20-41	KKSKKDGNPQKAPKKPQQQKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6F0	BHLH domain-containing protein	0.693	987-991	KKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S937	TFIIS N-terminal domain-containing protein	0.999	117-146	HKRKRAVGEGDEPKKKKKRADKPRRKKNKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S937	TFIIS N-terminal domain-containing protein	0.97	157-173	DRRSKRSKKGGKAARGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S937	TFIIS N-terminal domain-containing protein	0.631	207-210	RRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV8	Uncharacterized protein	0.983	211-245	PAPKKGKRASTKKRASARSSTASTASRKGTRGRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV8	Uncharacterized protein	0.748	24-37	GRRTSSRSKKAGTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHU8	SET domain-containing protein	0.881	361-374	RKLSRGKRKLRLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN09	Uncharacterized protein	0.85	147-156	PPKKKTRKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN09	Uncharacterized protein	0.783	292-300	RAKKRTKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN09	Uncharacterized protein	0.601	705-705	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPD3	Uncharacterized protein	0.705	15-20	RRKKKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSC3	PNPLA domain-containing protein	0.675	506-514	PPKPEARKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT08	Uncharacterized protein	0.983	116-149	TRSRPLAPASPRHQERRQAKGGRPKRKAVLGASR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTP7	Ribos_L4_asso_C domain-containing protein	0.993	183-207	KARNTRKLRAGKGKLRGRRHKQRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVA1	Uncharacterized protein	0.773	198-206	PPKWKKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXQ6	KOW domain-containing protein	0.947	44-58	PKRQRKAKSKSKSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXQ6	KOW domain-containing protein	0.669	493-502	KKRAAIQKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY42	Uncharacterized protein	0.954	1492-1501	KKKKKSKKAS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY42	Uncharacterized protein	0.885	116-128	AKSNKKFPKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY42	Uncharacterized protein	0.805	12-31	ATPSKKAKSALTDRSAKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1V1	Uncharacterized protein	0.629	60-64	RNKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1X3	Uncharacterized protein	0.975	355-369	AKKVKKGKKGGRRAH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3N8	Uncharacterized protein	0.983	10-64	RRRKKDPDRERSSPRTKDKDKDRDRDRDRDRDRDRDRDRDRERHKSSRARKTRSS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3N8	Uncharacterized protein	0.879	888-899	RRRKAHRARERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8U3	Uncharacterized protein	0.982	141-157	TFKSKRQKKREKKEPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8U3	Uncharacterized protein	0.863	228-238	ERSKKKVSKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8U3	Uncharacterized protein	0.73	96-114	KKKAKIHIAAKQDAARPKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9G7	Uncharacterized protein	0.998	47-69	PSKTPGKKTKRKGRAEKGKKGKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9G7	Uncharacterized protein	0.978	685-728	DRIEKEARERERREKEEAAKRARAEAAERGRIASREWAEKQKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9G7	Uncharacterized protein	0.762	567-592	KLRIKREERLKRMEEAEAAKKEAALK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD73	Zn(2)-C6 fungal-type domain-containing protein	0.71	618-626	EGRDQKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD73	Zn(2)-C6 fungal-type domain-containing protein	0.607	82-83	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDS7	N-acetyltransferase domain-containing protein	0.866	143-156	KQTRKRSRNKSKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDS7	N-acetyltransferase domain-containing protein	0.811	491-510	ARKRRMDDKQRKMLARRNRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI39	Uncharacterized protein	0.877	144-165	KEAKKPRDESPKKFLTKRKSSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI39	Uncharacterized protein	0.799	486-499	ASLRGRPKAKAPAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNT8	SPRY domain-containing protein	0.958	43-83	ARARPKAPAREQREKRETIKKREASASTRQNTPNAKPKKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNT8	SPRY domain-containing protein	0.935	274-300	SRASKIFKPLPKNAKSKHMKARPPHGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR59	Endoplasmic reticulum junction formation protein lunapark	0.824	395-404	RSKSKARTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR81	Uncharacterized protein	0.966	161-173	KQRNRKKNKKKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH7	Uncharacterized protein (Fragment)	0.996	1179-1260	RRERRRSRRPSKLEERSKTRRISVTEKERPSGRRVDSDRPRTRDRGEERQRPKRGETERRDRRKKKEESSGLKGLLGGLKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH7	Uncharacterized protein (Fragment)	0.989	797-922	EYRSRHRDIKVEDKHAKRRIIEEKEEEAERQRRREARRAEKERLAAADAARLKAEEEARKLEHRERRRAVKRAEEELVRAIEERRRLKEEKKAAAEEEERRIRHEKRRQRHEAEKEARRQEQEAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH7	Uncharacterized protein (Fragment)	0.875	937-953	EARRLRRQKRAEREAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH7	Uncharacterized protein (Fragment)	0.872	718-785	TRRRHSRAHRDGHHHSSRRRESGASTRDRPVMPSTAPPEPPKTKRRDSMTEREAAERRKERLREAERT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH7	Uncharacterized protein (Fragment)	0.602	793-793	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX57	Cir_N domain-containing protein	0.999	165-255	EKREKEKKEKERKHRHRDRSRDRSRDREHKHRSRRDRERSRSRSPHRNEERAHHRRDRDSHRRRSKSRSRSPYRNHNSRRHRSRTPRGRED
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2X1	Enhancer of polycomb-like protein	0.683	473-490	RRIGRGGRMMIDRRGVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S515	Ribosome biogenesis protein NOP53	0.997	265-301	EIKKKRPERKSLSQRNKIKRRKEAQRKATHEAKMKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S515	Ribosome biogenesis protein NOP53	0.803	106-113	GKRKKAKI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S515	Ribosome biogenesis protein NOP53	0.727	162-174	KKKPKVEPKTLKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S515	Ribosome biogenesis protein NOP53	0.678	16-21	RKGKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S825	Uncharacterized protein	0.982	49-64	GKKVKKIIRRKRRPAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S825	Uncharacterized protein	0.606	304-305	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9S3	Zn(2)-C6 fungal-type domain-containing protein	0.956	72-95	SKPAPAKTKKGQPPAPPSKKPKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9S3	Zn(2)-C6 fungal-type domain-containing protein	0.812	20-31	TAAKPGLGKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REG5	Uncharacterized protein	0.986	674-697	KAPAKKATPAKRPAAKPAKKKATA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REG5	Uncharacterized protein	0.985	564-581	RPWKPKPKNAAKKSRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REG5	Uncharacterized protein	0.923	630-651	PPKRIIKTKAEGAATPAKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REG5	Uncharacterized protein	0.64	741-743	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGD5	Uncharacterized protein	0.624	51-54	KRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGD5	Uncharacterized protein	0.611	200-202	KKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG6	Uncharacterized protein	0.994	717-755	SADSKYRSSRREKEKHRSSGSHRERSKEHRRRHRSRSPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG6	Uncharacterized protein	0.992	777-833	SRRKHRSGNKDRRDRSRDRERERDRKDRKERERDYDYERDKDRSRDKDKDRRRRRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG6	Uncharacterized protein	0.887	1042-1065	PKGPKAEAKPPTGPANHRDKRRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG6	Uncharacterized protein	0.851	616-653	RSRSPLRDESMRVKVRSPTRSRSRSKAREDVRDEPRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG6	Uncharacterized protein	0.778	847-859	HRSSRRSRKDRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG6	Uncharacterized protein	0.605	951-951	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJD9	CCHC-type domain-containing protein	0.784	281-289	RFKRKTKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF7	Cell division control protein 42 homolog	0.85	184-196	AKKEGGERKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN46	Myb-like domain-containing protein	0.84	335-347	KPRQPKAKGKEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN46	Myb-like domain-containing protein	0.721	155-164	PPKRTAKRPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN46	Myb-like domain-containing protein	0.669	275-279	RGKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP18	Uncharacterized protein	0.985	192-247	GKRKRRRGPRSTAAITKREGGSRAAKEDMKNDDPESRKKRGRPPRVDTPMEARIKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP18	Uncharacterized protein	0.892	762-791	AKAKKEALKASKRKADAANVEGREAAAKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP18	Uncharacterized protein	0.714	293-299	KRKLKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP18	Uncharacterized protein	0.614	250-254	KAIRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPR7	Decapping nuclease	0.84	16-27	RSPPRKRPRTRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ68	Uncharacterized protein	0.987	472-516	KWTKLKAKLKRSASKKSLKSMKSAKSVKSGKSVSTKAGDKEREKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ68	Uncharacterized protein	0.653	191-195	RPKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRP6	Uncharacterized protein	0.723	24-31	KKAKSRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVG0	Transaldolase	0.926	494-514	REEKREEKEEERKHRKHRSSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVG0	Transaldolase	0.618	293-297	KSHRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ91	Uncharacterized protein	0.984	122-151	EKSEKSEKSKKRDGGKSKEERDSKRQKKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZQ4	Uncharacterized protein	0.983	25-40	LKKALQHKKKHKKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZQ4	Uncharacterized protein	0.975	60-151	RKLRKARARAVVRERDEMEEKLRKARAKKQREEARLQRQVELEERRVERQRLKDAREHERAENAAERARKVEAQHQKKSTQQAQKRKRKASR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S137	Uncharacterized protein	0.91	505-532	ERGRKRRLLPALRTDSPKGGKHSRRGSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S137	Uncharacterized protein	0.897	115-133	KGKRSSRKEGRQERVPRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S137	Uncharacterized protein	0.668	630-635	KPPKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA64	Uncharacterized protein	0.979	457-496	KAEEGKAEKRERERRLKEKVGQEDEKKGEKRKRDHSNNGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ5	Uncharacterized protein	0.874	263-286	RKVESRGLKPVRRARSQSPKRHPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ5	Uncharacterized protein	0.844	923-933	PPVKRRLKRKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ5	Uncharacterized protein	0.698	821-829	RGKKNKLPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ5	Uncharacterized protein	0.692	663-671	GKRKSGGPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD82	GPI inositol-deacylase	0.809	1137-1142	KRKKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ5	Uncharacterized protein	0.632	79-81	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPP5	Uncharacterized protein	0.634	549-553	RKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS71	HATPase_c domain-containing protein	0.919	246-257	KKKEKKTKKVKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT94	Uncharacterized protein	0.731	833-838	GRKRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT94	Uncharacterized protein	0.671	664-670	RKPKSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUK8	Ubiquitinyl hydrolase 1	0.999	1636-1671	SGRQNKKKSKKARKHERKMERKHKNNKNFKHRKGGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWA9	Zn(2)-C6 fungal-type domain-containing protein	0.677	24-30	RRRKVAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S039	Uncharacterized protein	0.672	15-20	KREKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Y7	Protein kinase domain-containing protein	0.884	99-129	AKKKFSLRRPAGPFRSSPRTRNSNSKSPRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCQ0	Uncharacterized protein	0.878	39-54	EKRRKRTREYNNRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDH9	Chitin synthase	0.945	839-851	KKRKRLSKQKPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REC9	AP_endonuc_2 domain-containing protein	0.976	441-460	KRKAIKDAKPKKATKKAIKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REC9	AP_endonuc_2 domain-containing protein	0.787	33-42	GRKRKAGAKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG69	Plus3 domain-containing protein	0.849	131-172	RKSSRPKVQPRKNEKLEAYKREREQRGQQRQQNDDRRGRRRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG69	Plus3 domain-containing protein	0.819	410-439	RERKLDQKKRAAQQKAEEEARKAKEEADKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG69	Plus3 domain-containing protein	0.632	470-475	KKTERK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ22	Uncharacterized protein	0.92	63-71	SRKPKKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ22	Uncharacterized protein	0.917	657-674	KGDKIKRGSKKVKRMEWK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKA8	WW domain-containing protein	0.991	246-278	SLKAERRAKPPNKAKVKQYKQQRKEKKEAKRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS2	YL1_C domain-containing protein	0.982	115-169	LRKAERHERDKKRKAAANPFTARAAAAARKKVKLDVPRTQSPTHAPPRPKKKSER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS2	YL1_C domain-containing protein	0.737	217-227	AEARKMKAKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS2	YL1_C domain-containing protein	0.649	495-498	PRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS2	YL1_C domain-containing protein	0.644	201-207	KEKDRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP55	Histone acetyltransferase	0.754	92-119	ADKKKGTAVKVDKAPSKSDQKSLKRSRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQM6	Protection of telomeres protein 1	0.832	347-361	TAKEKRQAKRERQKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWH5	Translocation protein SEC62	0.993	320-345	KAKKAAKKEKKAAKLAAKAASGKQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY23	Uncharacterized protein	0.998	1303-1348	RTRPSNKNKRKAAAEEARKEKAKKAKAEAKIEAEKIKKQKEWEKLL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY23	Uncharacterized protein	0.973	1577-1595	PRKVRAKVVKGAKAKGRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1K4	Uncharacterized protein	0.982	450-518	RSRSRSDRRSTSRSRSRSRTRTHDRERSKGPGLRARSRSIIDRFRSKSRGPEDRDAGRDDRRDDRRDRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1K4	Uncharacterized protein	0.966	90-110	REQKKRERRRAKSVAKASSRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1K4	Uncharacterized protein	0.965	39-70	KHRKNNKNKGNSRKERRQSEEPSARRSSRRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G8	Component of oligomeric Golgi complex 3	0.786	17-27	KPPEKAKHRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G8	Component of oligomeric Golgi complex 3	0.613	93-94	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G8	Component of oligomeric Golgi complex 3	0.604	89-89	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5B8	Uncharacterized protein	0.959	25-44	PPKRSRAKPRPKDPNVPRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7A6	Uncharacterized protein	0.956	252-268	LKVRRVPRKKRASTRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E9	Uncharacterized protein	0.807	118-129	RPPKPRRAAQRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S992	Uncharacterized protein	0.954	924-984	KPEPAKPKTARKPRTRNNTVGIRKFHGKLRIRTYTTKGSGTRGAKPRGSPPVLRIRRYRGD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S992	Uncharacterized protein	0.925	703-737	KKKLEMHKIQQHRKRMEEELKRKIKLQALKKPGKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S992	Uncharacterized protein	0.833	1106-1116	KGVGGRQRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S992	Uncharacterized protein	0.832	1013-1024	RARRAERLRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S992	Uncharacterized protein	0.789	773-782	LRKHRRGIRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP9	Uncharacterized protein	0.999	2233-2323	EKKRVEEQQKAVRERVERDRKEAEKREKERLKRVEKEKKEKLKKLEKEEKAKKAAAAKQPKGVVPVKKTGKKVVVMPKTSLKAPTGVGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP9	Uncharacterized protein	0.744	2157-2174	RRQRKEKPGYSDNQKRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP9	Uncharacterized protein	0.735	856-867	KNKGNKSKSKIG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP9	Uncharacterized protein	0.735	988-996	KKKREVKHE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP9	Uncharacterized protein	0.627	1004-1006	KKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDW8	Uncharacterized protein	0.866	22-31	RSKKGKGKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA7	Utp12 domain-containing protein	0.788	13-25	HRAPPAKKPRLAQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA7	Utp12 domain-containing protein	0.659	45-55	KPAAKTNGRKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA7	Utp12 domain-containing protein	0.603	423-423	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA7	Utp12 domain-containing protein	0.602	421-421	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH68	Uncharacterized protein	0.972	41-75	KPRKVGYRLSKVKQEQFKTPKKTKKVEKRKQSRML
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHA2	Uncharacterized protein	0.915	50-62	RVRNRNKKGKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHA2	Uncharacterized protein	0.626	527-529	KKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW3	Uncharacterized protein	0.996	593-622	RKKAEKKAKKEREKAEKAEAEKKAAAAAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVJ5	Translation factor GUF1, mitochondrial	0.908	629-646	SRRRKLLEKQKEGRKKLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ03	Uncharacterized protein	0.779	325-356	EKSRKRPVGDGPRGSGSAAGDAFEKRRKVVGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ03	Uncharacterized protein	0.731	276-288	PKSKKEAAKQKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZW3	Uncharacterized protein	0.97	19-29	KKSKKRKRKNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZW3	Uncharacterized protein	0.913	191-214	KRAEAQQKAEEEERKKREKEKAAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZW3	Uncharacterized protein	0.755	65-72	KKSKKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0L6	Uncharacterized protein	0.981	310-333	RDKRRREKKAKADQERLRRRLERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0L6	Uncharacterized protein	0.811	153-161	RRKSSKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0L6	Uncharacterized protein	0.649	7-10	RRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q3	Uncharacterized protein	0.874	60-90	KRDDAIRRKIESDLNKKKNHSGRVRLSKKAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2K4	N-acetyltransferase domain-containing protein	0.983	262-279	AKKRGRRRRGKAVVRAWT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2K4	N-acetyltransferase domain-containing protein	0.602	281-281	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3F5	Uncharacterized protein	0.951	965-992	EKARDKPRPEKPALAKKPHRFNLAKPWK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Z5	IPPc domain-containing protein	0.878	864-873	KSIFKKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S645	DUF3074 domain-containing protein	0.919	472-505	AAEKHEKEKRKQETKYQKEIRKLEERRAKETRKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7I9	Nuclear cap-binding protein subunit 2	0.611	22-24	KRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y2	WH2 domain-containing protein	0.994	207-270	EARRRKMGAEATDKNRRRRLDKTRAASKGEERLPEKLRKSSTREKEERRRVDKRERGNRRDRGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Y2	WH2 domain-containing protein	0.813	101-127	SRRQEHDSRDRGRRASSEERPKHRYRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Z4	RING-type domain-containing protein	0.951	314-328	KEGKKKKDKERAPKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD68	Cytochrome b561 domain-containing protein	0.866	638-650	REARRRERKNKNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD68	Cytochrome b561 domain-containing protein	0.747	744-754	RRRRRAERAQA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF47	Mitochondrial genome maintenance protein MGM101	0.636	288-291	KKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFW6	Uncharacterized protein	0.98	728-761	KSRLQKREAKIKAKEARQAQREEARKQRRKARIA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH85	Lon protease homolog, mitochondrial	0.988	1065-1082	KELKAKKGERKKREQKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH85	Lon protease homolog, mitochondrial	0.824	136-146	GGGKKRKGPER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ1	Uncharacterized protein	0.991	18-38	KKERREKKDKKEKEDKKRSRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ1	Uncharacterized protein	0.913	83-94	SKKAARKAKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ1	Uncharacterized protein	0.862	331-339	KKPGKKRKW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ1	Uncharacterized protein	0.812	391-416	GGDKRFGKQDKSGGKPDGRDFKRKVD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ1	Uncharacterized protein	0.604	239-239	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR05	Chromo domain-containing protein	0.944	123-136	SRKEKRNKKRIKLA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR05	Chromo domain-containing protein	0.82	276-296	RKPIPKKKQTKTVSFKEPQRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM9	Uncharacterized protein	0.951	255-273	PREKASSKHVKKRTRRRSV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM9	Uncharacterized protein	0.898	216-236	KERDKAKKAKPIELSARRAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTQ8	Sfi1 domain-containing protein	0.724	931-936	PRRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX66	tRNA wybutosine-synthesizing protein 4	0.906	29-58	PHVYRPRRRFEALSKIEHNNERRKPKKALK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX66	tRNA wybutosine-synthesizing protein 4	0.601	27-27	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYB4	Uncharacterized protein	0.851	722-754	ALKKDRLRAVREAGLAKRALEASEEKIPKRRRM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF37	Uncharacterized protein	0.945	119-137	HKDHKKGARAMRKLKKAIR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHZ6	Peptidase A1 domain-containing protein	0.715	510-523	RRKSAKIDKHKDPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR6	Uncharacterized protein	0.963	160-183	ERARRKKEEERRLAEKKAREERER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR6	Uncharacterized protein	0.866	34-74	NRREAEKKRLAEKKALEDLHREHEREQQARKREAKRQAEER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL93	Uncharacterized protein	0.862	104-115	RNYNRKRRARKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF3	VASt domain-containing protein	0.963	71-87	HRRRMSKLFKGRKKRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF3	VASt domain-containing protein	0.933	1046-1060	ARMPGKGGKGKKRSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLZ9	HTH CENPB-type domain-containing protein	0.685	48-54	RRAGKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS9	Uncharacterized protein	0.964	176-225	RGPRTKVSHHERASSRHAAPVPDPPSRHESHSRSRSRSKLERVRRPRRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNK0	RNase H domain-containing protein	0.958	14-35	GRPVRQRRRYLRNESRRRRRRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST5	P/Homo B domain-containing protein	0.859	84-90	KRRRRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST5	P/Homo B domain-containing protein	0.803	768-774	RKKRAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST5	P/Homo B domain-containing protein	0.756	108-120	QKIKPRHWKRSII
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVU2	Uncharacterized protein	1	710-728	GKGASKKKRKKRGKKKKGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1T8	Uncharacterized protein (Fragment)	0.623	527-529	KKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S316	Uncharacterized protein	0.864	784-800	RAARLAKRKRDQKIGAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S316	Uncharacterized protein	0.79	379-395	PRPGEKQNRRGMRRPPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4J7	Uncharacterized protein	0.999	397-426	PAKKTKKHRDPEEEKRKAEKKARKEKKRAQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4J7	Uncharacterized protein	0.938	46-85	KKAGKPKATIGIHVNGVPKKKTKPSKSDVPAPKPTPKSKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4J7	Uncharacterized protein	0.726	380-385	KKHKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4T6	Uncharacterized protein	0.627	338-340	KRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S529	Ion_trans domain-containing protein	0.974	1088-1100	KKKGKGKKKSVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S529	Ion_trans domain-containing protein	0.789	880-888	SPGKKRAKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5L5	PHD-type domain-containing protein	0.998	614-630	STKKNKKKKKKPAKKPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5L5	PHD-type domain-containing protein	0.894	1145-1165	AAKKAKNAAHARAAKKTKANM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5L5	PHD-type domain-containing protein	0.71	844-853	KKKIKVSKTP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5S9	Uncharacterized protein	0.993	34-68	KATTRRRSHKRKRIQAEGARSDRKKLKTRVRAKGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S724	Uncharacterized protein	0.995	260-283	TKVKTEKARRKDGRKAAKGKRKTA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8W7	Uncharacterized protein	0.964	751-766	NGRPKSPKKIKPKKQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Z6	CBFD_NFYB_HMF domain-containing protein	0.934	144-155	KKKKTSTRRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REJ6	Uncharacterized protein	0.69	33-37	KKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REM2	Uncharacterized protein (Fragment)	0.998	4-56	RKEKKDKKDKKDKKSKKSKDSEEDASEKKSKKDKKRKQADEEVSDKKKKKSKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG91	Uncharacterized protein	0.991	528-543	KKKAKKSREAKRKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG91	Uncharacterized protein	0.751	134-146	KRERKDAKRLARA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR69	HMG box domain-containing protein	0.983	5-30	KTTRKAAPKSKADGGKKKKDPNAPKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUR3	Uncharacterized protein	0.85	3-15	KRHNRKRTRSRPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYS6	Uncharacterized protein	0.638	97-100	KKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0I4	DNA-directed RNA polymerase subunit	0.846	328-345	RPLKTIRGRLKGKEGRLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N7	Uncharacterized protein	0.73	121-127	RKKRGKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S390	Uncharacterized protein	0.975	20-39	RVARSKLKRLRKQKRLLKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S615	Uncharacterized protein	0.739	771-781	MAKRRAAHARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9P5	Uncharacterized protein	0.805	71-82	KKKTSYRKKRQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9P5	Uncharacterized protein	0.618	142-143	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAU1	Zn(2)-C6 fungal-type domain-containing protein	0.914	70-80	RGGRRERKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAU3	Mitochondrial distribution and morphology protein 34	0.951	358-375	RSRAGGMRKRKKRVVDLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAX0	Serine/threonine-protein kinase RIO1	0.999	469-516	PSRGKKHIDHEEKVAHKKAIKEEKREKRKEKMPKHMKKKLTSQTGRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDE4	Uncharacterized protein	0.706	495-503	LRRKSSARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHQ4	Uncharacterized protein	0.99	127-150	PVAKKVKRAPAGRGKGRTKKAVKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHS8	Uncharacterized protein	0.861	970-1006	APAKTHPRTPGKIPTKTTAKTPAKTPAKAPGKTPGRL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHS8	Uncharacterized protein	0.823	843-872	KRAETEKPGKGVGAKVGLRAPGKIPGKVLG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHS8	Uncharacterized protein	0.668	943-953	PAKIPGKGPTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJZ9	Uncharacterized protein	0.984	681-731	RLKKLQDAEAEKRAEEEKKERIAKKLAAMGPPKAKEHSPARPAKSPPKEKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKK3	Uncharacterized protein	0.623	23-27	RKPPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMM3	Uncharacterized protein	0.902	1220-1236	KPKKKAKTTKSAKEARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR04	Uncharacterized protein	0.667	308-313	PKRARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS60	Exosome complex protein	0.996	213-236	SKKGKKKKTKTQKMKAKREAKKTE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS60	Exosome complex protein	0.991	353-369	KSRSKRGGKKGSRGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS60	Exosome complex protein	0.909	276-287	RKRGRPPKKDKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS60	Exosome complex protein	0.694	132-143	RMAKEKARAHLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS79	U1-type domain-containing protein	0.967	183-197	EKRRLRNEKRRAKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS79	U1-type domain-containing protein	0.72	29-45	KKAKDREAKERDEGKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSR3	Ubiquitin carboxyl-terminal hydrolase	0.808	400-409	RARKRQKRMK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZS2	Uncharacterized protein	0.923	374-402	LKGNKRARPSDDGHEKSVPKKKARSSAPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZS2	Uncharacterized protein	0.919	474-492	VKIKRKKESAPKPSRLTRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1C7	acidPPc domain-containing protein	0.762	37-49	RVRRKWRATKSRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1T9	Protein SDA1	0.991	691-754	KRKEKKEAEGKSTTNKEKARKKNFLMTLGKAKSKNKRSLGDVKKTLLGHVERKKRGGKRGNKGN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1T9	Protein SDA1	0.99	259-287	GINKKSKKKARDLKHAAVSLKKKEKKKHA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5C6	TEA domain-containing protein	0.676	236-240	KRRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5C8	HMG box domain-containing protein	0.993	104-122	KGKKRKREKKEKDPNAPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5C8	HMG box domain-containing protein	0.992	365-393	LEKAEKAEKAEKAEKASKEKKRDRTKRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5C8	HMG box domain-containing protein	0.939	307-323	KKDSKKKKEKAAPQPIA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5C8	HMG box domain-containing protein	0.86	340-352	SGGKKKKSSRSTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E7	Uncharacterized protein	0.998	1121-1149	SPKKAARGRGGARARGRGRPRGRAGKAKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E7	Uncharacterized protein	0.983	7-37	RKRLRSDSPKAEPPAKRARDRKPPAPTRRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E7	Uncharacterized protein	0.944	1042-1072	PKPTRRKSSSTRGRSNPRARASQPSIRKRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E7	Uncharacterized protein	0.64	592-595	KRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E7	Uncharacterized protein	0.637	858-863	KERAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E7	Uncharacterized protein	0.617	240-243	KGKW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S904	Uncharacterized protein	0.986	68-89	KGGKRDKKEGAKKEGGDKKKSG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S904	Uncharacterized protein	0.819	10-32	KAAAPKKPTQRVQRGARVIKPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Y3	Uncharacterized protein	0.901	98-114	KSQSRRRQSRGRGRRGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Y3	Uncharacterized protein	0.894	34-49	SKKTERKTPKKLGGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Y3	Uncharacterized protein	0.875	130-144	GGRRNRQRQKKGGKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFE4	SAS4 domain-containing protein	0.801	518-525	RQRRRRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFE4	SAS4 domain-containing protein	0.699	439-446	PKPRRPPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFE4	SAS4 domain-containing protein	0.669	71-86	KEGRPTPARAHSSRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHF2	Uncharacterized protein	0.98	90-113	RRPSKKPKINKDGAPRKPRQPRPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL15	Uncharacterized protein	0.812	58-64	RGKKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL71	DUF2431 domain-containing protein	0.958	4-31	TKTKRARRELKREGDRKIMAHHRKIAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPT0	Phosphatidylserine decarboxylase proenzyme 2	0.999	245-269	KKAEKREKRRKKLKLAKLKRKAKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPT0	Phosphatidylserine decarboxylase proenzyme 2	0.653	776-781	KKRIRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ46	Uncharacterized protein	0.83	1666-1677	RRGSGKRKRGDA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRZ1	RING-type domain-containing protein	0.99	40-65	RKKRAAAKRKREQAWPPAFGRRKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSW0	Phosphatidylinositol 4-kinase	0.838	317-324	AARKKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTD4	Uncharacterized protein	0.85	428-449	LRLKKRRARDVDVQSKKRAPLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUV6	18S rRNA aminocarboxypropyltransferase	0.937	5-28	KKDFKGNNKFRNPAKARAPPRPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE6	RNB domain-containing protein	0.886	505-515	KREKEEKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWT7	Histone deacetylase	0.896	121-131	HKQKKKKKSVA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWT7	Histone deacetylase	0.892	678-693	SRRKKERNVGGRGERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1L9	Fatty acid hydroxylase domain-containing protein	0.975	277-292	SKKRRERKLAKARKAQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S297	Transcription elongation factor 1 homolog (Fragment)	0.828	2-17	KRKSSSKPQGPKKKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S512	Exocyst complex component EXO84	0.911	8-22	ISLRKKRGDKSKKNA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5X1	DUF1746 domain-containing protein	0.616	192-193	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RER4	Uncharacterized protein	0.672	444-451	AKLARRRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFC9	Ribonuclease P	0.994	73-96	PPTSKPAPKSRKPTNRKKKPKLPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFM9	Uncharacterized protein	0.674	126-137	KKRINKIKIWRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG10	Zn(2)-C6 fungal-type domain-containing protein	0.819	261-273	KAAQRSKKGKERA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH18	CENP-V/GFA domain-containing protein	0.702	72-77	KKPRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI01	F-box domain-containing protein	0.787	1284-1297	PPRRSGPQRRRDRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLX8	Uncharacterized protein	0.956	138-175	GKKKRAEKRAGLAIEEAYRDGKKTNTEKRRKSQKKPHG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLX8	Uncharacterized protein	0.692	67-76	RKKRQIVKRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPV7	Uncharacterized protein	0.867	247-272	RRRDRDGRRHRTQHVRAPRQPVPRRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS46	Uncharacterized protein	0.77	537-554	RSLGGRPRSSSHKRHPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS46	Uncharacterized protein	0.667	513-516	KKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTB5	Uncharacterized protein	0.991	170-199	EKRRKQKPRRLRRSPTGGFQRHDPHAKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV20	BAR domain-containing protein	0.977	407-431	GKKAPPPPPPSRAKKPPPPPPPMKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY88	Uncharacterized protein	0.985	389-428	KGQEKPKKSKTGGGNSGQNKHPRPKDPGGRGGRGGRGGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ12	Uncharacterized protein	0.711	51-56	PARKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S292	AB hydrolase-1 domain-containing protein	0.729	668-678	KKHRRNVLRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3T8	Uncharacterized protein	0.747	854-862	MRKRKMGKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7W7	37S ribosomal protein S25, mitochondrial	0.829	50-61	VPKMRKARKASK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9V5	Uncharacterized protein	0.882	367-392	IKRLKNSASRKSLKRQSSRLHRKFSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAU4	Uncharacterized protein	0.988	512-525	KRRKREKKRPRDKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCI1	Brr6_like_C_C domain-containing protein	0.782	210-228	RKAESRIVKRRSERSQSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD54	FAD-binding FR-type domain-containing protein	0.601	75-75	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI47	Pex24p domain-containing protein	0.931	460-507	RAKLKKRGSSKGGSKDIGDQEREVLRRAWEESKPSRKGEWRRRRWVRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIS1	Uncharacterized protein	0.637	233-244	PKPFKPPVESKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK74	Uncharacterized protein	0.918	473-489	KVKKAPKKLGSKGKGEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK74	Uncharacterized protein	0.856	549-560	KVKKKPKKLQVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLP9	Uncharacterized protein	0.957	272-301	KRPSIIRKISRSLKSGVRKVSGRKDKKEKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN35	Uncharacterized protein	0.986	792-806	RKIRGSKGRKGRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN35	Uncharacterized protein	0.952	726-750	PRNVRLGRPSDEFDKKGRKVKKAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRK1	RRM domain-containing protein	0.822	385-406	LRQKKEADDKAREEKKAKEAAE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRT7	BZIP domain-containing protein	0.956	329-359	RSRAKKGAANGKQAAGNKRKADDPPKSSRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW05	Uncharacterized protein	0.697	309-314	KKKKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY79	Uncharacterized protein (Fragment)	0.998	434-448	KSASKKKKNKKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S051	SRP9-21 domain-containing protein	0.993	159-170	GTGGKKKKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S721	Uncharacterized protein	0.996	337-366	KAPKPAEAPKKKGKDKEKEKEKDKSPRPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S721	Uncharacterized protein	0.927	748-758	KSKKKGKKHRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCN5	Uncharacterized protein	0.879	1522-1535	RQAKRLKKERRAGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCN5	Uncharacterized protein	0.733	2240-2258	RRKREQARIAAELEKRRRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCN5	Uncharacterized protein	0.652	2266-2278	RERQKEMERQKKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIS4	Uncharacterized protein	0.905	315-360	RKPPAAPVKGAPPVMAGPKLGGSKSARAKMHKAQQEEAAAKKGKIR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIS4	Uncharacterized protein	0.762	72-81	NRRRPRDRLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIS4	Uncharacterized protein	0.755	15-24	FKRRKIAHPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPX7	Ubiquitin carboxyl-terminal hydrolase	0.852	194-203	RASRGRRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSR1	DUF262 domain-containing protein	0.617	791-793	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVF0	Uncharacterized protein	0.938	38-48	PKSKNKKKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S128	S4 RNA-binding domain-containing protein	0.95	243-257	GRPGRVRRKKAKAAE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4G5	BHLH domain-containing protein	0.929	152-166	PKRPTRKRGRPKMDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S826	Uncharacterized protein	0.931	160-175	KSHERKAKKHPHRHRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9C4	alpha-1,2-Mannosidase	0.787	164-170	KKKKKID
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9C4	alpha-1,2-Mannosidase	0.601	680-680	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCN2	Uncharacterized protein	0.993	251-297	IKKGSIKKGYTKKEPIKKEPVKKETIKKESIKKERAKKEPTKASIKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDJ1	DUF2183 domain-containing protein	0.997	1522-1555	EKADAKDSSTKEKPKKDAPKKEAPKKKGPGKKNV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDJ1	DUF2183 domain-containing protein	0.995	1450-1473	EAGSKNEPKKGAPKKKAEGKKKAE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDJ1	DUF2183 domain-containing protein	0.987	1605-1654	KPKADAGAKKGVNKSSAKSKPSKGDAKAKANAKERTEGTRKSSRVAGKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDJ1	DUF2183 domain-containing protein	0.831	1668-1677	PAKKTKKSKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDJ1	DUF2183 domain-containing protein	0.615	1442-1444	KKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLL8	Uncharacterized protein	0.886	488-530	REAEKKQSSFGRRIWKRLSRGGNEKDELAPNEREAGKQKRKKW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQV9	Uncharacterized protein	0.696	31-39	IRRRSRPTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTJ7	Uncharacterized protein	0.713	298-303	RKRRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTJ7	Uncharacterized protein	0.641	318-323	SRRSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVL2	Uncharacterized protein	0.613	70-73	GRPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX53	Kin17_mid domain-containing protein	0.629	281-283	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX53	Kin17_mid domain-containing protein	0.606	292-292	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0A2	Uncharacterized protein	0.979	165-186	RKSKTEANNKRKSRRKGAKANK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0A2	Uncharacterized protein	0.658	614-628	RVKVGAGKNVNAKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0V8	Uncharacterized protein	0.656	329-337	KRKLSTMKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S385	Uncharacterized protein	0.883	11-30	PKRGARTKAPPPTKRPSRLA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8M8	Uncharacterized protein	0.997	40-61	KRLRERRKKRKTRKEPDKPDKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8M8	Uncharacterized protein	0.781	475-480	KKKKRF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX4	Uncharacterized protein	0.934	478-499	RAAKPEARDQRDRRRRARLKDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX4	Uncharacterized protein	0.722	87-94	IGKKSGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX4	Uncharacterized protein	0.652	29-32	PKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCX4	Uncharacterized protein	0.643	601-604	RRRN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF50	Uncharacterized protein	0.741	291-298	NRRSRKKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI09	Uncharacterized protein	0.969	602-618	AKRLAEKRKRKGKVVRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKC4	Uncharacterized protein	0.809	61-68	SSKKKKRL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKC4	Uncharacterized protein	0.803	226-235	RKRRKGQSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKC4	Uncharacterized protein	0.658	9-17	RKHKVLARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM53	Uncharacterized protein	0.946	22-54	KKKSQPHSHKHKSSRHHRDRPDGHRHSSSKRHA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMP5	Uncharacterized protein	0.909	335-349	NAQKAPAQRRPKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRE4	40S ribosomal protein S7	0.691	148-155	PRPKRSNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE6	Phospholipase D	0.932	252-264	RRPRQKRRKSSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWG4	Uncharacterized protein	0.651	117-122	RRKVRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3R0	DNA mismatch repair protein	0.855	210-224	AKPARGKKGAATKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5E1	YDG domain-containing protein	0.996	109-149	SKPRKRKVPVQKPEERRAKKEQVRKKQKEEAEKKAEEVKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAT8	Uncharacterized protein	0.836	500-528	KPKAQKIKMRKIQSGPTSKKAKTEANPGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAT8	Uncharacterized protein	0.807	539-580	VRPKRKLLMKPSPRTTLPPSPKEPMSAYKQTKKSPRLRSHRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK78	Uncharacterized protein	0.998	1247-1303	AKARAAKAAKQAAKRREEESTKPTSRLRSGPLQARKAAPGKPGRKKVTKPRGKGKNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK78	Uncharacterized protein	0.998	1394-1417	PVVAVKKKKGKARPGASKKKRKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK78	Uncharacterized protein	0.708	1381-1391	RSSRTRKRLSN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK78	Uncharacterized protein	0.62	1221-1225	PKTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKV4	MFS domain-containing protein	0.826	598-607	NERRKKRASK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP99	Uncharacterized protein	0.775	19-26	KKTKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP99	Uncharacterized protein	0.652	447-450	RRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPQ7	BZIP domain-containing protein	0.743	76-91	RKRNQAASARFRQKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQL0	Smr domain-containing protein	0.984	199-210	RGKKGKKKKKQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS76	DNA topoisomerase 2	0.998	23-69	AKPAKAAKVTKPKAAAPKKAAGPAKPRGRPAGATAKPKAKAAPKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS76	DNA topoisomerase 2	0.993	1291-1322	KRKKKIAGITRRASQKLGIAAGKSGKGKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS76	DNA topoisomerase 2	0.989	1579-1640	KPAASKLTAKPAAKPKTAAAKPVPKTKALAKKPAAQSPAAKAYAKKHGKEVEAAKPAPKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS76	DNA topoisomerase 2	0.896	1675-1696	KPAARKPAAGAARPGRRAAAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS76	DNA topoisomerase 2	0.884	100-114	PKAKKAPGPKKSSGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS76	DNA topoisomerase 2	0.88	1412-1429	KPAPAKRGRPAAAKPVKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS76	DNA topoisomerase 2	0.851	1339-1346	KKKAKPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUM4	Structure-specific endonuclease subunit SLX4	0.992	129-146	ESEKPKPKPRARKPKPKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUM4	Structure-specific endonuclease subunit SLX4	0.989	189-235	KLTKTGKLRKSRAKKQAPEEGGEAPIPKPRKTRVAKPKAAATRVKGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUM4	Structure-specific endonuclease subunit SLX4	0.964	464-488	KKPLRKRKSASDKADSKAKSKKTST
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUM4	Structure-specific endonuclease subunit SLX4	0.891	752-769	KPLPPKAKTKSKEKAKSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUM4	Structure-specific endonuclease subunit SLX4	0.767	727-735	PKKRGRPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUM4	Structure-specific endonuclease subunit SLX4	0.701	115-123	PKRRYTKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUM4	Structure-specific endonuclease subunit SLX4	0.693	405-412	GKATKKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVG4	Nucleolar protein 58	0.999	500-571	KSTKVDPKKAAKQAEKEAKKARKAEREAKREAKKAKKAAKESKKSDTKESKKRKADGGDDGEKKKKKKKSKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVG4	Nucleolar protein 58	0.697	460-467	SKKAKAPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZZ8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.947	600-644	RRGMGRGRGPWGDRGRGFRGRGAGGRGDFGGGGGRGDRGGFGGAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZZ8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.912	749-765	GGKNKNRKQRQREKRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZZ8	H/ACA ribonucleoprotein complex non-core subunit NAF1	0.675	517-521	KAKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Y3	UBX domain-containing protein	0.942	339-356	REKARKKKEEAERKAREE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2V8	Uncharacterized protein	0.917	345-354	GRRKKRKGAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2V8	Uncharacterized protein	0.647	449-453	RRVKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S844	60S ribosomal protein L8	0.664	250-254	EKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8I9	Uncharacterized protein	0.957	517-540	KQAQRKRRAAEARAARSRNPRRPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9K6	Uncharacterized protein	0.977	461-481	RRAHFHPRKRGRKGKNDEKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Y2	Uncharacterized protein	0.898	27-56	NKKKQDKREAGLQSARSRSSSRRARRQRLE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REQ5	Zn(2)-C6 fungal-type domain-containing protein	0.847	131-142	SRRGWKGKRKNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHC7	Uncharacterized protein	0.805	194-210	RSKEEERRVRKMREKID
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKY9	UBA domain-containing protein	0.951	586-596	EKKKRGRPKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKY9	UBA domain-containing protein	0.61	560-561	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKY9	UBA domain-containing protein	0.604	704-704	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNH0	CRAL-TRIO domain-containing protein	0.86	56-71	KKDKKKSRLNVFKRNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU03	Uncharacterized protein	0.701	490-505	RRSESPPMQRPTKRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVQ2	Uncharacterized protein	0.611	1638-1640	KRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ54	Uncharacterized protein	0.963	343-412	RRSTRSRRTTHSESKHKSHRTKSEKTSKTTKTSESKRPSSKAPSKAPSVAPSKTSSRSGKESSRKKEKEP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0K3	Uncharacterized protein	0.988	1067-1089	KFRSRKKKKMTKKEVKDREVRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U2	Uncharacterized protein	0.964	251-295	EMSKAREALARRMKAERARRETERTEKDERRELRKASKVLRSGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1V7	Uncharacterized protein	0.612	560-562	RRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3F8	TLC domain-containing protein	0.873	31-40	PRRRKPRAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3J8	Uncharacterized protein	0.917	799-839	AEAKRLQKDYKRERKGAMRELRKDAHFIARESLREKKERDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3J8	Uncharacterized protein	0.915	860-874	RNGYEREKKARKAGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Z0	Uncharacterized protein	0.942	615-666	SNRKKQNGKRKDAKWVFPKAVEGAGVRVPKGDIRVRIRRREGLPASKIVRRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDC4	PAPA-1 domain-containing protein	0.872	313-327	INRLLKKQPPKRGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDC4	PAPA-1 domain-containing protein	0.828	289-309	RRAEMARRRKNLSEKRNEEEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGR6	Uncharacterized protein	0.778	33-41	VPKRRRSRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKD9	Nudix hydrolase domain-containing protein	0.626	65-67	RRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL97	Uncharacterized protein	0.788	718-740	RKNSPAPKSVAKRKSFPSLGARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ1	Stress response protein NST1	0.998	470-628	RKDAKEAKKAKEAQKRKEKKDKQKQLKAEEKARKDAELAAKEAEAKAAEEKRLEEQRKKREEQRKKKEAERKAQEEERQRKEAERLKRQQEERERQQEAERKAREQKALEKKAKEEAKRKEREEREAKEKEAREKKAQEDKERKERESKSKTEKDRTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ1	Stress response protein NST1	0.987	103-119	RGGSSKKPRRKKKAPSG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSJ1	Stress response protein NST1	0.952	19-33	RKKQKRREKEAAKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSM3	Transcription initiation factor TFIID subunit 2	0.928	1402-1457	APSPRPSVAPPARPTAAAPSAPTPKHMIKQKRSKIVKLRLAPHHLASIRDSKKRKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTT9	Uncharacterized protein	0.886	182-200	KKKRKSGLRNVFRKMFGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW68	Uncharacterized protein	0.988	412-449	KPKSVARKMGRKPRKVKSWANSIITRKGKHSKRVKARS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW68	Uncharacterized protein	0.951	870-884	KEKKKKKNIGSRLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3K2	Uncharacterized protein	0.995	225-253	GHQGGRGFRGNWDRKKRGRGRGRGGRGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6X1	Uncharacterized protein	0.717	24-31	GPRRRRLP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S908	Uncharacterized protein	0.625	37-40	KSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCM1	Uncharacterized protein	0.897	12-23	PAPAKKGKGKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE96	Uncharacterized protein	0.938	541-571	KEKRKAAAQSLAKFFKPKHGKDPLHRRRGRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGC7	Uncharacterized protein (Fragment)	0.823	218-236	KKKRLAALRRKHYGDGGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGS5	Uncharacterized protein	0.777	462-474	KGKSKPPPKPTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJP3	Fe2OG dioxygenase domain-containing protein	0.979	359-376	KTKIRMRTGRTKKKKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKP5	Uncharacterized protein	0.701	31-43	KKPPKCKPRTPKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLA9	Ditrans,polycis-polyprenyl diphosphate synthase ((2E,6E)-farnesyldiphosphate specific)	0.655	47-63	KKALRDSRQRASQKHRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMS1	40S ribosomal protein S24	0.989	103-134	KASRQQRKQRKNRMKEFRGTAKTKGGAKKDKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTH0	PH domain-containing protein	0.854	99-118	LKKKNSVKRSGSLKRSGSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM1	Uncharacterized protein	0.69	96-103	RRFRLKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUB8	WD_REPEATS_REGION domain-containing protein	0.981	477-554	KARRGEKEPDKVDLLKKRGKGRNSALRRYLRKSGSRNVIDEEKERAREAMRSLQKRQMEKREKLKKDYGPALERFARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUB8	WD_REPEATS_REGION domain-containing protein	0.78	47-61	RIRPKSVKDKKLRSN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX17	Uncharacterized protein	0.845	277-286	AKRFNRKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2Q0	Zds_C domain-containing protein	0.969	613-673	RSEDKKSDKKSKDKKEAEGGPRKTSWGWFSGDKDKEKEKDKKDKDEKEKEVGTKKVKNKLS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2Q0	Zds_C domain-containing protein	0.935	717-761	RKKESARKTSSEGKKEKEPGLLSSIFGGKKKGEKESSHKKNSSRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S393	Uncharacterized protein	0.986	166-187	SKRGRGRPKGSGKVGRPRKQRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7C1	Uncharacterized protein	0.723	90-98	KPKKGEKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAS7	Uncharacterized protein	0.989	698-714	AKAKRKEKLRKRKERER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAS7	Uncharacterized protein	0.925	777-786	KTKKRKKAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAS7	Uncharacterized protein	0.783	11-25	RPTKVKKRENLQKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAS7	Uncharacterized protein	0.636	762-765	KKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE05	Zn(2)-C6 fungal-type domain-containing protein	0.773	590-601	KSKSAKSNKRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF49	Uncharacterized protein	0.969	316-332	REDRRRRRREEKGAKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN19	Endo/exonuclease/phosphatase domain-containing protein	0.762	460-478	AEKRRPSASGSPSKPIKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN97	Transcription factor BYE1	0.958	177-193	GERPWARKKGSKPKPRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN97	Transcription factor BYE1	0.938	276-296	EKRRHEASAEKPNASKKRRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN97	Transcription factor BYE1	0.605	21-22	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP67	Uncharacterized protein	0.915	207-230	KKWVMAKEARETRRMQKEARRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP67	Uncharacterized protein	0.654	20-25	GRPRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWN7	Uncharacterized protein	0.758	465-474	IKRKERVKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP1	Uncharacterized protein	0.784	372-381	KDDNRKRKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0I8	PPM-type phosphatase domain-containing protein (Fragment)	0.978	222-242	KMKLMLRRKNTNAKKKEKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S310	BRCT domain-containing protein	0.909	87-115	RRYKWEVLTKERRTRKELKRLGKVADGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S310	BRCT domain-containing protein	0.694	138-143	KRKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5R8	Uncharacterized protein	0.948	120-148	KKNRAPRERDRDKAAEDRDRKHKLKKVNA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5R8	Uncharacterized protein	0.905	540-558	KRNRNIGKGKKQNKRPGGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T9	Sec3-PIP2_bind domain-containing protein	0.683	807-811	RRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8C8	DNA replication ATP-dependent helicase/nuclease	0.803	1626-1649	RSRRRRLGNKSSSGSPEEKRAPGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8C8	DNA replication ATP-dependent helicase/nuclease	0.754	125-132	RKNKKRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H3	Uncharacterized protein	0.988	256-292	KKEEEKKPAVKKGTKRKAADSKIPAEGTRKSSRTKKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAF0	Uncharacterized protein	0.982	685-712	EREKDRRRRKDERSRSRGPEERSRASPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAF0	Uncharacterized protein	0.914	542-573	RERERRKAQDERDRQDRPDERRERKPEGRRNS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAF0	Uncharacterized protein	0.711	865-876	DRGDREKRSHRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG84	Uncharacterized protein	0.973	505-518	MREKAAKKKHKKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG84	Uncharacterized protein	0.806	125-136	PAVRIPPRKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ8	DUF4211 domain-containing protein	0.986	168-183	PRKKSKKRDSKRRKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ8	DUF4211 domain-containing protein	0.892	54-65	PNKGAKKKPKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ8	DUF4211 domain-containing protein	0.876	269-280	PRSTRRRLKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ8	DUF4211 domain-containing protein	0.85	678-687	DRKREKKARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGZ8	DUF4211 domain-containing protein	0.745	353-370	DKPKNKRQEALEALKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI46	Dual-specificity kinase	0.769	1346-1353	SKGRRRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RII4	Uncharacterized protein	0.943	221-240	GGNRKRKRGVTQASKKPRKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ15	40S ribosomal protein S25	0.936	6-21	GKKQKKKWSKGKVKDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLN9	Uncharacterized protein	0.931	72-86	GKKPRRTSKKKNTSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLN9	Uncharacterized protein	0.665	16-20	KRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR48	Brix domain-containing protein	0.982	369-402	KRWAQKNKEKEERRRIQKENVEKKRKEKAAARGE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR48	Brix domain-containing protein	0.887	297-327	RREKEKLKAGDETSHARARGSKPRVEKRAVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR48	Brix domain-containing protein	0.853	5-25	RGTARKKQSAKDKELAKKPEA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTE1	Phosphoinositide phospholipase C	0.979	184-208	RKEKKKSKSGLSIRKRLAAKFGKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE2	Uncharacterized protein	0.818	204-211	RRKRRNRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVX7	CP-type G domain-containing protein	0.998	4-48	GKPKSKRVPVRLRHKIEKASAAKQKKAKKLAKKDPTWRSKTKKEP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWN9	MI domain-containing protein	0.998	644-815	SRSRSRSRTYSRSRSPVRRRRDASRSRSSSRSRSYSRSHSRTRSYSRSRSPVRKRRGTSRSRSSSRSRSYSRTRSPSPARSPAPRRRGRSPSSSRSRSRSRSRSPASPPPRRRRETSSPPPPRRRRESSTPPSPRRKRESSTPPPKRKRESASPPPTRTKRDSSSPPPRRRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWN9	MI domain-containing protein	0.742	53-60	KKRPGRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZE2	Chloride channel protein	0.936	124-157	RRKARRRARDSIGVRRDGSSGRVFLGRGRGIWRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2U7	Isochorismatase domain-containing protein	0.845	239-246	NRRRKKKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3V9	Ribosomal protein	0.749	94-105	NKNKKLIKKLAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S643	AP-1 complex subunit gamma	0.809	609-620	KKRQSKIAKKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6X2	PH domain-containing protein	0.938	952-983	KTSAERKPAWTKEPWVGKPRRKSIRTASGRRQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6X2	PH domain-containing protein	0.646	1128-1131	KKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAV2	DNA repair protein REV1	0.947	951-976	RKNRIIGIPAKKPIVPVKRGRGRPPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAV2	DNA repair protein REV1	0.68	1071-1077	KRKTKAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD29	Uncharacterized protein	0.999	798-845	KVKSKSKKPKKSSKDRKGKGRAKPKLSLAQLKKESLRSKAAKKRYMRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGH8	Uncharacterized protein	0.916	1284-1301	ERKRRKQLAKKSMKNIRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHZ8	Ribosome production factor 2 homolog	0.797	6-19	KPKNARAKRAMAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHZ8	Ribosome production factor 2 homolog	0.612	250-252	KPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK39	Uncharacterized protein	0.87	116-129	PPPRRRHRQERPRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK39	Uncharacterized protein	0.869	87-104	PPPSRDPRDTRPRRPRRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK39	Uncharacterized protein	0.822	159-175	KSEGYKSDRRRKEKDPY
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK39	Uncharacterized protein	0.793	177-196	DERDRRDKPRSDRDRDRDRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK39	Uncharacterized protein	0.757	57-65	HRRPRRDRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK39	Uncharacterized protein	0.755	241-253	RRKSGRDAGKPGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK39	Uncharacterized protein	0.602	155-155	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN1	Cryptochrome DASH	0.947	606-654	RGRGGHDGRPKRGGGGGGGGGGGGHGGGFSWRGRGGRGHQGSDRNQRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN1	Cryptochrome DASH	0.681	416-421	HKKWKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN47	Uncharacterized protein	0.878	300-319	RSSSKGRHVRRRTRSTSRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RND6	DOMON domain-containing protein	0.752	370-383	KRGSAHARALRRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTT0	Uncharacterized protein	0.677	547-552	GPKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWZ7	Uncharacterized protein	0.879	452-460	NKKPRKKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4P3	PCI domain-containing protein	0.747	486-495	KSKAAKAKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S756	Uncharacterized protein	0.884	34-49	KKRKATKEPEVKKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S756	Uncharacterized protein	0.757	149-167	EKDGEKIASKLTRKDRKAS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA39	Uncharacterized protein	0.945	328-351	KKEKEKQEKANAKKKGGPAPQANK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCE1	Fungal_trans domain-containing protein	0.817	848-861	KEPPRDRKKEKNIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCP9	Phospholipid-transporting ATPase	0.727	231-242	KSAKGNKGAKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCP9	Phospholipid-transporting ATPase	0.705	32-47	KAENKRHSLKERLHRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP1	Uncharacterized protein	0.731	6-26	KRPLESRSRGNSPPDKRSRPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP1	Uncharacterized protein	0.661	150-154	KARKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REH5	HAD_SAK_1 domain-containing protein (Fragment)	0.817	449-489	RGGRDRDDRPGGYRGGNRDRGRGGNRNPSYAQRGGARGGHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REW4	FHA domain-containing protein	0.999	94-237	REPSPEPYRKPRAASGERKRHGSRDGKRDRSRDRRRDRSRDRRRDRSGDKKRDSSRDRRRDRSRGKDTDRDKKRHRSRERHGRRDRSRSRDRRRRDKSTQGRRSRSPIPYRSRKPRTRSPSASASPPPKRRRRTPSPSPHKRTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REW4	FHA domain-containing protein	0.908	46-80	SERPKKEPSIVSGRRSRSRSSEGKPRISSREAEAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFN2	Uncharacterized protein	0.978	9-89	GDRGRGNFRGDRGGSRGGGRGDFGGRGGGGFRGDRGGGGGDRGRGGFRGDRGGGGGDRGRGGFRGDRGGGGGGFRGGRGGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFN2	Uncharacterized protein	0.818	443-455	EGAKGKGKGKVPT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH00	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.842	595-604	RGHHGKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH00	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.664	332-337	RPRKPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH00	tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6	0.631	427-430	KRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR7	TGc domain-containing protein	0.634	97-110	RPPPRTSGTPKPSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR7	TGc domain-containing protein	0.605	39-39	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM70	Uncharacterized protein	0.842	121-142	SRDKAKYQAKGKETKAPRGRGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM70	Uncharacterized protein	0.698	13-27	QKEVEKKEKNAIAKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM70	Uncharacterized protein	0.611	9-10	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNB9	Uncharacterized protein	0.841	866-877	KLGKGKGKGKGH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNW3	Uncharacterized protein	0.763	9-20	RGSRTRKPKAIF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNW3	Uncharacterized protein	0.735	26-34	VKVRKSKRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI6	Valyl-tRNA synthetase	0.996	53-105	KGVEKKEKSAKELEKERKKAEKDAKFKAKKAAAAGASKDTGTAPAKEKKKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTP1	Pre-mRNA-processing protein 45	0.823	217-231	KFKHKRIPRGPPSPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUQ4	Uncharacterized protein	0.86	81-100	SRRSSFRRRSRSRSMHRSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVL0	Bromo domain-containing protein	0.995	28-53	KRAAPQRRRHRGTPGAKKKPSKRQRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVL0	Bromo domain-containing protein	0.819	362-381	GSGRRSNRLRGKTRQSGRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVL0	Bromo domain-containing protein	0.759	312-324	NLRNRAASAKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVL0	Bromo domain-containing protein	0.733	1273-1281	RKAREKREK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXE4	Uncharacterized protein (Fragment)	0.928	22-58	VKAGRVTKPAATPKSKSKDIAKSVASNVKDKKKSKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I0	Uncharacterized protein	0.706	408-417	RKKKSTKTPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3I0	Uncharacterized protein	0.673	338-355	RRSPPPPPPPQPKNSPPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFL5	RNA polymerase II subunit B1 CTD phosphatase RPAP2 homolog	0.664	111-115	KKKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG67	MRC1 domain-containing protein	0.993	1259-1290	REAERRALLEKKEGKRKEALRKKVEGGRKKGV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG67	MRC1 domain-containing protein	0.973	215-241	RRIREERLAKQREEKAGKIKPKKTARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG67	MRC1 domain-containing protein	0.604	266-266	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHX0	F-box domain-containing protein	0.866	191-199	DKRKRRRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM31	PX domain-containing protein	0.953	938-957	RKSRARAAEKLRRKAGEPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPE3	WD_REPEATS_REGION domain-containing protein	0.857	105-120	TKAKKEKKEGVIRARP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRS0	Uncharacterized protein	0.951	276-303	KAKKAKNKSRSVSRGKRASLFGGLLGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM2	Uncharacterized protein	0.669	920-926	RDERRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM2	Uncharacterized protein	0.606	916-917	GR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUH9	Uncharacterized protein	0.721	29-44	SKRQKADRGAGKPTHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU3	PIPK domain-containing protein	0.893	666-676	RQKRASKRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV24	Uncharacterized protein	0.956	509-539	RAKKWAERERREKALADRERRVREEKRKQER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV24	Uncharacterized protein	0.728	186-195	KEREKKERRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWW9	Uncharacterized protein	0.994	83-106	KSRGKSPPKKKRTAAESKKFNKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYS9	Protein kinase domain-containing protein	0.877	722-737	HKHRRSSSPRKHGKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1P0	Uncharacterized protein	0.976	138-150	RKKKEKPAKRRRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1P0	Uncharacterized protein	0.786	505-511	ARKRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1P0	Uncharacterized protein	0.649	68-73	KLGKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2D0	Uncharacterized protein	0.957	379-411	RGERGRGRGKQRGGGRNDRNEYRQRSPPRRQPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2D0	Uncharacterized protein	0.606	343-347	RSPAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Q0	Uncharacterized protein	0.737	5-22	KKKRYRSRSPEQARASKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S959	Uncharacterized protein	0.979	424-458	VRQRQAAGKLTSPKATKKPTRGKKAASKAAQKASK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S959	Uncharacterized protein	0.955	361-376	AKAKRGAKKNKKAEQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S959	Uncharacterized protein	0.745	8-24	KVASRVAKPPARKQQAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S959	Uncharacterized protein	0.619	337-339	RRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAH5	Tr-type G domain-containing protein	0.611	1077-1078	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDW7	Zn(2)-C6 fungal-type domain-containing protein	0.814	18-28	SSPKRKKVRQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIL4	Protein kinase domain-containing protein	0.801	42-60	DSKQKRPRTGTGRVKLWRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK41	Uncharacterized protein	0.988	122-165	KERKTLKRKRVAAETNRIRAEKKSKVKAAASVVGRKPPPKRRHG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK46	Uncharacterized protein	0.866	247-257	KKQEKKQKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK46	Uncharacterized protein	0.607	36-37	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLA3	Uncharacterized protein	0.879	335-352	RALKKEHPKRFRPLKQRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLK5	Letm1 RBD domain-containing protein	0.657	133-140	AKKEEAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSK0	Uncharacterized protein	0.716	276-282	ARRKKNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU78	Uncharacterized protein	0.959	125-153	PRMRTRQRGERKRNGHSHPSSKRRPSWKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE8	Uncharacterized protein	0.997	1108-1123	KKGKAKGKAKAKGRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE8	Uncharacterized protein	0.992	980-1030	SKANPKENTKPTPRSKKPPKPAPQTKAIAKPEAEPKAKAKSKAPQPSRSTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE8	Uncharacterized protein	0.916	536-553	KSKTTNPRKLSKRARKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE8	Uncharacterized protein	0.776	817-831	MPKKTPATRNLRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY85	Uncharacterized protein	0.993	1023-1048	QKKKAKLTSSEMRKKKKDRMARRKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q8	Uncharacterized protein	0.996	428-456	AKKKAAKAAILKARGQLPKKRGRPRKSGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q8	Uncharacterized protein	0.976	128-138	AKKKRKARKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q8	Uncharacterized protein	0.902	175-187	RRKSSTRKAKKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q8	Uncharacterized protein	0.845	402-415	RPKHFKGKGRAWKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q8	Uncharacterized protein	0.793	473-481	KRKRPPPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5V3	Uncharacterized protein	0.95	159-202	KKQRQNRKKVEEAKAAREEEEKARKALEEKQRRVAREARGEPAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5V3	Uncharacterized protein	0.904	55-69	KPKSQKPKAKAPRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6F1	Atypical serine/threonine protein kinase BUD32	0.699	132-140	KGRKEKEKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCK7	Uncharacterized protein	0.907	317-329	SPAKKRKIDRKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD63	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.981	874-888	LKKKAPPKNKKKTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD63	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.94	646-697	KGRNGGFGARGGRRGLGAWDPSTRRGKKPPRIVNAFVDERRKASAPKPRVAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD63	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.788	1038-1066	KIRESEKSKYLPHRIRVQKAREERQRRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD63	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.617	45-47	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD63	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.611	820-821	KG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD63	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.604	823-823	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REH4	Uncharacterized protein	0.993	203-212	AKKKKKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REH4	Uncharacterized protein	0.93	9-24	NQAKKNKKTSRAKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REY9	Uncharacterized protein	0.902	334-355	PAPINGGQPGPKRPRKTAEPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REZ7	Uncharacterized protein	0.971	274-302	KPKRKASPPTASARSSSKDRRAIKKARKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG6	Uncharacterized protein	0.985	21-49	KKRKSQEKAREERAIATREKRDKNKKKRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGP3	Uncharacterized protein	0.909	400-414	PRRSIKERRKKEVGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIA3	Uncharacterized protein	0.751	356-362	KKKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIA3	Uncharacterized protein	0.689	136-148	PKNKRLHAISKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJK0	Uncharacterized protein (Fragment)	0.78	57-67	SKPRKWTKRSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKS1	Phosphoinositide phospholipase C	0.685	1080-1085	SERRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLB2	Uncharacterized protein	0.976	323-346	RLKKEKEERKKRLAAMAAKMKRKY
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLB2	Uncharacterized protein	0.873	148-198	AKEKDATKPLAPPIKHEPTKILSRKERLALKAEASAGAKGKKAVGTALPSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLB2	Uncharacterized protein	0.66	202-212	PKADPSKDKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRC0	Chromo domain-containing protein	0.861	5-20	KRKRNPSRMTPRKRPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSH7	Uncharacterized protein	0.982	224-243	KKGKAKAKAAPSKPRKADKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUG1	Cation_ATPase_N domain-containing protein	0.895	249-265	KSKVRPVKRKENGKAKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0J3	Uncharacterized protein	0.669	19-24	RKRSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2A9	Uncharacterized protein	0.999	543-566	PTKKTPKKEDIVGKKRKKKRRGGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K9	Uncharacterized protein (Fragment)	0.829	457-470	RKKMKKLFKVKQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4K9	Uncharacterized protein (Fragment)	0.79	609-624	TRARKLRDLQRIKRKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9K5	Uncharacterized protein	0.615	426-427	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCP8	Uncharacterized protein (Fragment)	0.952	18-43	KKRRRLHPIRRIAKFLLGGSKQKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCT2	Uncharacterized protein	0.715	712-720	GAKRGKHHH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDZ1	Mitochondrial DNA polymerase catalytic subunit	0.951	471-492	VKGKKKNDPPRPAARQKKPGMP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDZ1	Mitochondrial DNA polymerase catalytic subunit	0.717	1073-1081	RAPPKPKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF66	Ribosomal protein L15	0.944	65-105	RASRPSRPDKARRLGYKAKQGYVIYRIRVRRGGRKRQAPKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF66	Ribosomal protein L15	0.886	180-220	KPVHKHRESRGLTATGKKSRGLGRGHKFNNTTAGRRKTWKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG1	C2H2-type domain-containing protein	0.789	603-614	PKKSKERQRRPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG1	C2H2-type domain-containing protein	0.712	652-665	IDKPKRIGSWGRPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFG1	C2H2-type domain-containing protein	0.679	620-632	LPKRAPSGLLKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHK2	HTH CENPB-type domain-containing protein	0.963	441-506	REVELRRQARAAARLVREKEKAEKAVKKASRAATYITAKRLQKALKTSQKGKKRSLKALCKATTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHK2	HTH CENPB-type domain-containing protein	0.648	377-380	RRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJD5	AMPK1_CBM domain-containing protein	0.913	790-808	KKKKRRSFFGKLKDKLSSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJV8	Uncharacterized protein	0.929	52-69	SQRSASKPSRAPKKAKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJV8	Uncharacterized protein	0.607	25-25	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL62	DUF4110 domain-containing protein	0.994	3-35	KDKKKAAAGGKAAAKAAKAAKQEKKAGKKDKKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1E3	Uncharacterized protein	0.992	988-1008	QKKKKMEKARERRKRWKQTRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1E3	Uncharacterized protein	0.706	7-18	GRGGGDRRRSGH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3B9	Uncharacterized protein	0.94	298-308	KKKGKKEKKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3M3	HMG box domain-containing protein	0.773	108-117	AKRKYRRHPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Q8	Uncharacterized protein	0.819	71-82	RRKRIKRLGARY
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S731	Uncharacterized protein	0.835	581-593	LKELRREKKAARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9X3	Uncharacterized protein	0.995	479-508	RRHPEGGVKGKGKGKGIRKRPDKETRRKQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9X3	Uncharacterized protein	0.994	627-652	KKSKGKDEKRGGTRGRGSKRGGRGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA25	WD_REPEATS_REGION domain-containing protein	0.994	137-152	VERKKKEKKRKDKAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA25	WD_REPEATS_REGION domain-containing protein	0.929	9-26	KRKREEAAAQKKAKKQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE04	Uncharacterized protein (Fragment)	0.678	28-37	PKSDKKAFKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFX2	Ubiquitin-like modifier HUB1	0.994	7-129	APIKRDRSRSPRRSRSPAPRKPKNFSGLKYKGDSDRRGPDRSERRRDDRDRNGPRDMDRRPERRRDDDNSRGDRERRPRHEDGGRRRDYSRDRDSRRRDSSRDRRPRDSDRPRESKPREPKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGX4	BSD domain-containing protein	0.704	606-610	RKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIY1	Uncharacterized protein	0.739	718-724	KRRKQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKL3	RING-type domain-containing protein	0.948	84-121	ESRRERESTKREPVKDKSSRSSKDKEVRRDSSKRTKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKL3	RING-type domain-containing protein	0.747	49-58	RERRERRRAE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMQ0	Clr5 domain-containing protein	0.998	114-137	RPKRTDGRIKKTKPKKKKKIAPGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMQ0	Clr5 domain-containing protein	0.926	221-232	WRTRKRRRRTRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPB4	Uncharacterized protein	0.872	252-267	KKEQGRRMLKKLKRRL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS75	Uncharacterized protein	0.98	623-646	NKKKRKQEKKMGSERSRSKSSKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUH4	Uncharacterized protein	0.93	44-61	QFRFERKFKRRIKAKSIR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUH4	Uncharacterized protein	0.616	30-31	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0I0	Glyco_transf_28 domain-containing protein	0.921	57-73	AKDKEGAPARKKGKAKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0I0	Glyco_transf_28 domain-containing protein	0.636	1104-1107	KKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1F5	Uncharacterized protein	0.888	57-72	KKTRKQLRKQKAKEKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1F5	Uncharacterized protein	0.856	109-119	RKEKRKQKKTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2P8	WD_REPEATS_REGION domain-containing protein	0.73	172-178	SKRRKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2U4	General transcription and DNA repair factor IIH subunit TFB4	0.987	346-355	PRKKKKKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6U5	Ribosome biogenesis protein RLP24	0.714	188-194	KSKRKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6U5	Ribosome biogenesis protein RLP24	0.712	41-51	KMKRNPRKLAW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6U5	Ribosome biogenesis protein RLP24	0.601	111-111	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD41	Uncharacterized protein	0.687	1020-1029	KKVKEKEQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI13	Protein kinase domain-containing protein	0.748	26-31	GKKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI13	Protein kinase domain-containing protein	0.667	294-298	GRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIC5	OTU domain-containing protein	0.955	152-166	RKKKPNRAKARLARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIC5	OTU domain-containing protein	0.723	66-75	KKKQASKKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM33	TAP-C domain-containing protein	0.794	42-53	RGRGRGRGPRGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM33	TAP-C domain-containing protein	0.682	10-17	RGRGRGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM76	Ubiquinone biosynthesis protein COQ4, mitochondrial	0.953	258-282	EKPPDLRAMRKAEREARKKEKEAKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRH8	Uncharacterized protein	0.953	318-355	PRGRPRTLYAEKLPSPRGGQIARVQKEHRGRPKGRKNN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRH8	Uncharacterized protein	0.94	385-401	RRKRIGRPPGSKNKPKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRH8	Uncharacterized protein	0.624	242-244	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRZ3	Nucleolar protein 16	0.958	7-26	KKKNKSSIPKKRQNGPSKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSA5	RHOMBOID-like protein	0.938	133-142	ARKKSKKKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM0	Uncharacterized protein	0.912	213-223	KTKKAKKNKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM0	Uncharacterized protein	0.719	156-167	KHERRLKRLQKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM0	Uncharacterized protein	0.687	241-247	KKKRGER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM0	Uncharacterized protein	0.657	71-74	PKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM0	Uncharacterized protein	0.649	39-43	KGKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM0	Uncharacterized protein	0.605	85-86	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1F4	Cut12 domain-containing protein	0.94	588-617	KRDGSKSTAADRRELAKIRLANKKKERKNH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S527	Uncharacterized protein	0.989	60-83	SKPKSRKRARVPPAERRARPRSRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S782	Protein kinase domain-containing protein	0.947	17-31	RRKKEKEEKKRLKLQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S782	Protein kinase domain-containing protein	0.934	401-418	KAGQEKRRKKSPTAPKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8A9	Uncharacterized protein	0.739	50-59	KKKAAPARKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8C1	Uncharacterized protein (Fragment)	0.605	40-41	KP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCV3	Uncharacterized protein	0.986	47-61	PAPKSKKKKQKERRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCV3	Uncharacterized protein	0.96	164-186	LRESGAGKNAIRASRRKKKAEIR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE56	Uncharacterized protein	0.977	172-190	PQRPKARSQKGKKDKKDKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGS7	WLM domain-containing protein	0.996	172-237	RRVGKRKRRGKEKSAPSYAEKKQRRILKKFGVGGKALGADDDTKVKLEKGVPKKGKPRVAGSARGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGS7	WLM domain-containing protein	0.67	330-342	KKPQGKMPGSAKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP76	Autophagy-related protein 27	0.853	211-224	KKEGKLRRREDKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPJ9	Uncharacterized protein	0.611	322-323	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPW3	Uncharacterized protein	0.604	378-379	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQD1	Uncharacterized protein	0.822	277-290	FKKRQDKGKDKGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQD1	Uncharacterized protein	0.621	1154-1160	PEKLARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQD1	Uncharacterized protein	0.607	1150-1151	RP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST8	RNA cytidine acetyltransferase	0.993	1031-1050	KEAEKFKEKKSKKHKSGKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST8	RNA cytidine acetyltransferase	0.949	69-83	HRKKREKKIKNEIKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST8	RNA cytidine acetyltransferase	0.633	1019-1021	KRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSU8	Uncharacterized protein	0.963	305-318	KTQKKRKRRGPNKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYE5	R3H domain-containing protein	0.957	153-170	PRKSRPPRPPRPPRQKQP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYE5	R3H domain-containing protein	0.932	84-104	RGGRGGRGGGRGARPRPGPDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYE5	R3H domain-containing protein	0.711	20-26	SRRRRNP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYE5	R3H domain-containing protein	0.641	527-530	KKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S159	BHLH domain-containing protein	0.877	172-184	KPAPRKRGRPRLN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3W6	Uncharacterized protein	0.716	169-182	RRLLGHRKDSAKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S654	Uncharacterized protein	0.832	389-398	DRRRGRRRMA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S654	Uncharacterized protein	0.641	775-784	KKRDTPARKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S684	Uncharacterized protein	0.607	287-288	KP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHL5	BTB domain-containing protein	0.805	17-35	KHRASKSKSSKKNPSFKES
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHL9	Uncharacterized protein	0.954	294-324	NREKRKRAEGELKRKFEEDRRRVEGMRGRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHL9	Uncharacterized protein	0.674	124-128	GKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHL9	Uncharacterized protein	0.622	271-273	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHL9	Uncharacterized protein	0.621	279-281	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKF1	RNA polymerase II transcription factor B subunit 2	0.753	470-482	KKKKENRESARGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKU4	Uncharacterized protein	0.998	148-199	EARKSDKDIAFEERKKDLKKKRKRHSEPAAGKSDEGDKIKEKDRKFKQRKRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKU4	Uncharacterized protein	0.996	5-72	KPSAKGKSPKGKSGPKSAGAKSKSKPKATGSAPEGISKRKQKSMSLAKPGGAQKTKSIISKDGRKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKU4	Uncharacterized protein	0.791	93-103	AKPKGVKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSL3	Uncharacterized protein	0.983	32-53	GKKKPKASPSSEKKRRGRPSDG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSL3	Uncharacterized protein	0.979	171-198	LRGRGAKRDPPRHSKSKKNIRPEPSRGW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSL3	Uncharacterized protein	0.74	69-82	KRSSKHSSSKRRSA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSL3	Uncharacterized protein	0.66	89-98	PPSQRRERER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSL3	Uncharacterized protein	0.648	158-162	HRRRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSQ2	Alpha-1,3-glucosyltransferase	0.785	8-14	KPRRRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTK3	Uncharacterized protein	0.909	1110-1124	KKAVARKRQKRSRGW
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTK3	Uncharacterized protein	0.794	13-34	RSTRPPRRHISDSAPPSKRRKY
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTK3	Uncharacterized protein	0.781	212-222	KRRPGRPPRNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW03	Uncharacterized protein	0.932	99-135	RVAPLKKKSVREKSQNRSSEKARNLRKHTRRDESPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW03	Uncharacterized protein	0.843	342-359	TGKASKVHTNPSRRRPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW03	Uncharacterized protein	0.605	337-337	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWF6	Ribosomal_L18e/L15P domain-containing protein	0.96	54-78	KKIRRGRGPASGKGKTGGRGQKGQH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWF6	Ribosomal_L18e/L15P domain-containing protein	0.747	309-319	AKDRKKQSARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYR5	Uncharacterized protein	0.865	11-29	PRRNVPKMRKQPRKTTRPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S445	MMtag domain-containing protein	0.999	128-247	KTKKREKKERSRRHRDDDGERRRRHRSRGHSRDRERRHRHRERSRSRDRRRDGDRDDRRRHRSRSREHKRREDRPERSERPEHRRERDVDEKRSRSRSRDHRRRVTRSRSPYERNERRRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M0	Uncharacterized protein	1	452-520	KKSLKRQQKQKDKSKQEWKERLTNVDQGKAAKQKKREENLKKRKEEKGQKGKKKAVKKPGKKVKRPGFE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M0	Uncharacterized protein	0.997	143-172	AKAELKAEKRREKRKEKQAKNKLKLEAKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M0	Uncharacterized protein	0.982	292-330	RAARKADGPDGRPARNRAELIETRRKKEAERKAAKKAQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M0	Uncharacterized protein	0.886	393-413	KKKKGKSDAKTALEAAKKKQA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6M6	Zn(2)-C6 fungal-type domain-containing protein	0.7	305-313	PPRKDSKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6M6	Zn(2)-C6 fungal-type domain-containing protein	0.681	344-348	PKRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH41	Uncharacterized protein	0.973	185-214	AKRVESMHEEARRKWGARRREAREDRGRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHJ9	Usp domain-containing protein	0.821	266-277	KKRERGRQRSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHJ9	Usp domain-containing protein	0.748	603-613	RKRLRKHSKYK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ08	Uncharacterized protein	0.949	448-473	RSKPKAKPVEPLEKRFRPPSPKRRAQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK83	RRM domain-containing protein	0.999	189-212	KAAKKEKKKDKKEKKEKKEKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK83	RRM domain-containing protein	0.991	84-99	RKEKKEKKSKKSKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK83	RRM domain-containing protein	0.985	343-391	SEARKTKIAAKNEKLHDERARDRIKEAEVSMKQRERKEKKEAKSGKKAD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK83	RRM domain-containing protein	0.984	53-68	KKERKSKKDKKEKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK83	RRM domain-containing protein	0.982	143-161	KDKKKSKKDKDSKKSKKST
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK83	RRM domain-containing protein	0.93	6-32	VDKPEKKRKRDAEVAEDVPKKSKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK83	RRM domain-containing protein	0.681	324-330	KKKEGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKH9	Uncharacterized protein	0.801	232-239	KRRKRRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMD9	Uncharacterized protein	1	805-829	KKEKKNRKHKRKHGKSKDKKHRKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMD9	Uncharacterized protein	0.822	326-335	PRTRLRKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMD9	Uncharacterized protein	0.804	940-951	RHKHEKKVKKAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMV1	Aurora kinase	0.991	40-66	KLRSYSRSKVTKARAKGKAVKKRERRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNL9	Uncharacterized protein	0.989	37-153	RRPDRERYLSRRARRSRSRDRGDRNRESNGDKRRSRDREHGPRDGSRPRSSKGADTDEDRDRYRRSRSRDRRGGGRGRDRGDFYSGGGRPRTRSPRQERNYNRYRERSRDRRRNSSD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRE9	Uncharacterized protein	0.843	109-129	RGRRPSKHSARPSRTPSPSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRE9	Uncharacterized protein	0.641	23-27	RRKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXU3	Sas10 domain-containing protein	0.998	582-613	GLTPHRKKSVRNPRVKKKEKYKEKQKKLKSMK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXU3	Sas10 domain-containing protein	0.682	351-360	KPTKQRKTKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXU3	Sas10 domain-containing protein	0.634	403-405	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXU3	Sas10 domain-containing protein	0.615	5-6	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6C2	ENDO3c domain-containing protein	0.783	102-108	KKKRKSG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S760	Ribosomal_L2_C domain-containing protein	0.879	323-372	GGRGKSKGNVHPVSPWGTPAKGGYKTRHKRNKHTFLVQDRPRNQGKRRSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S760	Ribosomal_L2_C domain-containing protein	0.768	111-121	RHRGGGHKRRI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7N1	Uncharacterized protein	0.656	412-415	RRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Q3	Uncharacterized protein	0.763	270-275	GKKKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H4	Protein kinase domain-containing protein	0.754	380-399	KRRRLGKNNSHEDKIKREIA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H4	Protein kinase domain-containing protein	0.61	402-403	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCB8	Uncharacterized protein	0.746	7-31	KKQSKNISKAVRMGKVEKPLKQKPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF57	U3 small nucleolar RNA-associated protein 11	0.926	13-54	HKERAQPIEREKWGLLEKRKDYKLRAADHRQKKAKLKILSEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF57	U3 small nucleolar RNA-associated protein 11	0.92	208-237	QARRETRKFRKDRERGQERLFSRLRAIKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF57	U3 small nucleolar RNA-associated protein 11	0.751	269-276	FKIRERKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH54	Uncharacterized protein	0.827	188-194	RRRKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHJ4	SWR1-complex protein 5	0.992	74-87	ARRKRSKKKGKKGN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI15	J domain-containing protein	0.992	290-364	IKKFRQAEHAQKNKRRLEKEAALKRETEEAEARKAEEAKAAAEKEAAEKAAKADSKKAKEAAKNAAKKNKRVVRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI15	J domain-containing protein	0.905	255-271	RHVERKNTAARRKKKTE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI15	J domain-containing protein	0.894	120-138	KRAHRRKVLKHHPDKKAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIW2	G-patch domain-containing protein	0.999	169-220	DKKSKKRKHEERTEDEPKLKRKKKSVDLRDESKDKKSKKDKKKEKSRKSKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIW2	G-patch domain-containing protein	0.999	241-272	KARRKAEKKARKEEKRAKKALKKAAKKAAKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKA4	Zn(2)-C6 fungal-type domain-containing protein	0.833	44-51	PRKRRRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL05	DNA polymerase	0.982	96-123	RPAKGKAAKRKREEDEEKRKKIDNGISK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL05	DNA polymerase	0.672	631-644	KKTPGWHRIGRLKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL05	DNA polymerase	0.652	127-135	AKNAAKAPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF4	Uncharacterized protein	0.935	497-519	KLKAGARKKEMERRERKGGDAGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF4	Uncharacterized protein	0.602	75-75	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP45	Exonuclease 1	0.879	90-101	KDRRERRKEGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP45	Exonuclease 1	0.652	685-689	KRRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW8	Uncharacterized protein	0.723	608-615	NKRAKKDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU68	Protein kinase domain-containing protein	0.962	558-611	RDRREPYPPRRFDDRRPERPDSRTDIRPARPERRTPPPQIPKTKTIIKKRMKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU68	Protein kinase domain-containing protein	0.854	943-975	RKEKDKQEHEARRVAREEKDLARKDEGKRRADA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX44	Uncharacterized protein	0.611	96-97	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY28	Uncharacterized protein	0.979	91-109	RPIARLPKRKHRHSRKKIP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYZ7	Uncharacterized protein	0.765	167-181	LRPKNQRKIAKAIRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0X1	Uncharacterized protein	0.799	732-749	RKQRPRRSMVSVKRQRKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1E4	Uncharacterized protein	0.943	115-127	PKAPERRKRKRTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAT0	ATP-dependent RNA helicase DBP10	0.986	841-893	KKRVAEAKEKRIGAFKDGGAKNELRDVDAVRKNRRVKEQRQAKNARPSKKRKF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAT0	ATP-dependent RNA helicase DBP10	0.825	329-344	AKEDAEKASNSKKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE29	Transcription initiation factor IIF subunit beta	0.67	167-174	QKRSKYKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFR2	J domain-containing protein	0.966	237-261	RNRRERRAMEKDARKPKKVQAVKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFR2	J domain-containing protein	0.91	383-394	ARKRRAIARKGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKL0	Uncharacterized protein	0.839	116-127	NRKKRLAARKTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLD4	Uncharacterized protein	0.737	8-24	RIQREHKKADKAGTRAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF6	Uncharacterized protein	0.978	272-305	KSSAKKTRKRKAAVESPTAGRKTSTKKNKKAPLP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLF6	Uncharacterized protein	0.974	238-248	KKPRKRRRSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT4	Uncharacterized protein	0.988	164-231	FSPGERGRRRTRSRSRTRSARTQRSQENVRGRVPRNMSGSVRSRSRSARRHHHERPRRRISASRSRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT4	Uncharacterized protein	0.906	109-137	SRSRSPPRKKQDGPRHRGNDDATLRKRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT4	Uncharacterized protein	0.88	256-295	SSPVKREPSRSPPPFRGSRNHSPSPYSKRKAAAAAARRSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT4	Uncharacterized protein	0.608	80-81	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT4	Uncharacterized protein	0.608	85-86	RK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN92	Uncharacterized protein	0.984	317-382	KRQARKPDAASKSTKALKPAVPKTSSRKAPAKIAPPRPKTTTKPQPSKTKTALAPTLKGGQSKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRS3	Uncharacterized protein	0.775	39-47	PPSPPKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX41	DNA-directed DNA polymerase	0.677	119-126	AKGKGKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXB1	Uncharacterized protein	0.998	474-505	KDRKERKRLAEKRRLLEKARMKGRKGKKASKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXB1	Uncharacterized protein	0.848	405-421	PPPPQQAPPPRKPRRSA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXT8	Zn(2)-C6 fungal-type domain-containing protein	0.659	149-152	KKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYU1	Uncharacterized protein	0.991	408-433	SSRKMKGKPTGGASKRPGKARRAKTH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYU1	Uncharacterized protein	0.957	16-38	RNIKLEKQRKHEKEVQKRKEKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYU1	Uncharacterized protein	0.916	363-395	RRGRGSDGKAFNAKRQKKDQKYGFGGKKRFGKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYU1	Uncharacterized protein	0.901	68-84	GKAKKSKSGKKEEVKSA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYU1	Uncharacterized protein	0.871	289-324	AGKKAAAEARKQRDLKKFGKQVQVAKLQERAKEKRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZL3	Uncharacterized protein	0.775	6-15	RFRRHKSPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZY6	Uncharacterized protein	0.706	282-292	KTETKKPPAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S135	WD_REPEATS_REGION domain-containing protein	0.804	503-515	KKRADRAKVRAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2E0	Arginyltransferase	0.647	291-294	RRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S856	Defect at low temperature protein 1	0.846	137-149	RKDKEKSHKKKGH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B7	Uncharacterized protein	0.998	14-88	KKKDDKKKRDRSRSRDRHSRKHRSSRHHDDDERDERHRHKRSRHHRETSEERARRKRKERDDKDDRSRRKHKEPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B7	Uncharacterized protein	0.619	98-100	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHP4	Uncharacterized protein	0.997	735-805	GSVKGKEKKKKLSGKDRKKLEAKDVRTEGKVWKKGKADRGLTTGKAKEKQAHQKAKSKKIAEKTKFKGFKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHP4	Uncharacterized protein	0.993	52-70	KPKEVASKKAKKDKKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHP4	Uncharacterized protein	0.722	264-269	IKKKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIC9	FCP1 homology domain-containing protein	0.884	525-534	SKKKNKKKLA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIC9	FCP1 homology domain-containing protein	0.742	217-226	ASRTKKPKSA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIC9	FCP1 homology domain-containing protein	0.715	271-278	KKPGGKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMI6	WD_REPEATS_REGION domain-containing protein	0.619	539-541	RRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMI6	WD_REPEATS_REGION domain-containing protein	0.61	546-552	KGGSGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN6	Uncharacterized protein (Fragment)	0.627	22-26	RAKGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPS9	Uncharacterized protein	0.988	121-163	RRRRSARISGDREQLEVRPKVPHPPPAKPRTKKAAPAEKERKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPS9	Uncharacterized protein	0.682	215-225	RKGNKDGPRRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQA5	Protein kinase domain-containing protein	0.936	521-562	RPDRSRAYRDRAPNFTRDRREGRTRSRSPDRRGDRGRDGRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQA5	Protein kinase domain-containing protein	0.693	501-509	SRPRRGSRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQA5	Protein kinase domain-containing protein	0.601	430-430	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQD5	Uncharacterized protein	0.943	466-486	KAKAAKRARREERANRTRKIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQD5	Uncharacterized protein	0.813	509-517	KPKLRRKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQJ5	Uncharacterized protein	0.99	335-354	RPKAREKKKKEVKKERILKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRM4	1-alkyl-2-acetylglycerophosphocholine esterase	0.884	251-263	HKKRSKHRKDGHG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRM4	1-alkyl-2-acetylglycerophosphocholine esterase	0.825	19-42	RRKSVIRASSSGKVPNAKKPRTRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUH1	SAP domain-containing protein	0.857	266-280	PKKKPSRSKAEKSAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS3	DNA-directed RNA polymerase subunit	0.868	1776-1782	PKKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS3	DNA-directed RNA polymerase subunit	0.748	1113-1121	KKAAKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS3	DNA-directed RNA polymerase subunit	0.635	1342-1347	KDLKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZV7	Uncharacterized protein	0.975	217-238	NMRKREASDKPAKKPTKRRRVV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZV7	Uncharacterized protein	0.627	164-166	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z4	SAE2 domain-containing protein	0.67	380-396	SRRRLSGHAGSPGTPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z4	SAE2 domain-containing protein	0.659	315-319	KRKRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z4	SAE2 domain-containing protein	0.609	565-567	KSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S279	Uncharacterized protein	0.978	1072-1090	KTSEKIKIGKKGKKKVAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S279	Uncharacterized protein	0.847	20-29	PRRKRGRPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4V7	Uncharacterized protein	0.65	162-165	KRKF
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6V1	Uncharacterized protein	0.996	437-498	ERTKMEERWEKDKAKEKKEREKGEKKRLEQVEKDRKEREKEEKKRQEQAEKERKEKETQEKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S781	RRM domain-containing protein	0.996	112-235	RGGRPPRGGGPPGAYRPPPMDGPGRYRSPPRRMSPDRGNWGRGRGGRGGRGGYGGRPRSYTRSRSRSPRRSISRSSYSRSPSRTPPRRRGGGGGGGYRRRDSPPRRGGRGGSGSGGDGGGARSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S781	RRM domain-containing protein	0.605	94-94	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S833	ANK_REP_REGION domain-containing protein	0.87	560-583	GKTKTKEKTKKAQKWTGSRQAGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S833	ANK_REP_REGION domain-containing protein	0.766	1115-1124	KRRWRERKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9S4	Uncharacterized protein	0.935	50-77	PRKRRVPKDDDAQGRDRDSRRKHKHKHG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9S4	Uncharacterized protein	0.924	224-240	RRMEESLRRGEKRKKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9S4	Uncharacterized protein	0.843	23-36	FHFKSGSKRRSRRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Z7	DUF2263 domain-containing protein	0.873	84-95	KRKGQGRRKAKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Z7	DUF2263 domain-containing protein	0.831	114-124	KGKAKGKDKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAV9	Autophagy-related protein 17	0.914	391-402	RRRRHEKAKRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE52	acidPPc domain-containing protein	0.659	26-31	RSRPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHV2	Uncharacterized protein	0.915	110-125	KQKKRRSKLHKSPSTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHW9	Uncharacterized protein	0.777	279-294	KAVSPRRRNRTTRRVH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHW9	Uncharacterized protein	0.686	258-262	RRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI71	Endopolyphosphatase	0.999	694-713	KGKKHKKGKKGKHHKKHKMS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI71	Endopolyphosphatase	0.995	518-536	MKHKGKKDKKKRKYKFKVP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI71	Endopolyphosphatase	0.732	614-624	EGKHRKHQGKQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKW7	Uncharacterized protein	0.695	790-798	KADKTKPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL67	Uncharacterized protein	0.99	338-383	KLVAENPKKVAPKKKKLTARDKIDANRRRARFAHIADKWERKRAMN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL67	Uncharacterized protein	0.986	258-285	KGKGKGKAEEAPSKRRRSVRSSAKKPGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN80	Uncharacterized protein	0.967	431-462	RARPGRGGHPSSGGRGGRGRGGGSRSPSPRRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN80	Uncharacterized protein	0.933	381-408	ARQKATERRRQDAIKRAKKAQEKTARDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQS4	Uncharacterized protein	0.762	19-32	PKRKQRSNRYIKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU65	Uncharacterized protein	0.992	147-239	SRVGKRSSPRSKPTKAATAPSRQDPRMRSKLRTRLPPAKKIIEDQPAPQPARRGRPPKDAAKAAAPKKAAGSKALDAGIKKPTRPLAPRKMRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU65	Uncharacterized protein	0.969	41-138	TPKKRGRPPKVRAEEPEAAIEDAPQPKKRGRPSLHASGPEAEQDAPKKGNGKTKKETEAAEAEEEAPVPKKRGRPRKEAATQDAPITPKRGRPAKAAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU65	Uncharacterized protein	0.874	5-32	ARNALRGPGRKASAAEATPKRGRPAAKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUV1	Uncharacterized protein	0.834	270-285	REMRDARAKRSERRRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1S2	Kinesin-like protein	0.975	690-725	KASPRRKKILGVAVKKGIQFSPARKKSPSKAKRGVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S547	Uncharacterized protein	0.994	727-756	AGKTKDGKLAQRTRIIAKKRQARKAKRAGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S547	Uncharacterized protein	0.976	687-715	ATKGRKRKRDSSAVGKTGKGKPDAKGKQQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S547	Uncharacterized protein	0.861	557-566	KMRKKKGKGI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K4	Condensin complex subunit 1	0.857	953-962	PIKKGRKRGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K4	Condensin complex subunit 1	0.803	927-938	KRRKAEKEKKTT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K4	Condensin complex subunit 1	0.634	182-186	GRGKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5S0	Zn(2)-C6 fungal-type domain-containing protein	0.912	58-71	RKHGKPGRSKKRNP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5V0	Zn(2)-C6 fungal-type domain-containing protein	0.725	176-184	RHKKEIKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7L2	GPI ethanolamine phosphate transferase 2	0.699	1003-1009	KKARKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7L2	GPI ethanolamine phosphate transferase 2	0.623	702-704	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8B9	Uncharacterized protein	0.87	202-220	KSGDRDVKKAKHQAKRPRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE76	SUN domain-containing protein	0.981	942-961	PPRPKARDRGKKQKRSPLRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF07	ENTH domain-containing protein	0.966	252-275	PARRKEAAAGPPKKEVKKEAPKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF07	ENTH domain-containing protein	0.651	160-164	RKKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFH9	Uncharacterized protein (Fragment)	0.732	140-147	RKPEKKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIE2	Uncharacterized protein	0.935	1132-1149	KDKIRERRTEKRREKIRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIE2	Uncharacterized protein	0.901	537-564	APKVERAPSPPLSPKPRRASPTSRKSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW0	U3 small nucleolar ribonucleoprotein protein MPP10	0.999	644-682	EKMSRRRRAKERAKKAGLNKPKEKKVEGKEKKRGEKKQL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW0	U3 small nucleolar ribonucleoprotein protein MPP10	0.86	342-355	KAGKNKNTKKRGRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW0	U3 small nucleolar ribonucleoprotein protein MPP10	0.719	85-90	RKKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW4	DNA-(apurinic or apyrimidinic site) lyase	0.922	333-347	EKAEPKPKRGRKNTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW4	DNA-(apurinic or apyrimidinic site) lyase	0.778	312-325	KPKKTNKRTAKAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQW4	DNA-(apurinic or apyrimidinic site) lyase	0.617	257-260	KGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR71	Uncharacterized protein	0.776	60-76	RVRLPSPPKRARDHRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRK0	Uncharacterized protein	0.945	142-155	RPGRSPRRRGKGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRK0	Uncharacterized protein	0.724	383-403	GRKKTSAAATPRKAGVPTGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRK0	Uncharacterized protein	0.627	80-83	RKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT17	Uncharacterized protein	0.876	410-433	AISKARRRLHRARHGDEHLLRRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVG5	DNA-directed RNA polymerase III subunit RPC9	0.958	162-179	LLGANKKRRKVKRNVTKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZB1	Uncharacterized protein	0.904	66-91	SQRGIRRIKRGPATGEEKHDRKNRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZB1	Uncharacterized protein	0.68	542-546	KKRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z1	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.999	552-592	GKAKARARKPAAKRKRGKEDPKETPRPKKLKRIRIRIRIPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z1	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.944	237-266	KEEKKTSTRRAKKEPRDATPVRSRGRQPKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z1	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.877	165-187	PAKRGERRKAAAEAPSRTRSTRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z1	[Histone H3]-trimethyl-L-lysine(9) demethylase	0.789	197-213	SPASRRSGRQSRRRQVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S792	Phospholipid-transporting ATPase	0.931	284-296	NSQKKKRLRKQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8K3	Nucleolar GTP-binding protein 2	0.822	499-512	EGKLGEMSKKRKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8K3	Nucleolar GTP-binding protein 2	0.747	6-16	KEKARKEREGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAA9	Uncharacterized protein	0.8	52-59	KGKHKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH45	Uncharacterized protein	0.662	173-181	ERDKERERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHF0	SAM_MT_RSMB_NOP domain-containing protein	0.993	23-88	RKRKDAPVAADPERKKRSRTAAREAREAKAKAMPKTRIAGKPVKPVKTAAAVLNGAKAKAKGKPAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHF0	SAM_MT_RSMB_NOP domain-containing protein	0.97	721-745	SKKARRKSSEKKSSEKMSSEKKSKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHF0	SAM_MT_RSMB_NOP domain-containing protein	0.932	643-700	KTMRRKGRDPKAVVPKGEKGVNGEAKEATKKASKEAAVEKNGVATKEKAGGKEKKGGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLC6	Uncharacterized protein	0.977	513-532	FRAKRRAINKARYKTRKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPB3	Elongator complex protein 1	0.988	1242-1259	KTSKNKRREERKRARGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPN5	Dolichyl-phosphate-mannose--protein mannosyltransferase	0.749	18-34	RRSGRSKSRSPAPNGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRH5	Uncharacterized protein	0.808	624-633	RENRRGRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSQ7	Uncharacterized protein	0.727	895-919	RKNKNPNRSPSPPSPRSSQQGKRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSX8	Uncharacterized protein	1	136-169	KAKRKKKRKLAAKRAAAKKKHKEKAKNKKERSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSX8	Uncharacterized protein	0.999	242-265	KRKRAKAKAKAKAKAKRKSKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSX8	Uncharacterized protein	0.996	195-213	KKTRRKALRAKAKKRKNKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSX8	Uncharacterized protein	0.961	440-460	KKTLKTRLRKAKRSKEQKRLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSX8	Uncharacterized protein	0.812	98-111	SKGKRGSQKSKHKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU50	Uncharacterized protein	0.998	133-208	VKKAKVESAKPAPKAAKAAPKPKTAPKPKAAPKAAPEPKAAPEPKSKTPTPQPEAAKIDPALVPNPKGPRRPKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU50	Uncharacterized protein	0.981	67-115	PKKRKAYASKSAPPFAKKPAVPARSRVKKTETPAPEPKAATKKTTKRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU50	Uncharacterized protein	0.632	17-21	KKESK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU50	Uncharacterized protein	0.63	30-34	SRRGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY0	Uncharacterized protein	0.999	616-637	GKPKPKKRGKKGGKKAQKKAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY0	Uncharacterized protein	0.998	342-362	EKPKKKNKRGKKGGKKVKTNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY0	Uncharacterized protein	0.807	108-116	KGKKGKGKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUY0	Uncharacterized protein	0.68	538-543	RRREKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVL5	Uncharacterized protein	0.665	138-142	KRKKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXW8	RanBD1 domain-containing protein	0.878	114-132	HSEKKPPGPHMRKRSRDIR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXW8	RanBD1 domain-containing protein	0.713	95-101	RLRRKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1N4	Uncharacterized protein	0.983	655-676	RPFKRRGSARGRARGGRGRGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4Z1	Myb-like domain-containing protein	0.973	274-300	DNAKKGGAVGGGDGGGGKKKKKGNNGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4Z1	Myb-like domain-containing protein	0.721	547-552	RGGRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4Z1	Myb-like domain-containing protein	0.698	26-38	GPKQPPAPPRPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6P5	6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase	0.92	517-560	RGRLKRRRQSSQHSPRRASSPSRGHDRNSGSRYRAHHRKHHRPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6P5	6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase	0.646	575-580	KKTRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6P5	6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase	0.635	591-596	GRARNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD91	zf-C2HC5 domain-containing protein	0.956	84-99	RARPKKKKPGLNKLPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFY3	Uncharacterized protein	0.604	194-195	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKI2	Uncharacterized protein	0.912	350-359	RRARKRRLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKI7	Uncharacterized protein	0.95	134-145	RRRKKSKKPPSV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLB7	Uncharacterized protein	0.704	208-218	RSSFSKKNKRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMW4	Uncharacterized protein	0.987	402-444	RRPPGRRKKGRLSVLRPTSSRFSGKSKGVKIAPGKQKGGKGKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMX8	Histone H1	0.998	208-265	GKTKSGRVTKTKAPAATSPKAAKVTKKAPAAKKAAPAKKATTPKKKATPKKATPKAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMX8	Histone H1	0.994	83-192	RPKGTSGPVKLAKKEAKPAAAASTKKAEPKAEKKTAEKKTVEKKTTEKKAPAAKKATATKAKAATTTKAAAAPKKAVGRPKKAAATAAATTKATPAAKPKANASKPRKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSK5	C2H2-type domain-containing protein	0.694	426-445	ARKHEWEKHKILDTKPKTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT54	PseudoU_synth_1 domain-containing protein	0.964	15-56	NRGNDKKRKWADKDRRNAARGGGGRQQGGSYPNKKRNMGRKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S166	Uncharacterized protein	0.725	51-58	KKPDKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1G9	Calponin-homology (CH) domain-containing protein	0.905	285-302	KKEKKEPRKSLAAPPKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1G9	Calponin-homology (CH) domain-containing protein	0.82	1118-1140	RWVRRITAGRVGGKEKVRRVRGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1G9	Calponin-homology (CH) domain-containing protein	0.763	371-392	KEPERIPQTKKRAESTQKRPRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1G9	Calponin-homology (CH) domain-containing protein	0.751	105-114	PRHAKPRRPL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1G9	Calponin-homology (CH) domain-containing protein	0.716	220-230	LKKQAPKKDLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1G9	Calponin-homology (CH) domain-containing protein	0.625	171-176	KMPKPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q7	Bromo domain-containing protein	0.953	1045-1079	KQRFPKPRLPPTGKISSPRKRPIREQQQMARKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q7	Bromo domain-containing protein	0.851	472-490	RGRKAPSKGGKGSSNARKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S621	Uncharacterized protein	0.973	80-157	RRKLTSQEKEAQRLEKEAKAKAREEKRAQKEADERLKAEQKAQRDEEKRRKNEEQDEKKRLKEEKQQRLEEEKAKKAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S739	Uncharacterized protein	0.716	833-841	KRQRPSRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z8	Uncharacterized protein	0.994	282-301	TGGRGGKKGGKGGRGRGGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z8	Uncharacterized protein	0.912	237-267	ERENRIGSGAGKKGGERRERGVGGPSVGKFR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Z8	Uncharacterized protein	0.698	221-232	GEEKRRSEAREA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Z1	40S ribosomal protein S1	0.952	5-19	KNKRLSKGKKGLKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD38	Uncharacterized protein	0.981	643-666	RKIKHWSKKLQRREAKRRAVRKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD38	Uncharacterized protein	0.91	288-304	RSHSRHPEKKEKARKPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFY8	Uncharacterized protein	0.893	374-390	KVKERRQRKLRLRGARA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL54	Uncharacterized protein	0.882	626-636	VKKKKEKEKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN02	Aspartate--tRNA ligase	0.973	18-47	KNALKKAQKEKEKAEKKAAAKARELAERTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN83	Uncharacterized protein	0.741	440-447	AARKARRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN83	Uncharacterized protein	0.65	472-477	KERRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNV6	Zn(2)-C6 fungal-type domain-containing protein	0.665	10-18	PRQRAWKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST3	Restriction of telomere capping protein 4	0.972	60-101	KPPPRKELKPIPAPEAKAKEDKELGTPPKRSAKKGAIRAPAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST3	Restriction of telomere capping protein 4	0.876	151-173	GSKTKNIHAPPPPRKFGKPAPKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RST3	Restriction of telomere capping protein 4	0.603	233-233	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT72	Uncharacterized protein	0.635	148-152	RARRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT72	Uncharacterized protein	0.616	33-35	RRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUQ1	Uncharacterized protein	0.743	115-135	ASGKSKPSAARAEKDSPAKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU6	Uncharacterized protein	0.996	376-411	RRERNALRRRKRAMQRKKTRLNRRPREKEDEEKGVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU6	Uncharacterized protein	0.995	255-275	RDNKRKIGKGRKARPKAKERE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU6	Uncharacterized protein	0.931	123-150	PSPSKKRKTTPLPPPRRITRSTTKPKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU6	Uncharacterized protein	0.699	104-110	RKRPRTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUU6	Uncharacterized protein	0.696	9-22	GRPRPPGRVIRIEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVI8	HMG box domain-containing protein	0.959	176-197	PREKRRYRRHPRPDAHAPKKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.997	502-569	LRRIAEKEERRKARGKAPVEDKDREHRSSRRKEKDRDAARPKTERRRSHQDEEADRRRRHEERRAARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.994	668-705	RIAGRKGPKRDKERAERRKTEERERERDRAHKHSRRAS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.973	437-487	EARRAERRAKRDAEKGSRRAELEEAEAKAERRRERERENERATLAEKKARQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.945	315-331	RPRRERERERERPRRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.92	360-394	GRKKAAPEEAPRERRRTAYETEDERKRRKRSTTRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.913	43-64	PPPEPKTESPRKARRAGRSGPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.676	718-723	ERKRPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWE9	Uncharacterized protein (Fragment)	0.62	402-405	KRLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXK2	Uncharacterized protein	0.751	932-939	REKKAKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZL1	PH domain-containing protein	0.693	173-179	RAKRRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZL1	PH domain-containing protein	0.663	226-248	KRLQKAEPQKLVRQREEGIRKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1W4	Uncharacterized protein	0.982	160-182	PRPPRRQEPKPKQRRGSKRASTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S438	Uncharacterized protein	0.808	1096-1111	KSGVSRGRSGDRRRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S438	Uncharacterized protein	0.656	618-638	KNALARRAASNASAREKVPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S451	Uncharacterized protein	0.747	191-201	FRKNRKVWKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4W2	DNA ligase	0.937	683-710	RAEKEKSEKEKEFKIEQSRRKKARTTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4W2	DNA ligase	0.626	65-68	GARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7I2	Ribosomal_L18e/L15P domain-containing protein	0.986	161-189	HSHKKPYVESKGRKFERARGRRRSRGFKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8T7	60S ribosomal protein L13	0.96	30-53	GKKKSRRNARVAKAAKVAPRPVDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8T7	60S ribosomal protein L13	0.816	197-215	GVREKRAKAKVDEADSKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REY4	Phosphatidylserine decarboxylase proenzyme 1, mitochondrial	0.673	112-117	PKKRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJB5	Uncharacterized protein	0.793	207-219	PLRKSMDRKRKPL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJB5	Uncharacterized protein	0.724	800-805	TKKKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJB5	Uncharacterized protein	0.636	1264-1271	KQRRSLHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJB5	Uncharacterized protein	0.619	1282-1284	HRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJB5	Uncharacterized protein	0.601	1277-1277	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJZ2	Uncharacterized protein	0.96	356-378	REAKRNKKTEKKSSISKEKRKAM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKF4	Topoisomerase 1-associated factor 1	0.988	954-986	GPRKKLKRRRRERTPHELDDDEKERRAEARRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKF4	Topoisomerase 1-associated factor 1	0.977	1045-1062	SKKRKADAPAKKTKRRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKF4	Topoisomerase 1-associated factor 1	0.959	566-580	RSKRRARNIKKKKAD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKF4	Topoisomerase 1-associated factor 1	0.807	336-347	KKWNKPRRPGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RN40	Uncharacterized protein	0.999	24-56	KKRKREAEPEASKDGKKAAKKAKRKEKKKQKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP54	RNA exonuclease 4	0.999	345-358	KKKSRNRKKKKKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSU2	Uncharacterized protein	0.734	167-173	KKARRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUJ5	Protein kinase domain-containing protein (Fragment)	0.615	86-89	RKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXC7	Uncharacterized protein	0.682	42-52	RKMPTRAKPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXD0	Uncharacterized protein (Fragment)	0.961	5-22	ARSKLKRLRKQKRLLKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3R2	Uncharacterized protein	0.87	547-564	HKKRKGQPHNAVNKRQRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3T4	Ribosome biogenesis protein ERB1	0.67	261-274	KRRFIPSKHEAKRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K9	DNA replication regulator SLD2	0.991	335-366	GKPRKAWKKKGLKRQTRRVIMRPNITKPRPAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5K9	DNA replication regulator SLD2	0.988	413-478	KPRKVTAKKPQQRADKPADQPAKEGLLKTAARKIKATANANYRRLNIKGKAATGGKSGKGKFGRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7J3	Uncharacterized protein	0.743	189-203	RRDRGGYRGGNKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV5	Uncharacterized protein	0.896	468-499	QRKLKPKRAATPQESGDTAPKAKPAAKRKTAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFV5	Uncharacterized protein	0.609	769-770	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIA2	Uncharacterized protein	0.743	268-286	KSHVKGRANGEVKIRKQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIA2	Uncharacterized protein	0.6	21-21	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIF9	Uncharacterized protein	0.998	220-288	KRGRGSNRGAPKTRGIPSIIPTSSNRGRRGAKRGRGSSRGRGGYNESRSTRGRRRGKPGRVKGPRGPRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIF9	Uncharacterized protein	0.876	742-760	ARGRYAVRKRAAQRNRKRM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIG2	Uncharacterized protein	0.845	488-498	RKLKKKREPIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIG8	Uncharacterized protein	0.993	129-160	KRGWGGAKKQKKKERRPVDKVSKYGGVKKEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJM6	DDE-1 domain-containing protein	0.735	468-483	PPKKSVRGRDIKTPAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT5	Uncharacterized protein	0.907	225-251	RRGPRRNGRDEREGRDMRGRGRGGGRQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT5	Uncharacterized protein	0.73	312-326	RRYRSRSRSDNRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMT5	Uncharacterized protein	0.711	181-189	RAPRRRSPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPJ8	Uncharacterized protein	0.851	123-138	REMKRVKRRAERAAMR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPM8	Response regulatory domain-containing protein	0.927	436-444	QPKKKRKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSM2	BAH domain-containing protein	0.702	302-307	KKRGRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWN4	RRN9 domain-containing protein	0.963	439-458	LRRLKRERREERHLERKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWN4	RRN9 domain-containing protein	0.755	628-638	PKVGNARKRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYC7	WD_REPEATS_REGION domain-containing protein	0.964	1171-1181	KKKKKRSKSRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Y4	Integrase catalytic domain-containing protein (Fragment)	0.916	273-287	PRRRGRPRGSKNKDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S342	Uncharacterized protein	0.923	426-442	ERRSSKKLQKKRRESNA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Q2	Protein kinase domain-containing protein	0.995	352-375	EERKAKRRERKRREREAEAKSLRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3Q2	Protein kinase domain-containing protein	0.707	516-533	KRARSPGSKASSGHSPKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4T8	DUF2439 domain-containing protein	0.93	492-538	KPKPIPVKKVASKKAVVPKPPEAIVPQSKSLSPKPVPRKAQARKKAV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4T8	DUF2439 domain-containing protein	0.653	362-366	GRKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S619	Uncharacterized protein	0.806	914-929	SRGPRGPRGSPPRPLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S619	Uncharacterized protein	0.606	947-948	KA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S619	Uncharacterized protein	0.605	1131-1131	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6T5	Uncharacterized protein	0.981	385-400	GRRRGRRRVMKKKKVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6T5	Uncharacterized protein	0.944	424-447	PKKAKPAPKPANTAKGKNAGKKGQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6T5	Uncharacterized protein	0.834	256-290	KKQDPKSGAKKDKATSDIFKSFAKAKSKPKEAEKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6T5	Uncharacterized protein	0.667	203-231	AKPVPKPATKATATIRTKEKEAPAPAPAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RII3	Uncharacterized protein (Fragment)	0.999	204-233	GAGKDKGKGKKSKDKKKGNKGKGNKHHAGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RII3	Uncharacterized protein (Fragment)	0.962	94-112	GAGKGKGKDKKSKDKNTKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RII3	Uncharacterized protein (Fragment)	0.9	272-285	GKGKGKGKHGKAEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RII3	Uncharacterized protein (Fragment)	0.814	363-371	KRNPRKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR8	DUF3824 domain-containing protein	0.991	400-439	HHHHRSKSRHRSKSHSRRSRRRSRSVVESDRGRSRSTSKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR8	DUF3824 domain-containing protein	0.986	464-483	ERRRSKSRKREGKRSPSKVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR8	DUF3824 domain-containing protein	0.978	504-549	KHKAKKEARAASRSKSRSRSRTSSSSSSSGGRRGSRSRSRSKSRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR8	DUF3824 domain-containing protein	0.965	340-361	SSERGRGGRRTKSRHRSKSRVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR8	DUF3824 domain-containing protein	0.947	568-585	AAKRRDRKKAEKEAERRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKX8	Uncharacterized protein	0.623	591-596	KNRTKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN7	Uncharacterized protein (Fragment)	0.886	69-93	RHKSFKRRKMAVIRERTRPLLRKGL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNA1	Telomere_reg-2 domain-containing protein	0.794	517-529	KVPPKPKPAPKPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP46	Uncharacterized protein	0.998	120-176	KNTKTKTKTNVKKDTKKPKKDKTKRTQTGRVEKVKANTKKKVAAGGKKGGKKGKKAS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM7	Uncharacterized protein	0.997	12-58	AAANRKSKPSKPAGPPPIRHKAKQKAIHNARRGRGGRGGRGGGRGGN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWD6	Exonuclease domain-containing protein	0.857	66-77	KRRRKERSPHGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2D9	S5A_REDUCTASE domain-containing protein	0.769	280-297	KKERRYRKEFGDKYKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S865	Uncharacterized protein	0.919	239-277	VRRKRTGEEKTERERVKEKGMDRERAKRTTSTSKEAKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S865	Uncharacterized protein	0.886	198-223	KRRKRTSSSPRTSSSPSSSPRRPKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S997	DUF4604 domain-containing protein	0.972	131-149	ASEKSNTKAVKKPKKKAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S997	DUF4604 domain-containing protein	0.711	109-114	KKRKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAJ3	RING-type domain-containing protein	0.961	381-406	KPRHAKRSRSIPTKRRDSERKEPKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAJ3	RING-type domain-containing protein	0.913	312-331	RTSSKSKVHRKRVHSSKKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAJ3	RING-type domain-containing protein	0.755	216-232	RRRSRIDGRLEKKPAPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAU6	Yippee domain-containing protein	0.622	223-225	RRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCD6	SMI1_KNR4 domain-containing protein	0.642	380-387	RRPQNKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCD6	SMI1_KNR4 domain-containing protein	0.614	431-434	KPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH83	Ubiquitin-like domain-containing protein	0.995	73-99	LRGGAKKRKKKVYTTPKKIKHKRKKTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKT5	Uncharacterized protein	0.895	155-177	GKGKKRARGPEPELQQPKRFKCK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKT5	Uncharacterized protein	0.61	179-181	KGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RME2	Rif1_N domain-containing protein	0.891	1476-1490	SSKKRKQTPSKKKTP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RME2	Rif1_N domain-containing protein	0.735	1112-1137	RAFKSPRVKESPFRISKSLRSKSRSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RME2	Rif1_N domain-containing protein	0.621	1545-1547	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNH1	DASH complex subunit DAM1	0.894	179-222	PRGRGGIPRAGGRGGIPTRGGATRGTRGGTGIARGVAGRGRGAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNT7	Uncharacterized protein	0.635	33-37	PRRQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.998	1509-1543	KEKERKEKEKEKERERKRERERERGWKRESSSSSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.998	2030-2064	KGKEKSRESESELKVSKREKKDKKKKKSSSSKSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.994	3176-3193	KGKGKGKVKAKKSKKSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.994	3340-3355	KAKKVKKVKKSKKAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.992	3840-3853	AKKKKTKKEKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.992	5023-5035	PKKSKKKKGKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.992	6780-6793	SKKEKKKKNKKARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.991	4753-4765	PKKSKKKKAKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.988	5526-5539	PKKSKKKSKKAKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.986	7690-7701	KKGKKKSKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.985	4618-4630	SKKTKKKKAKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.979	6940-6952	KKAKKKAKKTKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.978	5901-5913	KKDKKKAKKAKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.976	5769-5780	SKKKKAKKAKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.973	2554-2578	ERRRKHRRRESERDASPSEKKHRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.972	8745-8759	APKEKKEKKSRKSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.971	2494-2528	ERRRRRREARSETRGKSNDRGYGEEGGERRRRHRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.97	6154-6164	SKKKKAKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.97	8658-8673	RLRRKERKMKRERSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.969	4224-4236	SKSKKAKKSKKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.969	4503-4513	KKAKKKGRKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.963	820-836	PPKEKRPKENSLKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.946	4086-4097	KTKKGKKNKRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.943	124-139	KDRKKAKDRKVEKRRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.937	5282-5292	SKKSKKKGKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.929	6038-6050	KSAKKKLKRAKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.925	4392-4403	KQSKKKKAKKTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.916	8009-8020	KKLSKKEKKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.906	5397-5407	KKDKKTKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.897	2667-2676	RKHRRRKHRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.897	6455-6466	AKKEKKSKKDKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.882	7129-7138	KNKNKKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.872	5128-5136	PKKAKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.871	3973-3982	KTKKSKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.835	2622-2634	AKKEKEKEREKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.801	5678-5687	KKMKAKKAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.779	8189-8199	RKIKKENRKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.775	7247-7258	RKLSKKEKRESR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.765	774-781	DERKRRRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.746	862-871	RRRRSSVKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.719	753-769	PSRSKSPKRVQVLHPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.687	8539-8546	TRNKKLRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.659	659-665	SRRSRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQI2	Uncharacterized protein	0.654	1838-1846	KSSKKEERK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRM2	Uncharacterized protein	0.669	274-278	GKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS30	mRNA-capping enzyme subunit beta	0.685	102-106	PKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSK7	Uncharacterized protein	0.756	57-69	HRDIVPPKKSRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSP8	BHLH domain-containing protein	0.66	470-477	KSARNPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTJ3	Uncharacterized protein	0.857	560-570	KRRAKGGRARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTJ3	Uncharacterized protein	0.853	32-41	KPKKKKGESS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTJ3	Uncharacterized protein	0.626	272-276	KKTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTJ3	Uncharacterized protein	0.622	222-226	KAREK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTJ3	Uncharacterized protein	0.621	51-54	KGKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.995	616-652	KPGSKFKTQRGLGRPKKQAKTPKEKRVRIPKAPKPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.954	738-755	IRAERGLPKLAKKEKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.853	1750-1762	EKKKIRVGRHRKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.834	1694-1711	AKKQRVRAFRSRQKGRPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.813	1016-1026	KRKIGRGRPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.802	1456-1475	KARRRSEWSKQKRLEAKARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.79	879-899	RKRKAKDMATTPTPAKKRRVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.742	1640-1657	KKRVRIMTPGGQPPRKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.715	359-366	KRRRVRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTM4	B-block_TFIIIC domain-containing protein	0.615	823-826	KPAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU87	MFS domain-containing protein	0.774	99-109	PSKPRRHQKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUD4	Histone domain-containing protein	0.986	4-49	KSPARRNKARPSRGGRVSVGGRKESGKRLGQPGPAPDRAKKRYKPG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYN6	Uncharacterized protein	0.985	81-98	GGKKSHGNRKRKHKHKSE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ67	Uncharacterized protein	0.733	515-521	KKKPKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ67	Uncharacterized protein	0.72	302-312	KKKSEKARLRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ67	Uncharacterized protein	0.625	764-769	AKVRGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S146	Lysophospholipase	0.963	791-822	ERKKAQREQREKDERERRWRWKMRQGRIAGRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9F2	Uncharacterized protein	0.889	105-116	PPPKPVRKRRRL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCW0	WD_REPEATS_REGION domain-containing protein	0.99	312-328	VRKSLVRKRKRKREKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RES5	Uncharacterized protein	0.764	106-119	GPPRNKARTAKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHF4	Uncharacterized protein	0.659	762-773	GRVQKSARGNRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI89	Structure-specific endonuclease subunit SLX1	0.989	315-324	KAKRKKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI89	Structure-specific endonuclease subunit SLX1	0.792	101-120	ARKDELHKARKNASPVRRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJZ5	SGNH_hydro domain-containing protein	0.763	231-242	KRKRSVRRVVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW40	VOC domain-containing protein	0.913	655-668	RRRHRSHRHKSKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW40	VOC domain-containing protein	0.788	586-599	ESKAPPPKPPKPAS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYL3	Uncharacterized protein	0.695	110-117	KKKPSRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ72	Uncharacterized protein	0.897	410-426	RKREKERASAKGKVKRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S084	Uncharacterized protein	0.914	595-617	KKLRKERGLKAKGLMTRKQKLQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S266	Uncharacterized protein	0.709	406-414	ARPRRSGRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2W3	Uncharacterized protein	0.996	104-143	AKKAGKPRATKAKEPKKITAKVTKPKKTSTKVTKPKKKAT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4W1	EH domain-containing protein	0.981	549-579	KYKKKGTRIMGIKGRKHPNKHHEGTRRRWRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4W1	EH domain-containing protein	0.608	518-519	PK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4W1	EH domain-containing protein	0.603	390-390	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCD2	Mcp5_PH domain-containing protein	0.751	858-883	GVKHQRKDSIRKVRSAAPVTRASRPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDX0	Abhydrolase_3 domain-containing protein	0.89	196-206	KPKRKRAPKAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH51	Uncharacterized protein	0.819	214-237	RKKLRAAKFASKPAAPTKAPVKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH51	Uncharacterized protein	0.652	551-556	RVRRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIG6	Uncharacterized protein	0.681	1722-1727	KRKLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLL4	MutS protein homolog 3	0.781	68-80	KKSNKKAIKGSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNQ4	F-box domain-containing protein	0.92	17-37	MRSGKEPREPGTRKKLSKKGS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNT5	Pyr_redox_2 domain-containing protein	0.64	64-68	PKPKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPT5	TruB_N domain-containing protein	0.976	417-458	KKKERVEQGRNEDRERSYRGGGRNKWNKGKGKYSKGGGGRRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPT5	TruB_N domain-containing protein	0.846	235-245	TTARKGRKRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQC7	Uncharacterized protein	0.74	7154-7183	KGKMKAEEKANNKKSGTFGSLAKRIGFKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0Q4	Uncharacterized protein	0.696	160-167	VRKNKLRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0U9	Uncharacterized protein	0.989	567-576	RRRKKKKKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S827	Uncharacterized protein	0.983	426-460	RRRMHKIRRDAEKAETKAAKKQKKLLDKEKKAAQK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8P7	Uncharacterized protein	0.916	28-42	RRHKRKRALFRPKPN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA0	Origin recognition complex subunit 1	0.781	229-238	SRKGAGRPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REA0	Origin recognition complex subunit 1	0.735	261-266	PRKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF56	Uncharacterized protein	0.994	140-154	GRRRRRRKHRRRQHP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA8	Uncharacterized protein	0.998	714-758	KRASPKLPGKKKKGAAPPAKRKSLPLAVPPPAKPMKSSGVKKAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA8	Uncharacterized protein	0.794	453-472	PVKPAKAKKPTVNTAQKARR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFA8	Uncharacterized protein	0.658	536-540	KPRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFF7	Uncharacterized protein	0.913	239-266	RSRKRRRSTASNSNSSRTPKRRGHARKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFF7	Uncharacterized protein	0.798	277-288	KSEKKSRRASKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGH5	Uncharacterized protein	0.977	504-521	AKANKRARNKKGSKKNKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK20	PHD-type domain-containing protein	0.983	230-260	PTKKRPAPSGATVKKKGTAKTSKPNKKRRVE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK20	PHD-type domain-containing protein	0.844	423-429	TKKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK20	PHD-type domain-containing protein	0.715	273-282	RASRPPKMKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK20	PHD-type domain-containing protein	0.692	646-651	RARRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKX5	Uncharacterized protein	0.75	209-216	SRKKRPTA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWK9	BAH domain-containing protein	0.67	1189-1193	RKRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWK9	BAH domain-containing protein	0.632	74-78	RRSKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXG8	Uncharacterized protein	0.909	56-65	KKKKKPSKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S034	Uncharacterized protein	0.799	80-89	KKRKRIQPGS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1M3	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase	0.64	866-869	RKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S446	Mediator of RNA polymerase II transcription subunit 6	0.967	332-350	GSKGSVGPAPKKKKDRRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S641	rRNA-processing protein EFG1	0.95	242-274	PKKQEKKKEHAVKSKNTKAEEKLAQAKNRRERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S641	rRNA-processing protein EFG1	0.839	19-40	KPFKKHRAFKPGQSNQKFKKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S677	Uncharacterized protein	0.711	640-645	KKKGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7S9	Uncharacterized protein	0.677	412-416	RKKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE10	Type 1 phosphatases regulator	0.941	149-170	KHRRQRRKPSPNAYEKMPKQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE59	Uncharacterized protein	0.835	47-55	KKKRRAARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHF9	SNRNP27 domain-containing protein	0.996	10-120	RYRERDSRREPREAREGAGTPTERRNRSRSPRERGGRRDAPRYRSRSPFRRDDRESGGRGGDRSRGGHDRGRGRDDRRGGRDDRANAGDRSPQPPKGPRAGVRGPFGGAGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW30	CRIB domain-containing protein	0.856	21-40	RTLKESASRKSLFRGKKGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWF8	MFAP1 domain-containing protein	0.771	44-70	KPKPFAKPKPAPIASSFPKAALKSKLA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXC0	Uncharacterized protein	0.729	187-198	RKSHGPPKPPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYN7	Uncharacterized protein	0.817	4-11	KPKKGKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5A8	Protein kinase domain-containing protein	0.647	126-130	LRKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S638	SWIB domain-containing protein	0.996	150-175	RATRGGNTKRRAPAPKKKTKKKSSNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S638	SWIB domain-containing protein	0.686	119-124	KKKVKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7D6	Ribosomal protein L19	0.955	1124-1151	RARARELTAARRIGRHRGFGKRKGTKDA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7D6	Ribosomal protein L19	0.951	1206-1247	KRALVEHIHKAKAEKARERVIKEEMDAKRAKTKAARERRQER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9B2	Eukaryotic translation initiation factor 4C	0.935	3-16	KNKGKGGKNRRRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9I6	Uncharacterized protein	0.63	20-23	VKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCG0	Uncharacterized protein	0.947	565-623	RRLDMEHEKRRIKTEKERAAEMKAEEKQGREEEKRAAKARAVEEKTAAKQEKEAEKTRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCG0	Uncharacterized protein	0.61	696-697	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIR9	Uncharacterized protein	0.995	42-59	PPKKKKTHRGGKKRRNRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJY2	Adenylyl cyclase-associated protein	0.973	367-390	RSKSPAPPKAKKPESMRTKKPPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJY2	Adenylyl cyclase-associated protein	0.653	294-307	PPPPPGPPPPPGAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKY6	UBC core domain-containing protein	0.707	198-208	HSKGKERERVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMY9	Uncharacterized protein	0.992	637-661	RGGRGRGRGRRGRGRGGGGGGGGGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPB6	Uncharacterized protein	0.769	65-81	RKKKRSQFSRAGPQPKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQN4	MFS domain-containing protein	0.864	321-337	PKPSRRHNRARSKSPGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQN4	MFS domain-containing protein	0.661	102-108	RRQEKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR42	Uncharacterized protein	0.839	94-112	RKSKKHEQFKERNARKKQR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTD0	Uncharacterized protein	0.941	216-236	KPRTKPVGKKRLHTPKGARRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S174	Uncharacterized protein	0.967	336-356	AKGNAKSKKDKGTPKKNKAKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6Q7	RF_PROK_I domain-containing protein	0.863	177-195	RRLKHKKQQSAKKTSRRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S846	Uncharacterized protein	0.946	1240-1258	NKRRDYIKKKRARIEGKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S861	Uncharacterized protein	0.744	311-325	RPPSPRGARPRSPGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9K9	TAFII55_N domain-containing protein	0.946	59-91	KVKRKYTKKPKLDESGNVIPPGKPGPKKRAREE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9K9	TAFII55_N domain-containing protein	0.872	319-330	KWARKRRFRPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9K9	TAFII55_N domain-containing protein	0.773	98-106	PAAKRKPKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD35	Uncharacterized protein	0.855	415-431	HHRRRRHRSHEHASRLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDI4	Uncharacterized protein	0.836	470-481	PPHKRNRKAKHK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE77	Uncharacterized protein (Fragment)	0.996	41-72	RPRKKLSSKEEKKLEEKRLKEEKKLKKSKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE77	Uncharacterized protein (Fragment)	0.873	171-183	RKLRKSKKSSKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE82	Zn(2)-C6 fungal-type domain-containing protein	0.78	20-30	RRPPPDRRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ9	Uncharacterized protein	0.993	457-476	KTKKERRKHRKSHKDRRNRN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPZ9	Uncharacterized protein	0.962	361-375	KRKAKRMVKRLRRKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RR76	Replication termination factor 2	0.978	201-223	KGLTHALKKAPGSSKKKRKHAEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRE8	DDE_3 domain-containing protein	0.871	67-77	KPPPKPRRRKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSL5	Uncharacterized protein	0.822	365-371	KKKKKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXG6	AAA domain-containing protein	0.994	214-257	KKTIPKKQIKISKSGKLLSSPPKPAIEPEASPKKRRGRKPMKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXG6	AAA domain-containing protein	0.923	47-61	KAGPGRKKRTRKTDG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXG6	AAA domain-containing protein	0.891	571-578	PPKKKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ62	Zn(2)-C6 fungal-type domain-containing protein	0.863	144-154	ERKKRGKASRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S388	RNase H domain-containing protein	0.997	214-262	IKSRKEKKAEKRKASWEKKNAARRAGPKNVGERIAAKKAREEAARLLPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S436	Uncharacterized protein	0.798	84-97	KAHPRRHGKGSMKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S436	Uncharacterized protein	0.643	25-30	RRRVRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H2	JmjC domain-containing protein	0.992	797-809	RRKKAKGKKKKNK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H2	JmjC domain-containing protein	0.958	1212-1244	KRPLGRPPGRPSMVPTRGSSTGKRGRGRPRKVL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9H2	JmjC domain-containing protein	0.773	939-956	RNPEGSGAAKPGRPRGSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REX7	Uncharacterized protein	0.832	119-126	RKKARRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIN8	Septin-type G domain-containing protein	0.637	10-12	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLZ0	RNase H domain-containing protein	0.829	350-362	RRKVGGSRRPRWR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLZ1	tRNA-dihydrouridine synthase 3	0.954	373-388	PPKKKRKQMSKSEKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM57	SF3b1 domain-containing protein	0.857	188-197	PVKKTRKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQH9	Zn(2)-C6 fungal-type domain-containing protein	0.606	33-34	KR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQV8	Mur_ligase_M domain-containing protein	0.792	319-328	RKVKRGKKGE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4M3	Chromatin elongation factor SPT5 (Fragment)	0.93	88-98	RPSKRRKKAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4M3	Chromatin elongation factor SPT5 (Fragment)	0.8	285-291	LRKKKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S778	Uncharacterized protein	0.88	6-26	KLNNIAKKKRASTKDGLKKQG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S942	Uncharacterized protein	0.893	263-281	RSRRSTRRRSSGRRSSGRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAC3	Polynucleotide adenylyltransferase	0.874	1236-1245	RKKGKNKKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCY7	Methionine aminopeptidase 2-1	1	58-79	AAKKKKKRKPRKKKKAAGAAGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REW8	Ubiquitinyl hydrolase 1 (Fragment)	0.823	281-306	RRAERLKVQAVAEKIKPSKRSTKSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF14	Uncharacterized protein	0.832	291-304	GKKGKTRLPKRLVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF14	Uncharacterized protein	0.691	157-166	RRTPRPPKPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF14	Uncharacterized protein	0.633	258-263	KSRVRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLH1	Ribosome biogenesis protein SLX9	0.986	131-150	LESMKKSKGAKKRKEKLEKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLH1	Ribosome biogenesis protein SLX9	0.919	67-96	DKLKIKHSSFVSKIEKSSAKTQKRRRPNKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM30	C2H2-type domain-containing protein	0.894	138-162	KERAKNGGRKPVLKGEREAREERGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM30	C2H2-type domain-containing protein	0.825	37-53	RRSPGSGDRRTGRRRSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM30	C2H2-type domain-containing protein	0.641	827-836	GRLSPPRGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM30	C2H2-type domain-containing protein	0.601	821-821	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ20	Uncharacterized protein	0.742	17-25	NPRRRQRKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ20	Uncharacterized protein	0.63	33-36	RSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRU0	Uncharacterized protein	0.678	181-187	RKRARAP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZH1	Rab-GAP TBC domain-containing protein	0.948	1082-1102	KAIGHGLRRRASRKFRKMGMK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1G8	Threonyl-tRNA synthetase	0.961	30-44	KENKAPKAKKEKKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4J6	Uncharacterized protein	0.888	154-163	KPKKKPKKLE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4T7	Uncharacterized protein	0.956	409-422	AGKKKPPPPPPKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S513	Uncharacterized protein	0.738	40-51	FRKQLKKESKRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAS8	J domain-containing protein	0.98	193-212	KKPEAADGTKKKKKKVKALG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAS8	J domain-containing protein	0.906	145-169	KAAMREEGRAQKKEEEEMKERKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDN1	Uncharacterized protein	0.984	76-92	KRKRQRERKRAKERAEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE14	Uncharacterized protein	0.944	232-244	SAKKKGKGSKKGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE14	Uncharacterized protein	0.87	202-218	ARPLGGKMSRRDKKKAS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHH3	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit	0.621	180-184	KRMRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHP6	Poly(A) polymerase	0.984	528-546	RPKPSKDKKKKKDAKSVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ40	Uncharacterized protein	0.864	308-317	KFKPKRGRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ40	Uncharacterized protein	0.656	691-694	RRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJT5	Uncharacterized protein	0.658	83-90	AKPGAGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL96	Uncharacterized protein	0.979	1035-1054	KLKEAKRSREKKHKHGHRHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL96	Uncharacterized protein	0.951	541-566	RSRTRAPHGTKSRSKSRSRRTKSAHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL96	Uncharacterized protein	0.771	491-500	KSRSKSRRKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM16	Ribosomal_L18_c domain-containing protein	0.871	256-293	KKEEGAAPKKSKDEWKAESLKYRTKKLTKAEKEERVKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMP3	Autophagy-related protein 2	0.939	1765-1785	RPRGTTRSKRRLKLERSKHKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRW3	Uncharacterized protein	0.969	78-98	GAKAGMKRKRSVKSLPAKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRW3	Uncharacterized protein	0.928	353-373	AKAAKPEKAAKPATRSSARRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX0	Uncharacterized protein	0.958	111-128	KGAKGEKKHKKKTSKTSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX0	Uncharacterized protein	0.68	157-162	RRKNRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX0	Uncharacterized protein	0.658	274-282	KRREGQRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0W3	Uncharacterized protein	0.993	46-71	RTPKRKPSRPEPPKRAKQPPPKAPKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3B5	Uncharacterized protein	0.959	5-21	PRKRGRPPGSKNKRKAH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6C5	Uncharacterized protein	0.996	749-767	KTKTKLRLKKKKREKRAKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7U4	Uncharacterized protein	0.639	285-288	KKKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDL3	SEC7 domain-containing protein	0.647	488-491	RRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH39	Transcription initiation factor TFIID subunit 8	0.832	259-267	GKRKRSRRM
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI63	S5 DRBM domain-containing protein	0.742	33-40	PRQARKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI4	DNA topoisomerase I	0.993	191-244	PLVKKRAPAKKVNGVKKHESDSDAPIAKKSAAKKATKAKPAAAAPAKKTKAKPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI4	DNA topoisomerase I	0.984	152-184	KKKESIEKAAAKEAKAIRNKDKAAPKRKQKAES
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI4	DNA topoisomerase I	0.705	430-443	GRGEHPKTGRVKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPI4	DNA topoisomerase I	0.637	515-520	RELKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPV5	BHLH domain-containing protein	0.996	318-361	RPAKKRKKSLAKGGKDTPKKAARSSKARKAVVAEESAKKKRTPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX51	MFS domain-containing protein	0.756	11-20	RKLRERKARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ15	RNA polymerase II subunit A C-terminal domain phosphatase	0.838	481-503	KAKKVPAGGRIAELKGEKSPKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZK7	Histone acetyltransferase	0.865	377-391	PRRRKISQRRKEAKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S019	Uncharacterized protein	0.964	38-48	SPRRRRRRRRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0J1	UBA domain-containing protein	0.782	283-299	PRKPTLNRKSSKRSGPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Q0	tRNA 4-demethylwyosine synthase (AdoMet-dependent)	0.922	102-118	KAKKGPKTVKGRKIQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9R6	Pre-mRNA-splicing factor CWC24	0.832	8-19	FKKRGAKAAPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA88	Uncharacterized protein	0.931	146-166	ANKKKRGRPTKAEAQQRAREA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCS6	Nucleolar protein 12	0.998	524-561	SEKQGKSGLKFKGSGGKKKGPNGRKSRSAGWKKSGGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCS6	Nucleolar protein 12	0.964	448-482	RKLRITRCKAEKKKDKPRGPPPSSSSSKSQRGNGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCS6	Nucleolar protein 12	0.947	137-149	AQEKPKKRKRGDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCS6	Nucleolar protein 12	0.68	7-20	KRSAKTVSPKKSEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF02	Tautomerase_3 domain-containing protein	0.719	69-74	KKKKKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF92	Uncharacterized protein	0.695	163-168	RPRKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFI2	UDENN domain-containing protein	0.995	169-182	EARRERRRRRRRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJ93	Non-specific serine/threonine protein kinase (Fragment)	0.986	599-616	PKKKKTHRGRRGGRRLSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK97	BHLH domain-containing protein	0.848	324-333	KKRRRRESHN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK97	BHLH domain-containing protein	0.606	337-338	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS7	Uncharacterized protein	0.925	118-136	ELKKEREAKRAARRDKPSG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVA7	Uncharacterized protein	0.986	746-762	EAKGKRGRGSGRKKKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVA7	Uncharacterized protein	0.939	184-200	KTEKKKRTKEAKLKKLE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVA7	Uncharacterized protein	0.899	3-35	RPHAAPKKGAQKAYKRQKVEDFPKPLPSKPKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXL9	Rad60-SLD domain-containing protein	0.995	50-67	RRKEEDRKQKKRHRKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYL7	Uncharacterized protein	0.716	54-67	RRERRAHARAQSRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZV1	Uncharacterized protein	0.947	20-35	RTPKRPRRRAKTPEPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3H6	UBA domain-containing protein	0.833	621-639	ARTPARTPSPPRPKAPPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAE1	G-patch_2 domain-containing protein	0.997	346-424	SERRRDKDRRRNKDDYHDSDRRRDKRKERVRDDDYDGERRREKRRDRSRSPDDRKEKRRDRYRSRSRGSDDQRKRRRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAE1	G-patch_2 domain-containing protein	0.88	322-341	RRRERRRENRDDRDRDRRRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAE1	G-patch_2 domain-containing protein	0.639	434-436	RKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ4	RRM domain-containing protein	0.996	1332-1345	APKKKKKSKKKKTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ4	RRM domain-containing protein	0.987	1097-1128	KSKSQSKKEKEAKKKQQKKEADRIARARVEKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ4	RRM domain-containing protein	0.842	777-798	KRQQKSPTKNSKAKNKRESPLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ4	RRM domain-containing protein	0.679	275-281	RTKKNRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFB3	Uncharacterized protein	0.644	211-218	HPVRRYRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFB3	Uncharacterized protein	0.607	200-201	RR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGN2	Uncharacterized protein	0.893	191-208	LREKRRKLAREVREMRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMA6	HAUS6_N domain-containing protein	0.928	428-448	PRRRGASPKKAPPPVPNRSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMA6	HAUS6_N domain-containing protein	0.69	252-261	PRAKRPAVPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNK7	Uncharacterized protein	0.965	9-23	RRKKAAKKATKKHAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ39	NUC153 domain-containing protein	0.986	482-502	RKERERKARRKERWQAKKAGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ39	NUC153 domain-containing protein	0.981	597-609	SEKAKKKGKKAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ39	NUC153 domain-containing protein	0.972	542-557	KASKPESKKSKKAKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ39	NUC153 domain-containing protein	0.888	424-439	GKSSKTKKKASAKRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ39	NUC153 domain-containing protein	0.808	692-703	KKLAKKIKAKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQP6	Uncharacterized protein	0.656	117-121	KAKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUS6	Exonuclease domain-containing protein	0.84	375-382	PKKKKPKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE0	Transcription elongation factor Spt6	0.995	96-107	RRRRRKKKRKNR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVE0	Transcription elongation factor Spt6	0.821	136-147	KRLKRGHKERVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S657	Uncharacterized protein	0.858	1209-1226	PTAARGGRGRGKPGLGRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7C3	2OG-FeII_Oxy_2 domain-containing protein	0.984	61-89	DMTPRPSRRKRTTAPKRPSKKPATTMKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7C3	2OG-FeII_Oxy_2 domain-containing protein	0.64	50-58	KREIKPPER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7H6	Rab-GAP TBC domain-containing protein	0.815	134-144	RRKGRRKQTIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S845	Uncharacterized protein	0.942	439-466	KTKKKKKGLLGLGGDKAKDKKDHESKDK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S993	NET domain-containing protein	0.752	146-153	AAKKKSRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ9	40S ribosomal protein S6	0.935	153-202	VRKFVIRREVQPKKEGAKPYTKAPKIQRLVTPQRLQHKRHRVALKRRRAE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ9	40S ribosomal protein S6	0.817	131-149	KRLGPKRATKIRRFFGLSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ9	40S ribosomal protein S6	0.656	230-233	RKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAQ9	40S ribosomal protein S6	0.641	91-94	ERKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDJ3	Uncharacterized protein	0.873	420-459	KKKAAKVPSSFVERQEKLKVSKRKGPLQERQREKTHTMRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFW5	PlsC domain-containing protein	0.814	714-729	KRRLKDGVKLRTRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG70	PH domain-containing protein	0.699	225-230	KKRRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKK7	Uncharacterized protein	0.998	551-580	RKKKEEKDAAREAKKEGKKKAKEIKKVAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKK7	Uncharacterized protein	0.626	86-90	REARK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMV7	Uncharacterized protein (Fragment)	0.64	32-37	PLRRLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMW8	Uncharacterized protein	0.792	282-293	RREGYGKKKKLR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRM3	Uncharacterized protein	0.785	15-37	KRSRRSNSGEDGGALGKKARGRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV34	Peroxin/Ferlin domain-containing protein	0.967	131-152	RRRRWLRRRVKQKLPPKTKANA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW91	Uncharacterized protein	0.885	322-356	RGERRGRRVQSGEEEARRKEEHEARRREEHEGRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWS3	Zn(2)-C6 fungal-type domain-containing protein	0.734	47-54	RKRGPKKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYI2	Uncharacterized protein	0.821	724-740	SSKKSKAEKEVPKPAKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZM5	tRNA-splicing endonuclease subunit Sen2	0.761	34-41	PRKARPKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0W5	Tryptophan synthase	0.745	914-925	RKKSPDGHRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0W5	Tryptophan synthase	0.62	735-739	RQQKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S109	DNA-(apurinic or apyrimidinic site) lyase	0.912	383-419	KKETTKRKRVKKEPEEEELAAVKVKQEPTRRSKRQRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S208	Uncharacterized protein	0.869	347-374	RERPRTGVSERPRKARMSKEEIKLERAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S208	Uncharacterized protein	0.643	333-337	RKAKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2A6	Ribosomal_L23eN domain-containing protein	0.854	22-58	KAALRGSYANKKRAIRKNTSFHRPKTLELSRAGKYPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S579	tRNA-binding domain-containing protein	0.986	242-259	EKKKKEKKEKQPKPQKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S579	tRNA-binding domain-containing protein	0.881	159-169	KAEKERKKKEK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S595	Uncharacterized protein	0.696	40-46	KRRHWRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5L1	MI domain-containing protein	0.997	24-68	NKRRNGSRNGPPNRKDKRKADRVEKKRQNKQVRKPAPTHPHNGRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5L1	MI domain-containing protein	0.781	148-158	RLGVKGKKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6R7	Uncharacterized protein (Fragment)	0.963	11-50	AFKKLKKSFADTTIKSRKLRKVTSVKFKDKKRKLIGLKLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REQ8	DH domain-containing protein	0.921	949-978	SSRRRRLANRAIGSEHPNDKPAPKPKKTRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGG2	Midasin	0.621	730-731	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHT0	Uncharacterized protein	0.996	6-48	TKAKTKTKRKQRGRPFRPANHHATKNKKRKDPRTGPRPTRGPN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTS5	F-box domain-containing protein	0.88	653-662	GARRRRRRAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW08	Uncharacterized protein	0.961	592-608	KIAAKEDTKGRKKRKRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXQ7	Uncharacterized protein	0.842	34-49	KGPFGKARKRGTSRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX8	PARP-type domain-containing protein	0.981	111-126	RPGTKKPRAKKGKKGA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX8	PARP-type domain-containing protein	0.98	258-273	PKPKKAPQKRGRKKAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX8	PARP-type domain-containing protein	0.978	137-159	PAPPPKAKAQPKSKAKSKKAEKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX8	PARP-type domain-containing protein	0.942	228-241	APKKARGKKAAAKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX8	PARP-type domain-containing protein	0.921	177-189	PAPKKRGRAPKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZX8	PARP-type domain-containing protein	0.72	201-213	PAKKVRASGRSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q5	40S ribosomal protein S26	0.907	85-109	RVRSREGRRNRAPPPRVRYNKDGKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Q5	40S ribosomal protein S26	0.837	3-18	KKRASNGRNKKGRGHV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1R5	SFM domain-containing protein	0.969	51-114	KARKERLEKKRKAEEDEAEREAERREKRMRMAEESRRIREEEEEAEERRRRKRLGLPDLPPKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S951	Protein kinase domain-containing protein	0.687	124-139	KRRLGQRVGKLLRGKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD17	Chromo domain-containing protein	0.942	292-303	RPYRPRKHKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGF3	Uncharacterized protein	0.701	104-116	SRALRKNRSSDRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIC1	Uncharacterized protein	0.761	157-165	RRRRAPRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR6	Zn(2)-C6 fungal-type domain-containing protein	0.857	664-670	KSKKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR6	Zn(2)-C6 fungal-type domain-containing protein	0.836	517-534	SKSGKHGKPRAVSKSKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKR6	Zn(2)-C6 fungal-type domain-containing protein	0.817	203-225	SPQPGRGRRSVSASKRMRPSAKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM54	rRNA-processing protein	0.996	32-119	KAPFRPKANQSSWEKRSAERVALAAVKAKEKELKEEKESERQRRVEAIKTKRAAKEERERFAKMEEKMHKRRVERLKRREKRNKMLKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMZ6	Uncharacterized protein	0.834	180-196	KRAEFKEKERKTRHRAA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMZ6	Uncharacterized protein	0.738	202-211	GKPSHKKRVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP07	Csm1 domain-containing protein	0.981	149-180	PAPAKRGRKAAVKEPAAKKETKTKTAAKSKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP07	Csm1 domain-containing protein	0.959	41-104	APARKARGTAAQAKKAALTTKATAKGRPATRRVSGSSVVVMKKTGAGVKKAPAKGRKALIERKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP07	Csm1 domain-containing protein	0.878	126-137	KPAKRGRPAKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP07	Csm1 domain-containing protein	0.715	229-243	ARRTQAKPNSRARRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRM7	Uncharacterized protein	0.998	242-282	KQPKEKKQPKSGEKSEKAPKDKKLMKSEKKEKKSKKTEKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRM7	Uncharacterized protein	0.983	135-163	KKTTDRKSKRKREDADAKASKKGKKGDAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWF4	Uncharacterized protein	0.99	20-39	RTPKRPRRRAKTPKPKLSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYU6	BRCT domain-containing protein	0.958	1497-1509	LGKTKKAGKKRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0H0	Uncharacterized protein	0.964	104-122	MSRKRRPSSGRARSGKRKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0H0	Uncharacterized protein	0.903	65-80	RRHLKRVRKRLRNVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S168	MutL_C domain-containing protein	0.849	411-421	RPRHHRKRRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3W3	Uncharacterized protein	0.972	281-303	KGRPPGTKKSTDPDKKKRRRVAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S420	Uncharacterized protein	0.995	69-129	VPGGRSSRPRSRSPAFRRRSRSPRRDDNWRARPRSPPRRAFSPRRDDYRSERVRSPPRRDR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S420	Uncharacterized protein	0.992	21-65	RPRSPGPRPRSPPRGDSYRARSPPPRRGSPPPRRGSPIRRGIASA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S420	Uncharacterized protein	0.869	140-201	SPRPRERSPLPRERDVSPARSRGVRSPVRPSRYEEPRSRVNSPPRRYSPVRDYRRRSPSPRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S420	Uncharacterized protein	0.819	267-295	PRSPYRERIPDRSRDFSRERERSPPRRRD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA47	Uncharacterized protein	0.947	377-430	EEKAEERKLAADKVKKEQRDAKLGRLSAEEQRKFLEKEREKNARKGMKRSTVKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA47	Uncharacterized protein	0.606	373-373	K
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFU6	Uncharacterized protein	0.957	706-718	KRAKDGRKKAKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG28	DDE-1 domain-containing protein	0.872	339-366	RLKRAEEAAAKEAKANAKGQGKRGQKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG28	DDE-1 domain-containing protein	0.799	383-391	RRGRKRKST
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RG28	DDE-1 domain-containing protein	0.682	398-408	GRSMPKGKAAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGF7	Uncharacterized protein	0.799	56-61	KKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI60	Uncharacterized protein	0.938	89-125	SKDDKSRPLALRRRPSQPNTPTAKEPEKKSKKEKEPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RI60	Uncharacterized protein	0.756	45-62	ELKKQKQAEKQAKRAQAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI9	Uncharacterized protein	0.982	300-331	RRAGTITRDPRKVERKKPGHVKARKMPTWVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK26	HET domain-containing protein	0.711	519-526	HRRPRPKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM17	Uncharacterized protein	0.998	349-374	PSKKKEKKKRSEAERKERKEKKRRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM17	Uncharacterized protein	0.976	288-301	KKPKRKEKKLKERG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNG8	Uncharacterized protein	0.978	923-932	AKKKRKRRKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNW8	Cellulase domain-containing protein	0.987	8-54	PSRRRPQGDERRRRRESHGDDAERRKRRESREAAVREQEQRRRKGHR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNW8	Cellulase domain-containing protein	0.973	219-254	DRRRRQSARPAPSEAEERRERRRQEKQHRTEQKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNW8	Cellulase domain-containing protein	0.948	141-193	RRKEKNLEKERIKQERAAKRRDELENTKRRAAESDAAMHEDKARRRREERRKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNW8	Cellulase domain-containing protein	0.888	296-302	KKKKRKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPS3	Uncharacterized protein	0.843	139-167	RERTKEQKAADDKRAKDREYARRREQNKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPS3	Uncharacterized protein	0.808	101-124	RGRGGTTRGKRGVKLPAFTGRRSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRD7	Uncharacterized protein	0.921	253-280	ARERSRSDVGGKDRDRGRDRERKGNRRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRD7	Uncharacterized protein	0.638	196-201	RRHKHS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVW8	Uncharacterized protein	0.769	196-220	SRPRRASASTRQPAASPKKPTAPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVW8	Uncharacterized protein	0.607	120-121	RS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVW8	Uncharacterized protein	0.604	123-123	R
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZF5	p-aminobenzoic acid synthase	0.91	861-871	PPPKPKKKGRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2Z7	SHNi-TPR domain-containing protein	0.982	98-109	EKKKKKPKAKKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T3	C3H1-type domain-containing protein	0.898	701-713	KEKRERKERRRHL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T3	C3H1-type domain-containing protein	0.782	279-308	KKAGADSKKLRAKQLATKSQSRALKSIKRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T3	C3H1-type domain-containing protein	0.68	526-546	KKAKASPPPRVESAESKGVKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RED6	Uncharacterized protein	0.964	704-760	GRRNVRERSPRHAKKEAERRVPEEKVEDNKVTKGRPERNARGELERYDPRKKFGRGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RED6	Uncharacterized protein	0.734	613-623	RARDAKNRRKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK71	Patatin-like phospholipase domain-containing protein	0.99	79-94	RVKRRKKSKAPPRRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL56	tRNA (guanine(9)-N1)-methyltransferase	0.998	66-103	KNQLKKLRRQERWEAGREDRKLKRKEKIKEKKERRRET
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL56	tRNA (guanine(9)-N1)-methyltransferase	0.74	114-126	NKPRPPPSRAPRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS33	FHA domain-containing protein	0.695	311-316	KKRRGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS33	FHA domain-containing protein	0.666	638-644	FKKFRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSM6	Uncharacterized protein	0.976	570-604	RGKGLREKGKEIQSRLAEIRERQKAGDKKKKGGKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSR8	Pre-rRNA-processing protein IPI1	0.989	6-29	KKKKENKKKDFQKPKLKVGKARPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTB7	Uncharacterized protein	0.994	164-189	KEAKKKAKKERHLQRKREKAAPKPNH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS8	TPT domain-containing protein	0.995	170-182	KRDRRRRRRRKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVS8	TPT domain-containing protein	0.818	113-119	KKKPRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYI0	Uncharacterized protein	0.792	5-17	GKSFLRPKPKGKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S150	Uncharacterized protein	0.802	508-517	ERRRKAEKKD
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S150	Uncharacterized protein	0.658	375-387	KAKKLHIEAERRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1C2	Intu_longin_1 domain-containing protein (Fragment)	0.83	338-344	RRKRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S268	Uncharacterized protein	0.971	238-263	KEKEKQKEKEKKVKIELPPKPKPKPT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4T1	Protein kinase domain-containing protein	0.979	681-689	NRRRRRRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8W4	Fork-head domain-containing protein	0.903	270-305	SKQPNKRGPRNHQPQPQRQASGAKGGKASRRSARMR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9V0	WD_REPEATS_REGION domain-containing protein	0.836	740-748	KSKKAKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAT6	Uncharacterized protein	0.939	758-778	GKRRWNERIERSKKPRREGSP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAT6	Uncharacterized protein	0.609	429-432	RRVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RFU5	SP-RING-type domain-containing protein	0.787	74-83	VRGRGRPRKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMN3	Uncharacterized protein	0.744	27-45	KPAIKSARKTVPKVPSKRY
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RP84	Thioredoxin domain-containing protein	0.994	6-30	RKRKEAPPAPVRPAKKKAPAKAKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWP6	Uncharacterized protein	0.794	121-132	RPHRRWFKKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXU9	Uncharacterized protein	0.893	28-40	KKKRGRGRNTQKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S049	Uncharacterized protein	0.986	83-104	RKHEPTQPTKRRKAKRAKRMSS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5N7	Uncharacterized protein	0.905	168-177	HQKKHKKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5N7	Uncharacterized protein	0.752	217-227	KLQKARRKESR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5N7	Uncharacterized protein	0.742	197-209	RKVREARAREKVR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8H8	Uncharacterized protein	0.823	387-403	AKRKAEREKQDKEKTRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8X3	Uncharacterized protein	0.652	482-486	AKKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9U4	Glyco_hydro_85 domain-containing protein	0.855	590-606	KRKAEKGSSPSKPKKSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RE12	Uncharacterized protein	0.78	280-286	RKGKKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH44	Photolyase/cryptochrome alpha/beta domain-containing protein	0.641	617-622	KSEKKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKH3	Uncharacterized protein	0.998	84-195	ARRAQPEKISPPPSPSKQTPKSAAASKPASSAPPKAEKTEKSSSSKKTTSQTKLPAPAKAAAPPKKVTEPKAVPLKKKPEPKPAPKLAPKPAPEPKKQSRPKPETRISSRPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RKV9	Pyr_redox_2 domain-containing protein	0.856	154-163	SKHKKKKTIK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS56	Uncharacterized protein	0.937	640-650	SQKKKKGPKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU17	Uncharacterized protein	0.792	200-216	RRRATRKKELERERDRL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWW2	Uncharacterized protein	0.978	42-62	KRFPAPKKVKGRAKGRPAKAE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWZ9	Uncharacterized protein	0.994	256-273	KPKAPKKSKSKSKKKRTP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RYP5	DNA damage-binding protein CMR1	0.979	44-73	KGKASVSSKPKTKKPAPKKIKQEEVAPRRT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZW5	Uncharacterized protein	0.657	227-231	RDKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S299	WAPL domain-containing protein	0.901	253-277	SRQMPVGKRKEPAKEHPTKLREGRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S299	WAPL domain-containing protein	0.673	127-144	KNSAKATRPSSKPEPTKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S299	WAPL domain-containing protein	0.645	147-153	IAKKLPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S4A1	Metallophos domain-containing protein	0.994	624-657	LKDKSRGRVKLYGHPGGSKAGAGKKEKRKIRKGL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7F3	Uncharacterized protein	0.986	351-422	KEKERAAAREEARATKEQERLQAEKEKERAAAREEARRRKHEELERERLAQEKKERDEKMARDRKKEKSKPP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7F3	Uncharacterized protein	0.786	291-302	RPKVSDERRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7F3	Uncharacterized protein	0.774	686-692	SKGKKKH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAY0	Queuine tRNA-ribosyltransferase accessory subunit 2	0.704	427-433	KKEKKNP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHE6	Zn(2)-C6 fungal-type domain-containing protein	0.618	44-46	KKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL92	Uncharacterized protein	0.891	704-727	KDHSEKKPRDKSRTRTIFGRKKSS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ08	AIP3 domain-containing protein	0.887	923-951	EAERLRKAKDERARKENFEREAARQRAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTC5	Ribosome biogenesis regulatory protein	0.965	209-233	SRKERKERIRRNERKQRANDVKSRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTC5	Ribosome biogenesis regulatory protein	0.876	132-157	KPIPAAKEPTKWERFAAKKGIKDKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RVC5	Uncharacterized protein	0.758	354-365	KRVQARKEKEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N0	Uncharacterized protein	0.998	73-136	KKKLNGTTLRGTKVRIEMAKPEKRKARAEADAAKEQDEAERPSKRAKKDNKDKKEKKEKKRKEQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N0	Uncharacterized protein	0.996	148-192	RKVKRGWTEPATKNKKERKENKDKDKKEKSDKDAKKERKHSKYTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N0	Uncharacterized protein	0.994	319-333	ATKDEKKKKKKKKAT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N0	Uncharacterized protein	0.987	211-229	AHKDKKKDKKEKKEKNKSA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S0N0	Uncharacterized protein	0.974	560-585	RAWKRRRRDALKAKRKIENNKMTGGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1B3	C2H2-type domain-containing protein	0.883	890-904	KPLPKKKGRPVGWRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1B3	C2H2-type domain-containing protein	0.756	830-838	QKRRGRPPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2T7	RNase III domain-containing protein (Fragment)	0.939	379-468	KQRRKEARKERERMKLLQEQENKERQREKDKEIALQKAKKQEIQKEKEKQKEHEAHIKELEAQEKRKLEDHRNKELKAQRQKELKAQKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3D5	Uncharacterized protein	0.654	25-37	NKTPGRQSQRKPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3D5	Uncharacterized protein	0.653	469-474	GPKPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3D5	Uncharacterized protein	0.608	15-16	GK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5L2	Uncharacterized protein	0.998	119-138	LKKRDKKKAKKTKKKKVETK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7Q1	Zn(2)-C6 fungal-type domain-containing protein	0.624	53-55	RRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S824	Cation-transporting ATPase	0.897	1354-1367	KVKFGGKRGQKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S894	RF_PROK_I domain-containing protein	0.998	97-127	TRVRAREKSKKKASKEKKARRKYRALEEKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8Y4	Uncharacterized protein	1	481-497	KKKKKKKKKKKKKKTKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA09	Uncharacterized protein	0.766	466-473	KKRGRPRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD37	Uncharacterized protein	0.999	149-173	EPRTEKKSKKRKKEKEAKEKKKEAQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD37	Uncharacterized protein	0.992	681-733	KRDKQTLKRRGVEARRKGKEGGRISSKSGYDRKIENMRRGKMEKMRREKKGEN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD37	Uncharacterized protein	0.823	92-100	KKQRKKLKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDP5	Uncharacterized protein	0.907	103-109	KKKKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REC8	rRNA adenine N(6)-methyltransferase	0.901	319-334	KSKGKNGVNRKRKGRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REI1	Vacuolar protein sorting-associated protein 51 homolog	0.679	204-208	KKKRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH66	Uncharacterized protein	0.805	73-79	GRRKRKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIP2	Aa_trans domain-containing protein	0.677	27-31	RRKGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIW0	Arrestin_C domain-containing protein	0.928	211-222	SRRARPKPRKRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJA4	SET domain-containing protein	0.773	25-37	KKKQGQRPRDRKG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM90	Uncharacterized protein	0.992	528-550	KKNPKHAALKPVAEAGKKGKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM90	Uncharacterized protein	0.806	484-497	MGKAAQKRAKRAAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMF2	C3H1-type domain-containing protein	0.742	482-495	RGKYSKLKGGKHGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQA4	Uncharacterized protein	0.998	125-151	AKKTKAKVIAKPKPKGKGKGKRAIKKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQA4	Uncharacterized protein	0.737	87-96	GGSRAKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRI0	Uncharacterized protein	0.92	379-392	RKELRKAAKSKKKP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS47	Uncharacterized protein	0.953	500-520	TKRKLVDSPGKSGRKHPKRRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RS47	Uncharacterized protein	0.862	125-132	HRKKRRKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RU98	LCCL domain-containing protein	0.878	58-74	GRKAGEWAKGPKPRHKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUL4	Pre-mRNA-splicing factor 38	0.971	285-323	RDRSRSRGRSYDSRERSRSRSPRERSRSRTRSRSLSRRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXK6	Uncharacterized protein	0.949	577-595	PGKKADAKKDKKEKRASMK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXK6	Uncharacterized protein	0.76	311-320	KKMLKKKEPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXK6	Uncharacterized protein	0.759	83-96	RKKKPFYKRLNLLK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZR6	Uncharacterized protein	0.659	147-150	RRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1F6	XPA_C domain-containing protein	0.932	332-358	KERKQKKFKNKLEDLKKRTRVEAYRRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2P9	Mitochondrial Rho GTPase	0.97	405-416	TKARKRRRKPGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S3P4	Uncharacterized protein	0.859	670-690	RRLDRWEGGKAAPRGRPKGER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5Y1	MICOS complex subunit MIC60	0.958	139-151	KPLPKKKRRRFRR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S800	Uncharacterized protein	0.997	1168-1217	RKEAKVAKRGRKSGGRPEEDSPVPSRASSEEPMPKKRGRKPKAEKRKADE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S800	Uncharacterized protein	0.735	1225-1232	APRKRGRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S800	Uncharacterized protein	0.714	394-402	ARETKEKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S943	PKS_ER domain-containing protein	0.688	287-292	GEKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9C2	Uncharacterized protein	0.857	17-31	RKDAKSARIKKNKKV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9C2	Uncharacterized protein	0.657	74-80	KNPKGKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q1	Uncharacterized protein	0.999	1416-1440	GKKKPKKKSTKKPVKKKAKKGGKGH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q1	Uncharacterized protein	0.985	1069-1153	EKKAAKEKADAEKRAAEEKRAAEAKKAVERKLAEEREAAERKKADDEKKAIEARRLAEAEEAKARAAAERQRIDEEKKAVEARKL
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q1	Uncharacterized protein	0.984	1162-1203	ARLAAEKKAAEEREAAEKKKLEEKKKATEAKKLADAKKAEAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q1	Uncharacterized protein	0.91	1381-1401	GKKKRRNGKEPSSAGSYKPPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9Q1	Uncharacterized protein	0.888	1321-1337	KPPVKKPKVKRPTQPPH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RCV8	WD_REPEATS_REGION domain-containing protein	0.994	236-249	KADKPKKKKKKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RD07	Uncharacterized protein	0.875	687-698	GKGKTGRRKSRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF69	Uncharacterized protein	0.783	389-400	IKKKPAPKVAAR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RF69	Uncharacterized protein	0.682	361-374	RANIEKKERSEAPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RGS2	Uncharacterized protein	0.649	178-182	RRNKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH96	RING-type domain-containing protein	0.944	139-161	KRRRRERSRDASRESRRNRDERR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RH96	RING-type domain-containing protein	0.841	245-263	RQTERHAERQRERRERRER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIQ0	Uncharacterized protein	0.635	286-289	RKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJE2	Uncharacterized protein	0.629	215-217	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLE1	Uncharacterized protein	0.839	619-627	PRKVKKRRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RMG4	Non-specific serine/threonine protein kinase	0.736	876-885	KGRKRFSKRH
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQN6	Uncharacterized protein	0.999	28-81	TKELKAKPKLITEEQAGMKREERVKEKERKEKERKEKERKEKERKEKEKAAKAT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RW50	PDCD2_C domain-containing protein	0.871	96-128	RRKEGSVRGIRGVRIAKGAAKSASAKVERKEVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWI3	PLD phosphodiesterase domain-containing protein	0.867	102-118	ARLGKRKRNASPERPSK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RX31	Uncharacterized protein	0.666	502-505	RKKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXK3	Uncharacterized protein	0.652	272-276	KKSKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S6B1	Uncharacterized protein	0.849	834-853	RRRGSATDKLHKWSKGKKGR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E3	Uncharacterized protein	0.971	204-217	KPRRKPERKARKPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E3	Uncharacterized protein	0.81	389-411	RSSKRKSNTSTPKTPPSARRPKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E3	Uncharacterized protein	0.704	623-638	ESRRRASSYKPSERKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7E3	Uncharacterized protein	0.701	307-318	RRKMAEAKKQRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8E7	Uncharacterized protein	0.813	98-114	PKKAQKRRMAVQPKKAS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9X0	Uncharacterized protein	0.977	309-355	RKKQREANGGFRGHNNNRGRGSRRGGNDRGGNNRRRDHSPRRPRDRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S9X0	Uncharacterized protein	0.835	364-388	KQRRDRFKSGRDDRGSRKEEKEEKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA89	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.92	545-569	ERRERGRERSKSRSKSPSTIAPKGP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SA89	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.798	382-388	KKPRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAB4	BZIP domain-containing protein	0.85	146-154	PKRKRGRPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHJ3	Uncharacterized protein	0.801	428-437	RKRGRPSKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RL23	Integrase catalytic domain-containing protein	0.771	9-14	KKKKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLT6	HMG box domain-containing protein	1	74-151	KKAVKTAAAKKPATKAKAAPGKKVAPAKKTAKTQKKPAAKKAAKKKPAAKKPGRKRAKKALTPEEKEKAKIRELRAKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRX0	DNA mismatch repair protein	0.928	200-213	KKRKRPSASKARAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRX0	DNA mismatch repair protein	0.83	413-428	DKGKTPKKAAGGKENK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RSZ5	Zn(2)-C6 fungal-type domain-containing protein	0.873	59-70	EKKRRGKVPRHI
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RXG7	Uncharacterized protein	0.852	917-931	MKNGKGGKKEQRSKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZ83	Uncharacterized protein	0.729	78-84	RKKKKER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZI7	Uncharacterized protein	0.983	106-125	IKRKRGRPSGGGRGRPPKGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RZI7	Uncharacterized protein	0.902	75-88	PRKKRLGRPPKNRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2X8	Uncharacterized protein	0.986	116-133	SKKPRARKPKTPSKKAKS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2X8	Uncharacterized protein	0.689	87-94	KTPSKKKT
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S376	Uncharacterized protein	0.944	70-108	KSPSKSRTKKRNTSPSKNGVKSGRVSKSRNKTTTRTKVK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S534	DH domain-containing protein	0.613	1188-1189	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S5M9	Uncharacterized protein	0.993	122-142	LNKEKIERRRLKRQKKKEKRA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8E3	Ribosomal RNA-processing protein 8	0.994	117-134	KRGKKRKRGKAGGNKDKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8E3	Ribosomal RNA-processing protein 8	0.985	172-186	ESKRDKKKRKKESKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8E3	Ribosomal RNA-processing protein 8	0.977	53-71	PKPKDSKPGKKAQKRKEKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8E3	Ribosomal RNA-processing protein 8	0.941	288-310	GKLRPKDQRRDRRGPPKNAVRRG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S8E3	Ribosomal RNA-processing protein 8	0.908	440-474	VDKKKGGVPINSIGSLKKNVDKKLLKPAKKQKADK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REE8	TRP_N domain-containing protein	0.798	606-613	HRKKRKEA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REM8	Uncharacterized protein	0.947	260-304	SKKRKAEDEATGSKKRKTENGLEAKSVYRAQKKIKKEDVGKKRRE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3REM8	Uncharacterized protein	0.708	127-142	VKNKELKKLVEKMRAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RHP5	RING-type domain-containing protein	0.96	42-67	TKRRRSRAADPWAKRRKPSTNSKPPK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJQ6	Uncharacterized protein	0.804	1239-1253	VKEEKKSRKFWSRKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RK14	Clustered mitochondria protein homolog	0.896	658-676	KKPKLSSAEKKAAKIAKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLU8	Uncharacterized protein	0.847	576-619	EKESDRRDRSRRDDRDRDRDRRDRDREYRNGHSDSHRRHRTRTR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLU8	Uncharacterized protein	0.679	375-382	RIKRRIER
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPY3	Uncharacterized protein	0.998	110-221	KKRAPPPRPAPARSGTDPRAGHRPSRSEEERRERARESSRGPSRPRGPPSSSDRRDREHRRPRRNSESSIADKGTLDPREERRRRERRREREERSKDGKDSKDSKGKRVRRP
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RPY3	Uncharacterized protein	0.816	487-498	KSLKGGPRRRPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RQ69	Uncharacterized protein	0.833	37-52	KKKREASKQKREVIKE
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTP8	TAFII28 domain-containing protein	0.934	68-77	GGKKRRKKGG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTQ2	Uncharacterized protein	0.889	741-751	AQKRRKKSRHG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RTQ2	Uncharacterized protein	0.641	243-248	KRKQKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUF3	Uncharacterized protein	0.919	8-18	KGDKKVKKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RUF3	Uncharacterized protein	0.626	204-210	PRFKANK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RWK3	RRM domain-containing protein	0.664	240-248	KHKQGKNKN
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RY67	Uncharacterized protein	0.753	840-852	ELLKHSKIKAKRQ
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7N8	HUN domain-containing protein	0.993	54-104	TARGEPRKKPGPKPKNKDAVVPEPEKKTRKPRKSEPKDPTAVPVQRKRRTK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7N8	HUN domain-containing protein	0.969	525-564	RRGRGRGRGGTLRGETSGRGRGRGGGPGSRGGSTVRKPRV
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7N8	HUN domain-containing protein	0.934	465-473	GGKKRRKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDC1	Bromo domain-containing protein	0.958	531-547	SGRSRRKAPAKRARPGS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RDC1	Bromo domain-containing protein	0.953	476-496	PKQTPPKAKAQRKSRTKGKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RIG0	Uncharacterized protein (Fragment)	0.608	26-28	RAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RJI3	Uncharacterized protein	0.774	25-33	RKPRAKKSR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RLE2	Nop domain-containing protein	0.98	349-363	KPSRKRGGRRARKAK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM04	Uncharacterized protein	0.929	885-896	GEKKKKKRVGSG
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM92	ECM11 domain-containing protein	0.864	534-547	RSPRPSKSPRAKRS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RM92	ECM11 domain-containing protein	0.659	490-494	QKKRK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNE8	Uncharacterized protein	0.697	1181-1187	GGWRKKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RNE8	Uncharacterized protein	0.606	1178-1179	KK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RRJ2	Uncharacterized protein	0.635	21-25	NRRPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RT55	ATP-dependent DNA helicase II subunit 1	0.921	565-594	RGKPVEKKRPAGGTDADGKPAAKKVKKETK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV36	CDT1_C domain-containing protein	0.911	141-152	VPKRGRGRPKKA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3RV36	CDT1_C domain-containing protein	0.631	197-199	RKR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S036	Uncharacterized protein	0.873	801-814	RKSRAKGPQRRRPA
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z2	Uncharacterized protein	0.99	402-453	RGGRGRGGHPGGDRGGYRGRGRGGPRGEYRGGRGRGRGEFRGQRGGYRGPPR
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S1Z2	Uncharacterized protein	0.775	18-25	SARKKKGK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2F1	Uncharacterized protein	0.993	81-104	RGRADKGKNKSKSKRMAKRKRSPS
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S2F1	Uncharacterized protein	0.761	36-50	KTGRPVRKSAGKIKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3SAY3	DNA helicase	0.739	794-803	RKLGRSGPKK
UP000001067	Pyrenophora teres f. teres (strain 0-1)	E3S7T4	Btz domain-containing protein	0.687	68-76	SKRKANGAR