ProteomeAccession	ScentificName	ProteinAccession	ProteinName	PosteriorProbability	Location	Sequence
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWY9	Glutaredoxin domain-containing protein	0.657	812-816	KKKMG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWY9	Glutaredoxin domain-containing protein	0.64	821-828	GRDKNKDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8H0	Uncharacterized protein	0.98	352-370	KFKSPSSSSKGGKGKGKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8H0	Uncharacterized protein	0.879	68-78	KKRLSGKKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8H0	Uncharacterized protein	0.852	271-292	AIRQGMRKAAGERRDKEREKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8H0	Uncharacterized protein	0.763	8-18	KLDLKGKGKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH75	Chromosome 1, whole genome shotgun sequence	0.969	265-290	RPKNAEERRARMLESKRRWARKKRLQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJP9	Pre-mRNA-splicing factor SLU7	0.829	136-145	RPRKKGAKKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJP9	Pre-mRNA-splicing factor SLU7	0.812	485-499	EKRATRDAGRSKRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJU8	Chromosome 15, whole genome shotgun sequence	0.977	605-638	DAPRRGRPPKKRPLDDDRSETPPRKRGRPRIHPL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJU8	Chromosome 15, whole genome shotgun sequence	0.863	646-655	VPKKRGRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJU8	Chromosome 15, whole genome shotgun sequence	0.741	1521-1531	PRTKRDRRSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX12	Chromosome 15, whole genome shotgun sequence	0.997	395-430	HSRASSSRGKGRFFAAKPSRGRARGRGRGRARARGQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY61	Uncharacterized protein	0.898	177-193	RIRRRQRRREQEEKRKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ45	Uncharacterized protein	0.787	309-323	RERERRDRERKETRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZH3	Chromosome 7, whole genome shotgun sequence	0.794	534-547	AETRRRRWLRRAVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0L2	XPA_C domain-containing protein	0.896	293-303	EEKAKKRGKKF
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0L2	XPA_C domain-containing protein	0.724	31-45	ARARLRLQARARKPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4X1	Spindle pole body component	0.665	47-59	KKRDETKDERRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7M1	Chromosome 1, whole genome shotgun sequence	0.863	62-73	RPGRRKRNRGSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAB3	DNA-(apurinic or apyrimidinic site) endonuclease	0.755	695-718	KKNKPGRESKDEKFFSEVRKERGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBJ1	Chromosome 1, whole genome shotgun sequence	0.996	563-590	PKALKKKKHGTGKRSAPRKYGGKAKKRL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBJ1	Chromosome 1, whole genome shotgun sequence	0.976	656-671	PRKGRLAAKARKRKRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBJ1	Chromosome 1, whole genome shotgun sequence	0.773	421-426	RKRKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3H6	Actin cytoskeleton-regulatory complex protein SLA1	0.992	619-671	RRRERERERQSSRPQSSAVAGMPREDRERERERRKEKEREQRRRESARSGPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3H6	Actin cytoskeleton-regulatory complex protein SLA1	0.812	205-210	KKKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3H6	Actin cytoskeleton-regulatory complex protein SLA1	0.8	479-497	ARERGEREEKERARREALK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYG5	Chromosome 16, whole genome shotgun sequence	0.981	456-485	MFRAEQKAKRVSKIKSKAYRKIHRKEKERL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYG5	Chromosome 16, whole genome shotgun sequence	0.612	100-103	GKQP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYG5	Chromosome 16, whole genome shotgun sequence	0.603	453-453	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1P1	Chromosome 12, whole genome shotgun sequence	0.991	1054-1079	KFKAKKGKKKLTRNEKKAQEERRRLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C9I0	Putative translation initiation factor eIF2 beta subunit (Isoform A)	0.953	79-87	KKKKKSKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C9I0	Putative translation initiation factor eIF2 beta subunit (Isoform A)	0.929	31-39	KKKKKDKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFM5	Chromosome 1, whole genome shotgun sequence	0.883	1607-1625	KKKKRSEQRERIEASREKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFM5	Chromosome 1, whole genome shotgun sequence	0.728	1303-1311	RRGRGPKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIE9	Zn(2)-C6 fungal-type domain-containing protein	0.871	121-147	KSSKATPRKSREDTDESSRPKPLKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIE9	Zn(2)-C6 fungal-type domain-containing protein	0.748	1020-1029	KSRIRSKKRL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRI1	Anti_prolifrtn domain-containing protein	0.994	568-592	GRRRLRSRGRRSRGRGAGRAARRHA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT98	Uncharacterized protein	0.868	674-699	HSAPRSSPLRKNHARPSKHAHGTRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT98	Uncharacterized protein	0.678	35-40	KQRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXH7	Chromosome 9, whole genome shotgun sequence	0.985	211-223	SKRRRKRSHRKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY81	Putative ubiquitin-ribosomal 40S subunit protein S31 fusion protein	0.995	73-99	LRGGAKKRKKKVYSTPKRIPHKRKKVK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZG4	Uncharacterized protein	0.778	178-184	RRRKRPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1C0	Uncharacterized protein	0.738	1293-1301	TIKKRKQEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3N1	Uncharacterized protein	0.992	396-434	EAKRKAEKAKFDKLSPAEQAKRKEVERKRAMKKGAQKIR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4H6	Metallophos domain-containing protein	1	481-507	HHHRPTPPERRKGRKHKKKKRKPLPRH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4H6	Metallophos domain-containing protein	0.839	564-584	KKKHKNKHTSDNDKEKERKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4H6	Metallophos domain-containing protein	0.756	659-669	RKKRSAKLAKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E553	Associated with spindles and kinetochores protein 1	0.675	386-399	KSSKAASSSKRGGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6M3	Uncharacterized protein	0.902	550-568	KDRKFKLPKWIKRGSKKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7I1	Uncharacterized protein	0.91	154-172	WKKQKRRENAARREKEQKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7I1	Uncharacterized protein	0.675	552-559	AQRRQRKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3W3	ATP-dependent RNA helicase DBP10	0.998	1083-1154	AGVFGNRRPGQPKRQAAKDEVKSARQIQKDRELKEKRREKNARPSKSDTNRRAKRGAARRGRGGHGPRGASR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3W3	ATP-dependent RNA helicase DBP10	0.954	437-460	NRRAEFKGKTKDKHLGNKRKRGGP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3W3	ATP-dependent RNA helicase DBP10	0.86	842-854	PKVAARNKGKKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBL3	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.805	417-425	GSRRKRGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBL3	Histone-lysine N-methyltransferase, H3 lysine-36 specific	0.618	948-951	RKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0M4	EF-hand domain-containing protein	0.642	969-974	KARREA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5B6	Chromosome 7, whole genome shotgun sequence	0.821	562-577	KLKKRAKSSFKKDSHA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5B6	Chromosome 7, whole genome shotgun sequence	0.731	581-594	GKEDAKKIDVKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C9H1	Putative transcriptional regulator	0.983	207-220	AKSKRKRKHKRSAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C9H1	Putative transcriptional regulator	0.933	1341-1380	GAKSSKKARKSPSPSTHSPAPAGKLGKGSGGGGGAADKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEK8	Uncharacterized protein	0.684	621-629	RRPMRRAPG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLP7	Chromosome 12, whole genome shotgun sequence	0.835	1605-1617	GPNKQRRKARERR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLP7	Chromosome 12, whole genome shotgun sequence	0.714	913-926	RRRKAQAPTPGGKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW16	Chromosome 9, whole genome shotgun sequence	0.999	59-80	ARKEDKKRKRKEKEKARKQKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW16	Chromosome 9, whole genome shotgun sequence	0.665	219-223	KRRKF
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX84	Chromosome 15, whole genome shotgun sequence	0.884	124-144	RSQRGRKQPPARRVRGTGARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXE3	Ribosomal RNA-processing protein 8	0.745	339-350	KGKGNGKSKSKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ34	LsmAD domain-containing protein	0.711	486-494	KKKAALAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZL0	Uncharacterized protein	0.97	66-86	KKTGAKPKAPKKEKLKPWQAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZU2	GATA-type domain-containing protein	0.932	413-428	RRRLAGKGMKRVRKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZU2	GATA-type domain-containing protein	0.609	146-147	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1I8	Amidohydro_3 domain-containing protein	0.959	159-194	RRPRSNKAARLGRQLNSKKDGALRRKRKCDVRRLKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E277	1-phosphatidylinositol 4-kinase	0.734	43-57	KWKTAVARKFRGKPH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2A2	Chromosome 8, whole genome shotgun sequence	0.999	1038-1056	ARRKRRERRKKRRDKAKRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2T0	Uncharacterized protein	0.937	1062-1079	VTKKHKSKAKPRHSMKLV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2U9	Uncharacterized protein	0.927	540-573	KESKKDKDAKDKDGKVDKGKKGGNSDEPKTPRKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P209	Chromatin modification-related protein EAF1	0.978	1081-1129	KKGDGKDADASSSKRDKLSKKSGSKHDGSKRKQRRSNLMEVMRRSAKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PDT1	ATP-dependent RNA helicase DBP3	0.995	77-95	KAAKKRRKEEKKAKKAAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PDT1	ATP-dependent RNA helicase DBP3	0.992	46-66	PASPAKKDKKDKKDKKDKKRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PDT1	ATP-dependent RNA helicase DBP3	0.844	15-29	KSLHKKEKKASAKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWC5	Chromosome 19, whole genome shotgun sequence	0.932	554-563	KRKRKKRCKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWC5	Chromosome 19, whole genome shotgun sequence	0.783	8-22	HKRKRSSVRTDKARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZV5	DRIM domain-containing protein	0.959	3024-3064	QAKRNAKRNEKNHAARRKRNQSNLEQREAGGSGKTKRVRRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZV5	DRIM domain-containing protein	0.752	13-30	KKLTREQQRKKADSKASK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0K3	Uncharacterized protein	0.983	418-433	QRGRRAKRKKPIGGRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLT5	Chromosome 12, whole genome shotgun sequence	0.997	18-37	LKLKGEDGKKDKKKKKKKVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLT5	Chromosome 12, whole genome shotgun sequence	0.732	101-111	RKKRMHQRIAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQ05	Chromosome 8, whole genome shotgun sequence	0.725	486-499	RRKRDEEQERKRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DN19	Ras modification protein ERF4	0.696	310-318	KKYARKQKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSM9	Chromosome 16, whole genome shotgun sequence	0.879	42-50	SSNKRKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSM9	Chromosome 16, whole genome shotgun sequence	0.703	825-833	QKRRHPNRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSM9	Chromosome 16, whole genome shotgun sequence	0.641	546-551	AKKQAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSM9	Chromosome 16, whole genome shotgun sequence	0.603	517-517	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DV36	Chromosome 10, whole genome shotgun sequence	0.856	335-355	AKDMRERERSRKLREPPSRPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWV4	Chromosome 16, whole genome shotgun sequence	0.982	809-821	RKLKKRAKNKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY22	Chromosome 7, whole genome shotgun sequence	0.997	200-238	APPSKKALERKQKATEFRKKKKEQAMKRKAQKAAKGDKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY22	Chromosome 7, whole genome shotgun sequence	0.824	273-283	KKPAKKVKKQA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0G5	Signal recognition particle 54 kDa protein homolog	0.987	453-476	AKSKKKKKPQSKVRMTARARRVAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1V3	Ubiquitin	0.831	121-128	LRPKKKLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4Z8	NTP_transf_9 domain-containing protein (Fragment)	0.705	619-627	RPFRKRAWR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P49606	Adenylate cyclase	0.849	406-419	KKDPRKRIKGVRHH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PDF6	Structure-specific endonuclease subunit SLX1	0.799	301-311	KKSKRAKKLSD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PDF6	Structure-specific endonuclease subunit SLX1	0.751	130-138	RPKKRMARP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUR0	Protein SDA1	0.99	309-336	RKVNKKTRSGDKKMRAAAAVAKKKRKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUR0	Protein SDA1	0.981	840-869	WSVRSKKNASLREKSRRLRKHVETSKKRLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUR0	Protein SDA1	0.967	633-660	RKHKRSVKERLVAARERRQKKRAQVQRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUR0	Protein SDA1	0.88	802-817	QDREKYGSKKGKKNKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BY56	Midasin	0.802	903-911	SGSRKKRKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8H7	HSF_DOMAIN domain-containing protein	0.856	879-889	KPRSSKKPKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8P2	Uncharacterized protein	0.851	5-20	KKRLAGKTPRKVRREP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDL6	Sas10 domain-containing protein	0.994	714-745	NKGLTPHRPKTSRNPRVKKRLKYEKAKKKLGS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDL6	Sas10 domain-containing protein	0.918	458-478	KQKKKKSAGIDKMKKQAAHAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDL6	Sas10 domain-containing protein	0.776	432-442	KAKKNAKKQKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTB2	Putative pre-mRNA splicing factor prp1	0.876	109-127	RRKKFREARQKEERDRARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTB2	Putative pre-mRNA splicing factor prp1	0.8	163-172	KRRKAAAKRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZH2	Chromosome 1, whole genome shotgun sequence	0.947	436-452	HRRNSKQKKWKGNKKAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZH2	Chromosome 1, whole genome shotgun sequence	0.601	145-146	KR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1A6	Exosome complex protein	0.925	224-237	SKKHKKSKKTSASK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DME6	Chromosome 23, whole genome shotgun sequence	0.67	409-422	KEKRQLRNKISARN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E280	Chromosome 8, whole genome shotgun sequence	0.915	164-198	KSRSETRKRLPSHGIIRATLRRKKLAERASHPQRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E352	Uncharacterized protein	0.998	344-390	GKRKRSSAKSSSRKKSKKCKSSSKSSKSKHRHSSKSRSRSRERSRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E352	Uncharacterized protein	0.982	414-436	RRHRRRSSSKKKRSNGKVSSSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4H5	Uncharacterized protein	0.616	161-165	KQKER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7V8	Chromosome 1, whole genome shotgun sequence	0.704	56-61	PRKRPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E888	Uncharacterized protein	0.678	116-121	GRRPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBQ9	Chromosome 1, whole genome shotgun sequence	0.991	407-476	SPKEKRKAKESMELSPEKQKEKDEKEAAKAERLKAKEAKRLERETKELEKQKAKEAKEAELKKAEEQKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBQ9	Chromosome 1, whole genome shotgun sequence	0.903	755-767	PKKKKKVKLLGRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBQ9	Chromosome 1, whole genome shotgun sequence	0.605	578-579	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PB36	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.981	225-259	RRSRSRSRSRSRSRDRYRSRDHSRERRRERSRDRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PB36	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.889	1112-1136	KAKKIPKVKAATVSKKKGTTAARKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PB36	Histone-lysine N-methyltransferase, H3 lysine-4 specific	0.748	1012-1021	KKKRGHTHRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUR5	Putative snoRNP complex protein NOP56	0.999	468-523	KKSKKDKKDKKSKSKSSDKDKKKEVEKAAKKAAKESKKDKKDKKDKKEKKEKKPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVB2	Origin recognition complex subunit 1	0.874	368-378	PKRRPGRPRKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVB2	Origin recognition complex subunit 1	0.667	471-476	KRKLPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C312	Chromosome 10, whole genome shotgun sequence	0.753	86-94	RPRIRKPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C339	Chromosome 10, whole genome shotgun sequence	0.95	277-314	ARWRRKARLRVKREIDERAAAEAGEGSRHKSQRKGKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3S3	Chromosome 9, whole genome shotgun sequence	0.813	344-351	DRRKRRRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3S3	Chromosome 9, whole genome shotgun sequence	0.604	309-309	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJS6	Chromosome 15, whole genome shotgun sequence	0.947	151-173	RNKRRRPHTSPQTRRRARARARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CKS6	Uncharacterized protein	0.771	679-688	RKRNKSSRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CW95	rRNA-processing protein FYV7	0.953	138-196	RPRRQGGKEKSHKPLPHPLPKGSAVRSEPAAKATDTRSKAEKDQERLKKKKMWNKPSGS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CW95	rRNA-processing protein FYV7	0.761	44-60	KHKRIKAELIHKAKVKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D133	Chromosome 1, whole genome shotgun sequence	0.796	586-595	RRAAAPRKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMD3	Chromosome 23, whole genome shotgun sequence	0.682	571-578	RKARGKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMD3	Chromosome 23, whole genome shotgun sequence	0.616	733-735	RKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRE3	Hsp90 chaperone protein kinase-targeting subunit	0.719	192-201	KPAPNKGRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS04	Kinesin motor domain-containing protein	0.951	1089-1098	PKKKRKLRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWZ8	Chromosome 10, whole genome shotgun sequence	0.916	138-162	KFQHGAGKLKSRAHKEREAEQRKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E077	Aa_trans domain-containing protein	0.657	171-177	RSRSPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0T5	Chromosome 9, whole genome shotgun sequence	0.849	773-780	RMKRRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E151	Uncharacterized protein	0.661	1140-1152	RIRRVSSKISGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E151	Uncharacterized protein	0.606	126-126	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E774	Uncharacterized protein	0.704	505-511	RKRAKSA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAT1	Uncharacterized protein	0.985	235-334	KGGKNAKAPKAPKAPKVDKKAAAAAAAAAAAAAAPAKSVPAAKSKAGRKGASADAPKAKSKAHPYAQPEPTEDGKPAKKSKKSEDAPKPSTLKSRLKPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAT1	Uncharacterized protein	0.827	422-439	RKAGKSRKGNLKDPNAPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P5U1	JmjC domain-containing histone demethylation protein 1	0.946	650-669	RAKKAKAANGSAIKSRKARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P5U1	JmjC domain-containing histone demethylation protein 1	0.651	245-251	PKPARAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P5U1	JmjC domain-containing histone demethylation protein 1	0.614	53-54	RK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PA50	Clustered mitochondria protein homolog	0.862	1394-1404	KAKGKSKASRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PA50	Clustered mitochondria protein homolog	0.826	1010-1020	KKNSKGKKKGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PA50	Clustered mitochondria protein homolog	0.663	693-709	AKLAARQEAKAAKDAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1L3	Chromosome 12, whole genome shotgun sequence	0.891	380-393	ERNALKRKRKIEGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2T1	Uncharacterized protein	0.884	254-265	AARRPRRVKKGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8D7	Zn(2)-C6 fungal-type domain-containing protein	0.777	634-640	RKKPKRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDM7	Uncharacterized protein	0.641	109-114	RRARNR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMQ3	Uncharacterized protein	0.625	137-140	LRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CR33	Chromosome 7, whole genome shotgun sequence	0.997	717-753	KRRTAERRVERHERHRARKEKKRQRAAELEARRMRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CR33	Chromosome 7, whole genome shotgun sequence	0.823	1131-1140	GKSERKKRRI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CR33	Chromosome 7, whole genome shotgun sequence	0.624	134-138	RSKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CR33	Chromosome 7, whole genome shotgun sequence	0.624	1062-1068	RSRSPSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT37	Golgi apparatus membrane protein TVP38	0.893	396-412	RRGAVRLRPSRKRRITR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWS6	Chromosome 16, whole genome shotgun sequence	0.828	307-323	RHARDASRRRNTRVKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWS6	Chromosome 16, whole genome shotgun sequence	0.725	189-212	PKRGGGSKPNRILEAPFRRELRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXC0	Chromosome 7, whole genome shotgun sequence	0.646	139-144	RTPRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXC0	Chromosome 7, whole genome shotgun sequence	0.635	97-100	KRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1R8	Chromosome 9, whole genome shotgun sequence	0.604	292-293	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E673	Methyltransf_25 domain-containing protein	0.681	774-779	KKKKSG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3S3	Histone acetyltransferase ESA1	0.643	539-543	RPRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PFV5	DNA polymerase epsilon catalytic subunit A	0.96	1279-1297	KKKWRKQRLQRAKERKARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q99126	Chitin synthase 3	0.618	300-304	RHKTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFJ1	RRM domain-containing protein	0.715	95-99	RRRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CS44	Pheromone response factor Prf1	0.942	239-278	RGGPSKAIKRARKATRASVAARNCGKPSSPRAKRARVDKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CS44	Pheromone response factor Prf1	0.85	105-129	KRLPPSKRPGVSHAKRTPPNHIKRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CW42	RWD domain-containing protein	0.639	230-234	KKSKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSK6	Uncharacterized protein	0.999	148-176	SKKSKKDKKHKKDKKDKKNKNDKKDKSLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW15	Putative ATP-dependent RNA helicase	0.986	548-613	NPGKKDRKSLKNNAPERKHIRTSAASSVGRRQANKRKEMIAASKRRKLAEREDNDKGKAKEKVKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0J6	Chromosome 10, whole genome shotgun sequence	0.985	215-259	SRRRKRKAPNPLSVRKPKTPRLSMDDKLKREQELKKQKQRAAARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0J6	Chromosome 10, whole genome shotgun sequence	0.809	280-286	RKKRRRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Q2	Chromosome 1, whole genome shotgun sequence	0.968	403-468	KTSTKDKKDTKDKLDKKDTKDTKDKRDKKDKAKAVAPASEEQAKLQEAEKDKSSRKETRKKRTGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Q2	Chromosome 1, whole genome shotgun sequence	0.838	526-536	RPPRRKAPPKN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Q2	Chromosome 1, whole genome shotgun sequence	0.701	103-113	KEAPKAKAKVQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9R8	G-patch domain-containing protein	0.91	731-742	KKRKKDKSTKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDA3	E3 ubiquitin-protein ligase listerin	0.994	56-85	QRGQKKDKSNKDGKGGKKSKAEKKKQYVPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDA3	E3 ubiquitin-protein ligase listerin	0.761	7-26	KGKSSASSATRKKQANKAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q7Z8J6	Myosin-1	0.883	5-32	KKAGAKKAGAVSKPPPSKGASSKGGVAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q7Z8J6	Myosin-1	0.842	983-1021	PAPKKKPGLVRPITQGKLLRAGGPSNANNKPKPRAIPRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q7Z8J6	Myosin-1	0.756	1260-1282	KPVVAPKPAGSNGRAMPPPPPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVT2	Tyrosine--tRNA ligase	0.769	385-391	KKKKDKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXP5	Protein kinase domain-containing protein	0.918	166-190	KTRLRKTHRAERLRKSARSNARPHP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BY90	THO complex subunit 2 (Fragment)	0.994	1550-1655	RNDRQSDRDKTRVSERERERERERDKDRDRRERERERERERDRSARDRDRDRDRDRDRDRENERERERERERERERDKEVRDRERTRERERASSNRGRDREDRRRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BY90	THO complex subunit 2 (Fragment)	0.747	1818-1833	RDGGRDHRRDRSARRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRC9	Acetyltransferase MATC1	0.764	232-239	KKHKKNKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTF0	PHD domain-containing protein	0.989	195-241	RPAKSRPPAKKGSKRARMEAAAARRAASASGAENPPSASKPAGTKRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTF0	PHD domain-containing protein	0.734	434-471	KRSSRIAIKESEREERERDREARARMEEKMALIRKEEA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTF0	PHD domain-containing protein	0.729	516-529	RERKEKQRQDRIRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTF0	PHD domain-containing protein	0.605	473-473	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXV7	Uncharacterized protein	0.869	970-983	RSGRRKALKKARIR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CYJ0	Uncharacterized protein	0.71	149-156	GLKRGRRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZA8	Chromosome 1, whole genome shotgun sequence	0.818	316-336	RIERLRRAKNNQKMLRMRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZA8	Chromosome 1, whole genome shotgun sequence	0.684	152-161	RAQARRAARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPT2	Chromosome 19, whole genome shotgun sequence	0.798	3-10	KKRGKKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUV0	Chromosome 19, whole genome shotgun sequence	0.858	783-802	PKRAKKDAQPKDGKLAKKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUV0	Chromosome 19, whole genome shotgun sequence	0.763	109-121	RKRKKNCTKSAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVJ8	Eukaryotic translation initiation factor 4C	0.942	3-17	KNKGKGGKNRRRGKN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW86	Protein kinase domain-containing protein	0.694	8-13	KKPRKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX67	Chromosome 10, whole genome shotgun sequence	0.995	435-453	AKRRVRKKRKIGTKKLRSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYF6	Chromosome 7, whole genome shotgun sequence	0.836	233-248	RPTGERRRQERKRSGP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYZ9	Vacuolar protein sorting-associated protein 54	0.999	1760-1773	SKKNKKKKKKAKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2B2	Chromosome 8, whole genome shotgun sequence	0.992	850-885	KKREKERLKKKIRRERELERERDREWERDQAKGRQK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4N7	Uncharacterized protein	0.973	791-819	KQAAKDRYKEKRKQAKARRSEVKEAHRLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4S2	Uncharacterized protein	0.965	59-78	RRGGSAGARRRARARARAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4S2	Uncharacterized protein	0.829	303-314	KARRKAQRKAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6E5	Uncharacterized protein	0.645	542-548	KARQRRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAC9	Chromosome 1, whole genome shotgun sequence	0.775	15-27	RRSRKSPSSKARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVI7	Chromosome 21, whole genome shotgun sequence	0.929	930-942	APSKKELKKKRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXG3	Uncharacterized protein	0.982	364-391	PKRKEEERKEKEEEERKKKEEVERKKKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXT2	26S proteasome regulatory subunit RPN2	0.828	898-907	KGSKPKKERK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCQ6	FHA domain-containing protein	0.896	31-71	SRRDRDRHSYERRERKSHSHRQDRDRVARENRHGHKSSRHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFX3	Chromosome 1, whole genome shotgun sequence	0.735	157-164	KRKRGRPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFX3	Chromosome 1, whole genome shotgun sequence	0.616	236-238	RRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CN41	Chromosome 10, whole genome shotgun sequence	0.63	5-9	RDKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CN71	Chromosome 10, whole genome shotgun sequence	0.985	201-217	AKRRRMPKSKERRKRGS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNV1	Replication factor C subunit 1	0.986	928-950	KLVKKPKSGAGKAKAKVVGAKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWS4	Uncharacterized protein	0.892	124-131	KKKKRRTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRK5	Chromosome 16, whole genome shotgun sequence	0.889	283-303	KARRRRRLLQEQVRKRNSKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTT1	Chromosome 12, whole genome shotgun sequence	0.934	70-95	KKARFLRAAQRKAVSAANKGKGKRKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTT1	Chromosome 12, whole genome shotgun sequence	0.904	689-700	AKGHRGKKKRNL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW93	Condensin complex subunit 2	0.689	326-331	RKRKRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYB0	Uncharacterized protein	0.865	335-345	RRLRKRRRTGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYB0	Uncharacterized protein	0.631	464-468	RSRRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZP1	Chromosome 7, whole genome shotgun sequence	0.806	271-285	PATKARRPTPAKKIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E243	Chromosome 8, whole genome shotgun sequence	0.966	332-344	GRKRPGKRGKRLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E243	Chromosome 8, whole genome shotgun sequence	0.819	618-652	GRRPVGRPPGKGTPTRSNPYPFLERRIGPGRPKKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E249	GPI-anchored wall transfer protein 1	0.688	627-633	RRRSKPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2K0	Zn(2)-C6 fungal-type domain-containing protein	0.748	530-536	PRKRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E472	Uncharacterized protein	0.863	243-258	RSGRSKKLNKAFRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5M4	Bromo domain-containing protein	0.935	684-720	RKPSSRRTPVRRRASCTRRAKRTPPPPTREAAAAKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6M8	Peptidase_M14 domain-containing protein	0.797	305-314	RRKSRKGRNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7B6	Ribosomal 60S subunit protein L18	0.994	160-192	GFGPHKNKKPYIRSKGRKFEKARGRRASRGFKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E892	Chromosome 1, whole genome shotgun sequence	0.998	535-559	EKEAREKQKKEEKEKRKKEKRNRKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDK7	Chromosome 1, whole genome shotgun sequence	0.99	682-789	RAAKADRAAEKRRAKQEASAAAAAAALAAKEAKRNEKIKKREAKQAEAERKRDQESQARDRAIREKEEAEEHRLLAAREHEHERDRKSKARQASRRQPHGAGGPKKRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDK7	Chromosome 1, whole genome shotgun sequence	0.616	1590-1592	KPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P0C196	Peptidyl-prolyl cis-trans isomerase-like 4	0.983	504-551	RRSERSRHDRDRDRDRDRDRDREREHRRRTEDRRRHDDRQRSRDGSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PB95	Pre-mRNA-processing protein 45	0.61	233-234	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C041	Uso1_p115_head domain-containing protein	0.836	1341-1352	KRKRDKAKLRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C197	Chromosome 12, whole genome shotgun sequence	0.916	152-169	ARESGRRRRQRATKKSQA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C197	Chromosome 12, whole genome shotgun sequence	0.829	240-251	GKGRRRHRGLRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQ83	DNA mismatch repair protein	0.636	201-205	AKRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXP4	NudC domain-containing protein 1	0.973	858-878	GKTPRRAERNKRRKERTASKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXP4	NudC domain-containing protein 1	0.625	81-83	RKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQA8	Uncharacterized protein	0.998	52-78	KQMKDKKDKKDKKDKKDKKDKKGKKDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQA8	Uncharacterized protein	0.969	139-160	LKRAKLLKLKAKKAKNEESKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQA8	Uncharacterized protein	0.742	450-459	DKREAKKLKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DR22	Chromosome 16, whole genome shotgun sequence	0.989	113-135	KPKARRSRSKKAKESSRTPRRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DR22	Chromosome 16, whole genome shotgun sequence	0.949	165-179	KPSKSAKRRQKKKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DR22	Chromosome 16, whole genome shotgun sequence	0.919	205-219	PRAPRAKREPKGKPH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSI9	PH domain-containing protein	0.943	718-730	RRRSKNGKARRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSV8	HECT domain-containing protein	0.953	165-181	RPIPAKKRNGKGKGKEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUQ8	Oligopeptide transporter 1	0.675	117-124	KPKHRAGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXE6	Chromosome 7, whole genome shotgun sequence	0.808	14-20	AKKKKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYH2	Chromosome 8, whole genome shotgun sequence	0.962	220-234	RSKGKKKAKAKAEPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYH2	Chromosome 8, whole genome shotgun sequence	0.754	142-152	RKRRAPRASAP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYH2	Chromosome 8, whole genome shotgun sequence	0.647	382-389	KHQARLKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0K7	FAD-binding FR-type domain-containing protein	0.98	1037-1062	KRIRSEGKLRRAKTRRNTVKRKGGRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E175	Uncharacterized protein	0.878	100-110	RRKRPRKGIPQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1H4	Uncharacterized protein	0.935	142-156	RRKPVYRKKPRNKKF
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6Y2	Reverse transcriptase domain-containing protein	0.929	256-274	RLRAKRRRTRLLLRRRASP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9C1	Chromosome 1, whole genome shotgun sequence	0.792	658-667	AEKSRRKRQR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAT9	Telomerase reverse transcriptase	0.981	1245-1281	AKFKRQAMNKRQNSARRAPAGRGAGRGRGRGTGRSRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED80	Chromosome 1, whole genome shotgun sequence	0.789	242-261	KRGKGAEQKQKQQKKQKTNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED80	Chromosome 1, whole genome shotgun sequence	0.632	193-196	KNKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED80	Chromosome 1, whole genome shotgun sequence	0.601	89-89	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCC5	Zn(2)-C6 fungal-type domain-containing protein	0.655	63-69	KKRMGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFQ8	Uncharacterized protein	0.881	448-463	KSKPKSKSKAKSNPKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFW5	Chromosome 1, whole genome shotgun sequence	0.881	332-349	KPKSSGKNGKLRKGNKNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGQ3	Bromo domain-containing protein	0.877	797-809	KRPKKQKDKEREK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGQ3	Bromo domain-containing protein	0.845	538-554	SKHSKHRKRLSAPGTPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRJ4	Uncharacterized protein	0.679	277-283	KKSKGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DST4	Non-specific serine/threonine protein kinase	0.999	722-762	KEQAKALKKEAKKQTKQANREKRKTKMPKAEKKRRMKKNHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX97	Non-specific serine/threonine protein kinase	0.722	1014-1019	RKRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY09	Chromosome 9, whole genome shotgun sequence	0.904	310-326	AAAKRRGRPPKSSSSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY09	Chromosome 9, whole genome shotgun sequence	0.882	78-92	KRRPGRPRGSGPKQK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY09	Chromosome 9, whole genome shotgun sequence	0.673	287-293	ARQRRRQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY09	Chromosome 9, whole genome shotgun sequence	0.633	468-472	RQKRL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0F6	Chromosome 10, whole genome shotgun sequence	0.769	42-53	NRGRNRGRARSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0F6	Chromosome 10, whole genome shotgun sequence	0.747	89-99	KKKGNGRGAGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1E3	Uncharacterized protein	0.877	402-413	RRRERRRARSRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3L6	Chromosome 7, whole genome shotgun sequence	0.649	92-95	RKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PGT8	DNA damage-binding protein CMR1	0.829	43-57	TPTKPKKQATPKKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q99109	Repellent protein 1	0.924	500-545	KDTSKPTTKPEPKPQPSDKPEPKPSDKPEPKPSDKPEPKPSDKPEP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6Q0	Uncharacterized protein	0.956	24-49	KEANPDEKKETSRAGRGKAREPRKGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6Q0	Uncharacterized protein	0.886	125-143	ARTRKLGKIAGNRRRARPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C774	Uncharacterized protein	0.787	336-345	KPTRAKSKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CG36	Chromosome 1, whole genome shotgun sequence	0.956	85-100	KGPGSKSKKTIKRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CG36	Chromosome 1, whole genome shotgun sequence	0.71	25-40	ARAGPSKRNGEAAKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH09	Chromosome 19, whole genome shotgun sequence	0.829	397-410	KKRRSRLRSNPHKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH09	Chromosome 19, whole genome shotgun sequence	0.699	640-652	RGKTRKQADSRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CI28	Uncharacterized protein	0.953	468-479	HKKKGRPFKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMK5	Uncharacterized protein	0.999	389-541	KKPTYKKKKKAQREKEEAEAAAAAEAEAAKKKAEEEAAAAAAAVAAKKPKKKLTKKEREEKERKEKEEKEKAEKEEKQRKEKEAAAANGKPSKPKSKKKQKEEAASKSLAKNAPGSPDKDKKATPKKTAAKKPAAATAAASTAKKKTTAKSEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRA2	Chromosome 7, whole genome shotgun sequence	0.716	1278-1283	PRRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D097	Chromosome 1, whole genome shotgun sequence	0.876	82-109	KREAARTNELKAHDKATKKNKQVKKERA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPA2	Uncharacterized protein	0.839	714-730	KKDKERERKESEAKKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPA2	Uncharacterized protein	0.609	468-469	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPG6	Chromosome 21, whole genome shotgun sequence	0.68	119-124	RGRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU00	Chromosome 12, whole genome shotgun sequence	1	3-25	AKWRKKRMRRLRRKRRKMRARSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUA4	Zn(2)-C6 fungal-type domain-containing protein	0.898	79-88	AKKKPSKRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX39	Chromosome 15, whole genome shotgun sequence	0.968	503-523	KPRSSKESVRRRRRKEGGQRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY03	Chromosome 9, whole genome shotgun sequence	0.695	323-328	DARKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY03	Chromosome 9, whole genome shotgun sequence	0.667	373-378	GKKAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYM2	Uncharacterized protein	0.604	8-8	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZJ5	Uncharacterized protein	0.642	2087-2090	KKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZJ5	Uncharacterized protein	0.632	2236-2238	KRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3J7	Chromosome 7, whole genome shotgun sequence	0.904	345-374	RHRKRAGMPPFVVQSRPEKKRRLSAKSARS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7L4	Peroxin/Ferlin domain-containing protein	0.619	624-627	RRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAB9	Chromosome 1, whole genome shotgun sequence	0.76	70-88	RRRLEAHHSSRAKQRKSNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EB32	Non-specific serine/threonine protein kinase	0.697	119-127	KKDKHSRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EB32	Non-specific serine/threonine protein kinase	0.657	289-294	RKPPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED87	Chromosome 1, whole genome shotgun sequence	0.964	12-39	KPARRAVPGAPPLPPAKPGKKSKGGAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED87	Chromosome 1, whole genome shotgun sequence	0.634	457-460	KKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P6D5	SWR1-complex protein 5	0.73	267-274	RPTPRRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVX8	Uncharacterized protein	0.972	42-71	KKPAQVKKKAVVKKKATHSGPRSTGGRRKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXN9	Ribosome biogenesis regulatory protein	0.861	101-129	PREKSMPKPKPLTKWEKFAKQKGIQSRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXN9	Ribosome biogenesis regulatory protein	0.834	176-190	AKKERLAKKQKNEKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXN9	Ribosome biogenesis regulatory protein	0.696	334-341	KRGKRASK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1M4	Chromosome 12, whole genome shotgun sequence	0.876	588-608	RTSKGKAKKEADRANVKTKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1M4	Chromosome 12, whole genome shotgun sequence	0.872	542-561	RRRRKGTISKKNESEGAKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8F2	Uncharacterized protein	0.972	689-708	ERRRRMKRKNEKKQPDVAKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8F2	Uncharacterized protein	0.839	949-959	GSRRPRKRIGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8F2	Uncharacterized protein	0.73	1324-1329	RRKKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8F2	Uncharacterized protein	0.615	1732-1733	RK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAQ0	Uncharacterized protein	0.992	424-448	RRSSRKSAPTPKKQREKGKGKGKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAQ0	Uncharacterized protein	0.838	352-360	APRRKKPKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAU0	DUF4110 domain-containing protein	0.992	385-399	KRPKKKGGAGRRKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAU0	DUF4110 domain-containing protein	0.983	3-38	KKGKTSAGKAAAKAAKKEKAEKQATRKLTKQAAKQK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF89	Chromosome 23, whole genome shotgun sequence	0.67	173-178	RAGRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTQ3	Zn(2)-C6 fungal-type domain-containing protein	0.701	238-245	AAKTRKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DNQ1	Transcription initiation factor TFIID subunit 8	0.713	679-688	RSVKRMRKWK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DNQ1	Transcription initiation factor TFIID subunit 8	0.652	292-306	KRKHDIARVLSKKQR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSB7	Chromosome 15, whole genome shotgun sequence	0.916	452-464	RERKRAHRKKDPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSB7	Chromosome 15, whole genome shotgun sequence	0.775	642-658	KHKKERSKPYDGNRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTG6	Uncharacterized protein	0.685	1306-1311	RRKARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTG6	Uncharacterized protein	0.663	11-20	AKARRSSIGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTG6	Uncharacterized protein	0.646	278-283	KRTKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTG6	Uncharacterized protein	0.616	22-26	SHKNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTG6	Uncharacterized protein	0.603	81-81	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTI0	Chromosome 21, whole genome shotgun sequence	0.892	327-349	EERKRESKALQASSKRNKAAKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTI0	Chromosome 21, whole genome shotgun sequence	0.715	602-610	GKRERGRER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXA1	Chromosome 10, whole genome shotgun sequence	0.945	247-262	QGKRKKRNAKLAAAPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZE7	Putative type I HSP40 co-chaperone YDJ1	0.732	104-112	RPRGPRKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZE7	Putative type I HSP40 co-chaperone YDJ1	0.647	27-30	RKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0S8	CBF domain-containing protein	0.832	335-342	KKMKKKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0S8	CBF domain-containing protein	0.752	408-418	AARSAAARKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0S8	CBF domain-containing protein	0.625	827-829	AKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBE6	Chromosome 1, whole genome shotgun sequence	0.868	707-714	PKKKRKRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBE6	Chromosome 1, whole genome shotgun sequence	0.635	854-856	KKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EE20	Chromosome 1, whole genome shotgun sequence	0.911	957-972	RRRHRRRSSGPRSLRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EE20	Chromosome 1, whole genome shotgun sequence	0.83	1010-1025	ARRGRGGRGRASSPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EE20	Chromosome 1, whole genome shotgun sequence	0.659	310-315	RRRPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA28	Uncharacterized protein	0.983	1388-1428	RSRAKASRAKIGVAASTPAKRAGKRLGAAPASKPAAAKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA28	Uncharacterized protein	0.932	316-350	AVKKPVAKRKRTDNSPPEKSLASPNRPVAKKPRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA28	Uncharacterized protein	0.894	697-713	APLPPKKKLGRPTKAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA28	Uncharacterized protein	0.805	19-27	KIRKRRRGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA28	Uncharacterized protein	0.713	644-651	PKKKLGRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA28	Uncharacterized protein	0.703	236-243	RARSRRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA28	Uncharacterized protein	0.62	550-553	RGRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFV4	Chromosome 21, whole genome shotgun sequence	0.607	228-228	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQ64	Chromosome 8, whole genome shotgun sequence	0.739	159-171	KKRIHKRAVLRHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZY4	Chromosome 1, whole genome shotgun sequence	0.849	397-410	QRRRRNKATKAARP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTF6	Chromosome 15, whole genome shotgun sequence	0.999	100-174	LKKRDKARERKMDKAREQSRKKLIETVDGRDKIITNKMGSKRGAGRRKRQRALKKGLALRKEKSKEAKRKVQAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0I0	Uncharacterized protein	0.846	137-151	RPLAHKKSAERRRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E135	Lipase_3 domain-containing protein	0.85	520-540	RRMREREKARKQAEKLAARNR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E135	Lipase_3 domain-containing protein	0.715	226-234	RRRRSQRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1Z3	Uncharacterized protein	0.915	976-989	RGHKRGKQKGKGKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4I7	HDAC_interact domain-containing protein	0.975	384-418	GAPSSGSRKKRSGANESGKPSSGKTKKSKHGHKAE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4I7	HDAC_interact domain-containing protein	0.666	906-912	RRGKKQA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5R3	Uncharacterized protein	0.998	865-907	RRRKVGEQIGKLKRRKIAKTRPKKTPPPKKDEKKDEKDQKDQK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6A9	Uncharacterized protein	0.802	120-130	RRRKATSKKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6X5	Chromosome 1, whole genome shotgun sequence	0.996	233-301	RSSRRHRSHQNDRSSRSRSRSRSPESLSRHRSRHHDERRHKRRGSPSGAGRGHRGEDEKHHHAPHSRRY
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6X5	Chromosome 1, whole genome shotgun sequence	0.758	198-213	HRRHRHRDGSSRHRDG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6X5	Chromosome 1, whole genome shotgun sequence	0.671	156-160	VRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E768	Chromosome 1, whole genome shotgun sequence	0.977	27-68	KMKRTELYRKYKADKRKTKLAKRSAQAKEERGEDGAAKKAAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1X1	C2H2-type domain-containing protein	0.657	542-546	RRRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGA9	Chromosome 1, whole genome shotgun sequence	0.964	117-136	RGGHNKAKKQRTRKKRWNFK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHQ9	BHLH domain-containing protein	0.994	289-307	GKPKRKRNRKKPDTKKPGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHQ9	BHLH domain-containing protein	0.801	215-237	PKRTARDSKRRATHSQIERRRRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMD9	RRM domain-containing protein	0.855	64-77	KKTAGVPKKKTKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMD9	RRM domain-containing protein	0.841	329-355	KKQSKKAMSAKAKPTATKSTKGKTAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CT21	Uncharacterized protein	0.824	48-56	ARRRRARRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVZ5	Uncharacterized protein	0.875	720-734	ARRRRRSIGLGHKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWU1	HSac2 domain-containing protein	0.607	328-329	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DNV2	Chromosome 23, whole genome shotgun sequence	0.829	3-12	RRRPRTRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1B1	Zn(2)-C6 fungal-type domain-containing protein	0.773	97-103	RKKKRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3C2	Uncharacterized protein	0.991	277-427	ERRARKRAERDRLVLEAREREREAEAKAHAEREARRLAREQAEKKEAERKRLQHEEAQRRRIEAQKAAAEERERKEREAEQRRAKRKQQAEERRIREEQEAQERRKHEEQEAIRKAEERAKRQEEKRLAAIERKKREEEEAIRRAEEEVRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8D0	Chromosome 1, whole genome shotgun sequence	0.962	90-140	ARSRSRSRDSARSRRSHLSRKSSSRADEEAEERRKRRRGQDLHLRDRDRDR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8D0	Chromosome 1, whole genome shotgun sequence	0.886	147-159	ERARERRRRRTDR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8D0	Chromosome 1, whole genome shotgun sequence	0.838	204-223	RRRRRYDDDARRAAPRRRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PA45	Protein BCP1	0.995	228-253	GARKRKAKLARREAKKAGAKKDAPKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFS9	Chromosome 1, whole genome shotgun sequence	0.88	1026-1039	RKKNRLPPRARKQR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZP5	Chromosome 1, whole genome shotgun sequence	0.976	568-623	PAKPVKEKNRMRGKNKALSRYLRKKRENVVDPNRIAVKARMEKMRKEEQQARKRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ81	Uncharacterized protein	0.989	306-340	KSKPSPQKQPKVVKKPKKVLGKRKYREIGPMERRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQH3	Non-specific serine/threonine protein kinase	0.992	576-610	RAKASRRTEKHHGRKAHAGKGGRAHPGGKAKTGKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQH3	Non-specific serine/threonine protein kinase	0.641	538-542	RKAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX31	Chromosome 15, whole genome shotgun sequence	0.951	237-253	KKKLSAAFRPRGRKKRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX45	40S ribosomal protein S26	0.809	87-108	RSREGRRSRLPPPRVRYNKDGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX45	40S ribosomal protein S26	0.691	4-12	KRRSGGRNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXW8	Uncharacterized protein	0.802	408-418	KPGKKKSKDEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY49	Chromosome 9, whole genome shotgun sequence	0.996	501-562	KQADRQKKRQDNIAARKAAKGGKHKKGASSTLSKSKTPAGKKPSFAKARPGFEGKKIGRSTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY49	Chromosome 9, whole genome shotgun sequence	0.984	289-320	RRRQRFDARERKKQEKKDAKAAAKAAIKAKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY49	Chromosome 9, whole genome shotgun sequence	0.977	111-137	KNKRKKAKSEIEAKQRKDKLREAKKQR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY49	Chromosome 9, whole genome shotgun sequence	0.966	471-491	KLLKKAAKRKDKQKEKSSKTW
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYD7	Chromosome 7, whole genome shotgun sequence	0.808	466-479	KAAKFNKKFGKRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYD7	Chromosome 7, whole genome shotgun sequence	0.668	531-536	RIKPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYD7	Chromosome 7, whole genome shotgun sequence	0.619	96-98	KRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZR7	Chromosome 7, whole genome shotgun sequence	0.806	136-166	RKRGPPSKKERAILEAAGIIFRGTRPHRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1N4	Chromosome 9, whole genome shotgun sequence	0.939	619-626	KKKKKKRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1N4	Chromosome 9, whole genome shotgun sequence	0.604	124-124	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2W4	Chromosome 7, whole genome shotgun sequence	0.776	373-388	RRERNKASQRESRKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3Q8	Uncharacterized protein	0.99	99-134	RHDRDKDHRSDRSSKRRETSEERRVRKAAKRAKKLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3Q8	Uncharacterized protein	0.819	49-71	PDRRKRHRQDDDSKRSRSSRAHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3Q8	Uncharacterized protein	0.788	176-191	KWGKKEEKERKQGLSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5A8	Uncharacterized protein	0.667	195-199	RRRRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5H6	Uncharacterized protein	0.709	739-747	QRNKRGRPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E634	OTU domain-containing protein	0.967	531-575	KRGRGRPRKDGLPNKSTIAIKRRVPTAREKRDAAQARKRERQLEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E634	OTU domain-containing protein	0.789	196-209	RKQKRDEAKRDKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P7X6	Transcription factor IWS1	0.936	119-126	RKKKKKRH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P7X6	Transcription factor IWS1	0.922	173-183	RAGKKKAPRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI72	Pre-mRNA-splicing factor CWC26	0.912	33-42	KVKRKKKKVK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI72	Pre-mRNA-splicing factor CWC26	0.637	150-153	ERKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDP8	AAA domain-containing protein	0.98	404-435	NKSTRGKPKIRGHDRRKRWEEVRELRKEYRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDP8	AAA domain-containing protein	0.636	519-522	KRSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGG6	Chromosome 1, whole genome shotgun sequence	0.867	584-594	RKKPRKSLKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CM13	Chromosome 12, whole genome shotgun sequence	0.647	223-227	RIKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNC6	Chromosome 10, whole genome shotgun sequence	0.984	926-961	AKKKRAAKRGQDSRAKTSQSRPKESASKRRKREEAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNC6	Chromosome 10, whole genome shotgun sequence	0.914	1821-1850	GGGWGGRGRARGGGRGGHLEGGGRGRGGWM
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNC6	Chromosome 10, whole genome shotgun sequence	0.849	263-276	RGGKQRRGPKASRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNC6	Chromosome 10, whole genome shotgun sequence	0.849	823-843	KARRSAEMAPKSKSATKRKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNC6	Chromosome 10, whole genome shotgun sequence	0.617	872-874	KRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPX3	Chromatin modification-related protein	0.952	600-618	RTARKRKPKPLSPQKGGRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPX3	Chromatin modification-related protein	0.861	712-732	RVPPNAKHKPPGFRKGIGIKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRW9	Uncharacterized protein	0.708	760-765	RRKKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRW9	Uncharacterized protein	0.616	806-809	KIKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVV6	DNA helicase	0.931	724-738	RSGRPARGRRRGRGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVV6	DNA helicase	0.637	684-688	IHKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZR4	Chromosome 1, whole genome shotgun sequence	0.95	39-107	SPERKATSSKRRTSRSATPDEPAEARKSSRIASGSRPRSYRERDLLPSIARPKTTKEKKPRQGTRRSSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1W1	Chromosome 1, whole genome shotgun sequence	0.764	915-924	PPRALKRRPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ56	Uncharacterized protein	0.759	738-759	KARWKDKAKQANKLWRHSEREK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTC4	Putative carbamoyl-phosphate synthase (Glutamine-hydrolyzing)	0.628	1084-1089	PVKDKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTC4	Putative carbamoyl-phosphate synthase (Glutamine-hydrolyzing)	0.604	1082-1082	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUY8	Ribosomal protein L15	0.912	63-78	RIRVRRGNRKKPVPKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUY8	Ribosomal protein L15	0.835	162-189	RGLTATGKKSRGQGKGHRYNKTQGGGKN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUY8	Ribosomal protein L15	0.658	156-160	HKRRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWW4	Uncharacterized protein	0.983	4-36	PSHKSKRKLVKKIKSRSDLSGRNPKSNKNKKWK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXR6	Chromosome 9, whole genome shotgun sequence	0.77	324-334	AKAPRSHRKRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYM0	Ribosomal 40S subunit protein S24	0.999	98-134	AEKTEKASRKLRKERKNRAKKVRGVKKTKAGEAAKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZT5	Chromosome 7, whole genome shotgun sequence	0.644	144-153	DKDKDKDKDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2F8	Chromosome 8, whole genome shotgun sequence	0.6	360-360	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EA23	Chromosome 1, whole genome shotgun sequence	0.783	546-556	RRRRRVGKARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUQ5	rRNA-processing protein	0.986	28-107	KKKTTPWEKKMEQRRKQDSIKQREREMKAEKESEAERKKQVTRERKQMAEEKARLEIMAQKMSAKRLARKKRRLGITKKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYB7	Chromosome 16, whole genome shotgun sequence	0.994	1225-1242	GARPAKPHRPPKKKKRAS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYB7	Chromosome 16, whole genome shotgun sequence	0.622	1085-1089	RSRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRW1	Cep57_MT_bd domain-containing protein	0.611	923-925	RKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXP1	Zn(2)-C6 fungal-type domain-containing protein	0.924	94-107	RERKRRNKEKKAAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1S1	Chromosome 1, whole genome shotgun sequence	0.693	152-160	KPLRPKPGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPM5	Protein MAK16	0.94	139-161	IKKKTERRERGRESKALKAARLE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPM5	Protein MAK16	0.932	290-317	AKKRKGASTASSSFKKPHLNKKRAKNGP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQC8	DUF155 domain-containing protein	0.985	721-736	KERRTRKVKLRRRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU58	Uncharacterized protein	0.696	312-320	RRKNSKGNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXT5	Zn(2)-C6 fungal-type domain-containing protein	0.858	38-45	ERKPKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3Y5	Uncharacterized protein	0.996	507-552	RAGAGGKKERKRERVIAGAKDERRSKKKRNTHLGRDRAGSSSRRRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E492	DNA-directed RNA polymerase subunit	0.976	1219-1230	ADKKKKSKKRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4M7	Uncharacterized protein	0.916	41-51	KAARKKRKAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4M7	Uncharacterized protein	0.785	398-415	EPKHGVRRSSRRAISSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4Z2	PWI domain-containing protein	0.964	256-276	RHPPPRSPSPPPRRRRRSPSP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4Z2	PWI domain-containing protein	0.748	128-152	KEELRLKREEGERVVREARERARRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6T2	Histone acetyltransferase GCN5	0.709	194-207	RKRKLRDSSRSRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8E7	B-related factor 1	0.95	653-669	RRGRRGRKGASASKKSN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8E7	B-related factor 1	0.893	615-632	KGSIRKAASGAKSRKRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8E7	B-related factor 1	0.855	556-565	PYKRKKPKAP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8E7	B-related factor 1	0.809	308-315	IVKKKRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PE51	Vacuolar membrane-associated protein IML1	0.758	1542-1547	GKKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3G4	Chromosome 10, whole genome shotgun sequence	0.799	278-287	KAKPKPKRNH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3G4	Chromosome 10, whole genome shotgun sequence	0.657	252-256	RPKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJD1	Chromosome 16, whole genome shotgun sequence	0.833	58-64	KRKRRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CU96	CP-type G domain-containing protein	0.96	676-689	ARRKMKKLKKRADR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY95	Protein kinase domain-containing protein	0.966	275-308	KPTKKPKHANDPRAVTKKKQPKSVKPHTAKSRSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTL3	Chromosome 15, whole genome shotgun sequence	0.875	417-442	AKDHNRKRSALRRGWGRTKSVEGWRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX17	Chromosome 15, whole genome shotgun sequence	0.706	334-340	RRKQKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ74	Uncharacterized protein	0.96	708-760	KRDSERKRKTKLNKKMAAGREKMFDPSTGQWRSKRSMRDNPQGKRPGRPKGSF
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ74	Uncharacterized protein	0.944	283-302	PRSRRKAHKARDRAIPPKTA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ74	Uncharacterized protein	0.668	1261-1269	EKEKEKEKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0R2	Uncharacterized protein	0.778	255-266	KKRKGESKVKIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0R2	Uncharacterized protein	0.684	434-439	KRTKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E140	DUF155 domain-containing protein	0.666	127-135	RRLTKRSRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1Q9	Chromosome 9, whole genome shotgun sequence	0.747	251-261	RRIHRKSKTSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2B0	Uncharacterized protein	0.889	849-868	KRKGRASKPKSSSTAATKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2B0	Uncharacterized protein	0.855	970-976	KKKKRKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3J1	Uncharacterized protein	0.994	242-284	KRRLDKDNSKRGSRKKKRSAETAKEYIVRKKELNRKRGKEDVP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3J1	Uncharacterized protein	0.729	288-296	RYTGRRRKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4B9	Uncharacterized protein	0.962	475-488	GKSKKQKKQAKKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4B9	Uncharacterized protein	0.863	875-889	GWKGKKGSKGKLSGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4B9	Uncharacterized protein	0.721	927-932	KKARRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4B9	Uncharacterized protein	0.673	249-260	KRLMEKENKRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N7	Uncharacterized protein	0.975	1246-1268	KKERKRIEKEEKERKKAEKAEYK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5P2	IPPc domain-containing protein	0.969	322-341	KQKKRAAKEKSKPFKSKEKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5P2	IPPc domain-containing protein	0.727	1407-1418	AKRKASAPRSEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6S3	PX domain-containing protein	0.911	993-1005	KSRKRRKIPAPKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Y7	Chromosome 1, whole genome shotgun sequence	0.926	357-372	AKQLPKRKRGEPAKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Y7	Chromosome 1, whole genome shotgun sequence	0.877	256-290	KPRKRSRMTKGTADERPAVSAPSGASSKRPKKAKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Y7	Chromosome 1, whole genome shotgun sequence	0.697	186-191	AKRKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Y7	Chromosome 1, whole genome shotgun sequence	0.662	308-315	NKPERPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P9E5	ATP-dependent rRNA helicase SPB4	0.983	652-687	RAKNKRKLEREKGAWSAQKERKQARLANREKRARKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BV26	Chromosome 21, whole genome shotgun sequence	0.975	485-536	KSAKAGKASKDAKPDKKSSKKGAEAAGGAAAGAAAATAGAVGLKRSKSKKKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BV26	Chromosome 21, whole genome shotgun sequence	0.77	569-587	KPKRSASTNKNLARKPSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5Y2	Chromosome 7, whole genome shotgun sequence	0.892	136-148	KAYKRSRKPRKVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6V3	Ribosome biogenesis protein NSA1	0.83	239-251	QRKRKRQLEAKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.994	570-598	AAALANRAAGKGKGKGKGKGAGRGKMPTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.979	878-892	AKAKPAKPKTKKKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.935	643-668	GKHPAKGAKGQKSTKSAKAGKAKIAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.933	505-533	RRRSSVAAGRGKLDPPKRRLVLKPKSKVG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.914	1734-1745	KKGTSGKKKKKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.718	732-742	KRAKAAKARAD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.689	702-706	RKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJZ1	Chromosome 15, whole genome shotgun sequence	0.603	567-567	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMH6	Uncharacterized protein	0.868	407-426	KREQRKLRRQRRAAEQQDKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMR6	Uncharacterized protein	0.981	167-196	KSGEKASPSKKRSRRRSPSPPEAAAPAPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CU52	BHLH domain-containing protein	0.995	273-298	KERTKRHKARSKKERDRTKPRYRPKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CU52	BHLH domain-containing protein	0.849	364-372	KSRSKKRHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWF4	IPPc domain-containing protein	0.632	395-399	KKTKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY03	Velvet complex subunit umv2	0.747	441-450	RNDKKKQRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZG8	Chromosome 1, whole genome shotgun sequence	0.642	61-63	RKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRJ1	Chromosome 16, whole genome shotgun sequence	0.988	1383-1401	GKRLLHKPVKKRRKSRIKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRZ0	Amb_all domain-containing protein	0.687	291-296	RHRKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS97	Ribosomal protein	0.714	93-103	NKNKKLVKKLA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUL6	Uncharacterized protein	0.875	1184-1198	KRLGIKGKNKKGGKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUL6	Uncharacterized protein	0.714	196-205	RRRNRRLRDA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ56	Uncharacterized protein	0.817	188-207	RRRKEEGRDTAKGVKKRLGW
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1G4	Chromosome 9, whole genome shotgun sequence	0.959	67-88	PKKRGPPKGSTRGGSKAARRKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E485	RING-type domain-containing protein	0.931	627-644	RQRRNRRRDKERREDRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E485	RING-type domain-containing protein	0.858	898-918	KPKRVKKKLILTGGGGGRGSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAG2	40S ribosomal protein S6	0.879	171-206	AKPYTKAPKIQRLVTAQRLQRKRHLRSLKIRKAEAQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAG2	40S ribosomal protein S6	0.83	220-240	RVAEKKQEVAAHKAARKSAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAG2	40S ribosomal protein S6	0.65	91-94	ERKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P9P3	ATP-dependent RNA helicase DRS1	0.959	833-919	KYAGLSRKKRRSKMMRQEIERERKDASGSAGAKTASGGGMDAGIRAAKKAQRPTKLGVAPLKLANKSKGKQSGRNARPSATGGSKTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P9P3	ATP-dependent RNA helicase DRS1	0.797	96-105	NQRKRKEKAH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUD7	Chromosome 23, whole genome shotgun sequence	0.73	684-690	KPRRRRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C268	Nuclear pore membrane protein	0.636	353-357	ERRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3D9	Chromosome 10, whole genome shotgun sequence	0.826	181-193	RRRHSGKGKNKRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CBD8	Uncharacterized protein	0.992	97-113	GKRKRKRKRTQKNKTKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CBD8	Uncharacterized protein	0.972	20-34	NKPKRTRKRMRNKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCM1	Uncharacterized protein	0.887	256-277	RYRKPSKTGPKSIKGNKARHLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDH0	Fork-head domain-containing protein	0.978	337-355	RRRLKLKKHKLRQRRQRER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDH0	Fork-head domain-containing protein	0.92	1369-1378	KKRNKAKRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGN3	Chromosome 1, whole genome shotgun sequence	0.744	30-38	PPPKRRNRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGT8	Chromosome 1, whole genome shotgun sequence	0.952	135-152	LRWKKRLARKEKLARKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHI6	Chromosome 19, whole genome shotgun sequence	0.999	400-443	SKTRRVKQTPKATPAPKKKHKSTAINKKKHRRPTKVQRKKRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJM6	Chromosome 15, whole genome shotgun sequence (Fragment)	0.811	5-18	RRPPPPRTPRKPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMZ9	DNA helicase	0.709	926-935	QKRADKAKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNN3	Chromosome 10, whole genome shotgun sequence	0.891	152-168	RSRKHAEQKRAKARREK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPQ2	Chromosome 19, whole genome shotgun sequence	0.971	195-225	AKSRKKKLPGQTDAKSAKLSELRKKRKEKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPQ2	Chromosome 19, whole genome shotgun sequence	0.891	143-163	KAAAGATRKAASKKRVVRGGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPQ2	Chromosome 19, whole genome shotgun sequence	0.656	421-426	GKLPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPR7	Ribosome biogenesis protein RLP24	0.879	40-58	FKLKRNPRKVRWTKAFRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSS9	Chromosome 16, whole genome shotgun sequence	0.653	183-186	RKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSS9	Chromosome 16, whole genome shotgun sequence	0.648	81-84	RKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUN6	Uncharacterized protein	0.945	179-199	KGSRRQQKKQAKREAKKLTAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVE3	Chromosome 10, whole genome shotgun sequence	0.996	614-633	VRRAKARKKGNKKRNSKAKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWS5	Chromosome 8, whole genome shotgun sequence	0.856	459-466	KRRRRPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZL1	Uncharacterized protein	0.821	1717-1727	SKIRKKRNVKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZL1	Uncharacterized protein	0.612	1268-1269	KR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4B1	Uncharacterized protein	0.765	537-545	RKRKERKIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5B1	Enhancer of polycomb-like protein	0.713	461-465	KKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5B1	Enhancer of polycomb-like protein	0.609	581-582	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P328	Helicase SWR1	0.876	428-450	RKGDAKRARLSSTPHKRHRAKVQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P328	Helicase SWR1	0.668	456-465	APVKRTGPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PA36	Vacuolar fusion protein MON1	0.995	302-316	SRRKRRREKRRRQRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6W5	Uncharacterized protein	0.694	65-74	RRKNKASADK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6W5	Uncharacterized protein	0.666	182-186	RRRRV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6W5	Uncharacterized protein	0.617	196-200	RERER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8Q3	Uncharacterized protein	0.977	21-52	KRRREHQKKRKVIERSVVAKKQKQLRSTGKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CK59	Uncharacterized protein	0.697	58-65	RQPKKHRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CK59	Uncharacterized protein	0.626	598-603	KREAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZN0	Chromosome 1, whole genome shotgun sequence	0.936	193-206	HRRSDRRPLRRRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTD9	Uncharacterized protein	0.605	710-711	KR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTT6	Chromosome 21, whole genome shotgun sequence	0.962	434-458	REKERQEELKAKKEKAKAEKEKRDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUV7	Uncharacterized protein	0.814	1422-1439	GKNGKVRRASASRHGKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUV7	Uncharacterized protein	0.787	1100-1110	ERRARAAAKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX1	Chromosome 12, whole genome shotgun sequence	0.892	228-289	HHKEVTHKKQPAHSHKDAVHKHDKEGEKKHQSHKQHPAEHHKKTAPSDGKLTERANEPKKHS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX1	Chromosome 12, whole genome shotgun sequence	0.813	294-317	NSKTKKGPAAHKDSDGKRNKSDHS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX1	Chromosome 12, whole genome shotgun sequence	0.791	101-118	PQKRDAQAKPPKASDKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX1	Chromosome 12, whole genome shotgun sequence	0.659	345-351	AKQNKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX1	Chromosome 12, whole genome shotgun sequence	0.645	321-329	NKHKQGEKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX4	Chromosome 7, whole genome shotgun sequence	0.968	209-221	RPKPKKRRRIIRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX4	Chromosome 7, whole genome shotgun sequence	0.898	794-817	SSKGKGGKPNGGASKRSKDAAGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYX4	Chromosome 7, whole genome shotgun sequence	0.783	100-107	KRERRRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZI7	Chromosome 7, whole genome shotgun sequence	0.794	108-118	KAKAKRAKEKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4S4	Uncharacterized protein	0.867	392-410	PRKRGRKPFLQPGEAQRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4S4	Uncharacterized protein	0.604	354-355	RK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8V4	Chromosome 1, whole genome shotgun sequence	0.679	147-151	KRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P4G8	NKAP family protein UM04995	0.996	257-331	REKRKRHRDSSSRHRDKDKDKDRDKDKGKRDRKHSSSDKHHSSSRSHRHHSSTSRRRRSSRHSEDDKASRHRHTR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P4G8	NKAP family protein UM04995	0.954	385-412	SSRHRRRHHKSDRSSTHRRRESEKRHRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P4G8	NKAP family protein UM04995	0.631	355-359	RKSKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0H2	Putative mitochondrial 54S ribosomal protein	0.974	71-92	ARLTRKERRTAVKKQRKEAKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0H2	Putative mitochondrial 54S ribosomal protein	0.97	417-467	GRGKSKSNMHPRSIYGHLTKGARTRKPGTRGGNQMVIRERPRRNGKRLGKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0H2	Putative mitochondrial 54S ribosomal protein	0.881	385-403	RRLGKAGRSRWLGRRPKVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0H2	Putative mitochondrial 54S ribosomal protein	0.641	170-176	RGGGHRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF85	Chromosome 1, whole genome shotgun sequence	0.669	823-829	KRKGARM
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFB4	Chromosome 1, whole genome shotgun sequence	0.87	135-143	KKKRKRVVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFD5	Chromosome 23, whole genome shotgun sequence	0.695	193-205	KPTSKPTANKRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFD5	Chromosome 23, whole genome shotgun sequence	0.682	231-239	AKTAKGGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CG54	tRNA(His) guanylyltransferase	0.904	262-284	RIKNESRRVAAKQAKKQEKKDKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMM9	Mitochondrial DNA polymerase catalytic subunit	0.862	387-400	IKHNKAKAEKRAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMM9	Mitochondrial DNA polymerase catalytic subunit	0.804	1881-1890	RARRAKKRVH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMM9	Mitochondrial DNA polymerase catalytic subunit	0.603	959-959	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWE1	Phosphoinositide phospholipase C	0.713	300-309	KNKAKRNEAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXI3	Nucleolar GTP-binding protein 2	0.99	699-736	VKNKSRRGKPDAAEPKSKERGPKVGANGKGATQPRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXI3	Nucleolar GTP-binding protein 2	0.843	674-690	RRKQKKAPRMTTSKRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DNU2	Zn(2)-C6 fungal-type domain-containing protein	0.64	319-324	RRAKFK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP95	Ribosome biogenesis protein NOP53	0.935	294-321	KRKTRAQRARAKRAHQQQAEAARRKQAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP95	Ribosome biogenesis protein NOP53	0.744	424-429	TKRRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP95	Ribosome biogenesis protein NOP53	0.636	23-26	KGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQV1	Chromosome 19, whole genome shotgun sequence	0.735	566-572	RTKRRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DR12	Chromosome 19, whole genome shotgun sequence	0.75	166-180	RVRPIPPRRVRHPVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT94	Chitinase	0.828	91-121	RKRRAVPSARLLARQRPSRLGTGSSRKTKRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWA4	Zn(2)-C6 fungal-type domain-containing protein	0.636	66-68	KRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4I0	WD_REPEATS_REGION domain-containing protein	0.72	529-546	KGRKQRLKATVAVGRGRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6Z6	Chromosome 1, whole genome shotgun sequence	0.72	283-295	KHLKKRLNDPKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E983	Chromosome 1, whole genome shotgun sequence	0.621	483-486	RRIR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EC53	Tubulin-specific chaperone D	0.686	336-342	RPRNRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2C3	Uncharacterized protein	0.715	404-422	KRTEKVAQPKAKVRQGPGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQA5	Chromosome 8, whole genome shotgun sequence	0.96	638-654	SKPSKRARLKRKLKGTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQK6	Chromosome 7, whole genome shotgun sequence	0.968	118-150	NRRWAAKLEKQKAKRLAREQAKKEREAAAAKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTS1	WD_REPEATS_REGION domain-containing protein	0.686	936-940	KKKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DNX2	Putative TOM complex protein import receptor	0.992	93-106	NKKKKKKATKKKPT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQX7	eIF-2B GDP-GTP exchange factor subunit epsilon	0.818	160-165	KRRRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXH3	Uncharacterized protein	0.687	31-38	DGRARREK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXX8	G-patch domain-containing protein	0.999	127-173	GKKSKKTKKEKKDKKDKKDKKDKKDKKDKKDKKDRSKDESSKKKRKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXX8	G-patch domain-containing protein	0.996	322-342	FKKKKDKKDKKQEKGAKKSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXX8	G-patch domain-containing protein	0.669	185-189	KKSKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYK0	Phospholipid-transporting ATPase	0.669	1475-1483	KKSLRKNKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ61	MFS domain-containing protein	0.73	200-208	EKKERRHAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ85	Chromosome 7, whole genome shotgun sequence	0.999	69-135	PKKEAINKGERKDPSEAVGTPKKRKADAKDDGAKSESKEKSKKPRTKKEPKPATKGTREQPKRGAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ85	Chromosome 7, whole genome shotgun sequence	0.701	11-19	PKKREEAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZY1	Condensin complex subunit 1	0.967	577-599	RNRHSSKKSKDKAQHSKPKKARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZY1	Condensin complex subunit 1	0.802	1379-1397	KLTRARKSGKPSNAAAAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0T2	Uncharacterized protein	0.998	172-205	PGPSRQKPPPLDVRIKAKARRAKRKRQKAEHRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E555	Uncharacterized protein	0.757	51-63	RGKLRIKRAGIRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E555	Uncharacterized protein	0.638	837-843	VKRVRIG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E555	Uncharacterized protein	0.609	846-847	KP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E769	Uncharacterized protein	0.798	3-10	KKRGKKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E905	Chromosome 1, whole genome shotgun sequence	0.996	388-408	LERKRKREERKRRKLEKQKHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Z2	PH domain-containing protein	0.765	36-41	KKKRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P358	Eukaryotic translation initiation factor 3 subunit A	0.704	797-811	KERRRQQVRDERRRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P358	Eukaryotic translation initiation factor 3 subunit A	0.649	785-788	RRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P358	Eukaryotic translation initiation factor 3 subunit A	0.612	612-617	RAERAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P6I3	Pre-mRNA-splicing factor CWC25	0.994	177-222	ERRRSKEEKRRRHDRDEHRRRGSRHGESRSESRSHSRRDDRDRKSS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZF5	Chromosome 15, whole genome shotgun sequence	0.995	207-226	PKKKKKKKSQRARDAEKAKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZF5	Chromosome 15, whole genome shotgun sequence	0.968	319-362	KQEGPKGKRKHGNKGGANDNEKRHEKEGLSKQASKSESNRRESG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZF5	Chromosome 15, whole genome shotgun sequence	0.792	454-474	RERQGDRRDDHRRDKGRERDR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0I4	Uncharacterized protein	0.983	144-182	KRAQKVARPIYREAHKRGRLLWKKRIDPARRRTIKSARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C890	Na_H_Exchanger domain-containing protein	0.714	599-606	PRRRGRPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CI18	Uncharacterized protein	0.848	28-39	KRGRGRPPKNRD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIC7	Glutamyl-tRNA synthetase	0.962	725-755	KKHAAQKARAEKAAAKAKKQQEKADKTKAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIC7	Glutamyl-tRNA synthetase	0.69	530-541	PKRHTKEMPRHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNG8	Chromosome 10, whole genome shotgun sequence	0.913	173-192	KKRKDEEKRKVAEDRKKVRQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNG8	Chromosome 10, whole genome shotgun sequence	0.683	133-142	LPRKERLRLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPH3	Chromosome 9, whole genome shotgun sequence	0.939	7-31	SPSKDGKRKGKASDAVPSPKKSKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPH3	Chromosome 9, whole genome shotgun sequence	0.628	514-518	KGKAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CR21	Chromosome 7, whole genome shotgun sequence	0.692	631-640	DKRRFEPRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXB9	Uncharacterized protein	0.999	97-133	KKAQTGPREKTKAKQRYLKAKKERRKARIRAAPKKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXB9	Uncharacterized protein	0.764	818-831	IARRTPIAKIRPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXB9	Uncharacterized protein	0.602	165-165	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZA2	Chromosome 1, whole genome shotgun sequence	0.684	77-87	RIRVTKGKAKF
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMK8	Uncharacterized protein	0.756	712-720	KKGSGRKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DR04	Chromosome 19, whole genome shotgun sequence	0.962	244-256	KIVKKKRRKGYKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS92	Uncharacterized protein	0.997	571-608	RGARGSKVKVPSGKAGFRPKQKSGAAKRPGKARRAGAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS92	Uncharacterized protein	0.964	516-552	RSAKKPALGKAGRAASGKSKMPRSARDAKYGFGGKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS92	Uncharacterized protein	0.898	448-487	AAKKQRELKKFGKKVQVEKLQERIRNKKELNARIQGLKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU49	Uncharacterized protein	0.926	536-556	GLARRRKQLRKLKEAARQQRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXJ5	Chromosome 7, whole genome shotgun sequence	0.989	219-257	RKRGRPRKHPLPDPNAPPKSKRKLSPVRSAAAAAKKKAT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXJ5	Chromosome 7, whole genome shotgun sequence	0.967	477-497	QAREATRRAKKDRKAREKSLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYC3	Transcription initiation factor IIF subunit alpha	0.914	171-190	NARPPKARLFKKKVREIHKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYC3	Transcription initiation factor IIF subunit alpha	0.677	566-575	EKKEKEAAKN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6U4	25S rRNA adenine-N(1) methyltransferase	0.99	57-81	KRGKLIRPRGKRGGIKNRKGGASAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7Y5	Chromosome 1, whole genome shotgun sequence	0.917	759-783	ARGRRSASKPSAGASRGRSHRGKGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9A4	Kinase	0.861	1037-1049	KRNARKNRRRLAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9A4	Kinase	0.768	1573-1583	RRRKLRAQRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9A4	Kinase	0.648	1498-1501	RRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9B9	Spore development regulator umv1	0.975	270-288	KVRVRKHPRSRRRGSKRTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9B9	Spore development regulator umv1	0.646	781-785	RERKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P1U2	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]	0.97	90-118	PKKLKGAARKRARREEAAALAAAHRAEKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P7G1	Eukaryotic translation initiation factor 3 subunit G	0.643	58-66	KIKITRRVK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PG15	SWR1-complex protein 4	0.879	96-107	KPKFKRRKEKVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BX76	RF_PROK_I domain-containing protein	0.999	381-415	LVRGDRGGSRIDRKIEKERKKKMNKKKKQKRRLRD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXG9	Uncharacterized protein	0.765	1046-1052	RRRRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEC0	Uncharacterized protein	0.921	969-981	RAKANIKRRAGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEC0	Uncharacterized protein	0.881	364-374	GKRRKRSKGAN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEC0	Uncharacterized protein	0.718	29-36	KKSRSRKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEC0	Uncharacterized protein	0.703	338-347	RKAEKARLKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEC0	Uncharacterized protein	0.686	74-84	GRKIKGAVGRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEC0	Uncharacterized protein	0.647	914-918	KKERK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH16	Cation-transporting ATPase	0.842	142-165	GRRTSRSSRRRISMEGRSPRRTRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQM0	Chromosome 7, whole genome shotgun sequence	0.853	326-339	QKKPDKRERTRKGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQM0	Chromosome 7, whole genome shotgun sequence	0.701	660-672	KQSRRHLKTKPST
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQM0	Chromosome 7, whole genome shotgun sequence	0.633	319-321	KRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXZ0	Uncharacterized protein	0.601	43-43	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSV9	Chromosome 16, whole genome shotgun sequence	0.954	115-127	KPEKKKKKKQEIG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSV9	Chromosome 16, whole genome shotgun sequence	0.617	131-137	REPHPRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUV5	Chromosome 19, whole genome shotgun sequence	0.626	42-44	RKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYP6	Chromosome 12, whole genome shotgun sequence	0.776	152-162	KSRRKDSRKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYP6	Chromosome 12, whole genome shotgun sequence	0.616	951-954	PGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0E4	Uncharacterized protein	0.996	1033-1056	KKRQQNRKKNAKRREKEKNRKSSG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E212	Chromosome 8, whole genome shotgun sequence	0.973	548-563	KPKSRGKARGKGKKSA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E212	Chromosome 8, whole genome shotgun sequence	0.97	820-840	RGRGRGRPRGSRGGAKAGRPA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E212	Chromosome 8, whole genome shotgun sequence	0.957	277-289	PAKKGRGRGRKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E212	Chromosome 8, whole genome shotgun sequence	0.864	631-646	KRAASRRPRKSSPAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3M0	Chromosome 7, whole genome shotgun sequence	0.768	55-67	RKADARRLRQKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6T9	HSF_DOMAIN domain-containing protein	0.782	469-482	KRKSSRQKRGGSPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6Y1	Chromosome 1, whole genome shotgun sequence	0.686	221-225	VKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9V4	Chromosome 1, whole genome shotgun sequence	0.977	117-129	RRTKRRRSKKKRI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9V4	Chromosome 1, whole genome shotgun sequence	0.802	15-26	LASKSKPKPKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9V4	Chromosome 1, whole genome shotgun sequence	0.765	319-331	EKAKHIREKARRL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9V4	Chromosome 1, whole genome shotgun sequence	0.683	398-407	PKRNAASRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAJ9	H/ACA ribonucleoprotein complex subunit CBF5	0.998	458-496	RKKRKKEKKEKKAAEAAAAGIETPKSDKKKKEKKEKKDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDN1	ABC transporter domain-containing protein	0.937	110-124	RGRGGRRGKKSRGPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDN1	ABC transporter domain-containing protein	0.873	59-68	GAKKKSKKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CE56	Uncharacterized protein	0.986	706-732	RKAPSPFSGKRSLEKKGLAKKRRAARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CE56	Uncharacterized protein	0.938	997-1011	GRITRREKREKRAKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CE56	Uncharacterized protein	0.892	110-134	GKKPIKVYSTKKERIRGERKASVRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CE74	Uncharacterized protein	0.934	627-648	KKRSLKRDKSERIRGRRASQSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CE74	Uncharacterized protein	0.756	591-602	KAARDRKATKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CE74	Uncharacterized protein	0.624	829-832	RKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGZ9	Chromosome 19, whole genome shotgun sequence	0.635	1548-1553	RLGKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH86	Chromosome 1, whole genome shotgun sequence	0.918	712-725	KKHNKANKRKKQRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTG7	Uncharacterized protein	0.88	263-280	FKPRPSKARKDRGPSAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTS8	Ribosomal 60S subunit protein L12	0.803	86-99	KEPPRDRKKEKNIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1E3	Chromosome 1, whole genome shotgun sequence	0.782	28-35	RPKKRPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQS9	GTP_cyclohydro2 domain-containing protein	0.999	597-631	WKFGKKLRRRKKGGKRKEKGGSARGSPLRAATGAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRW6	Chromosome 15, whole genome shotgun sequence	0.756	85-96	KAQREFRKRREA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTI9	Chromosome 15, whole genome shotgun sequence	0.641	304-314	HRKNDKEDKLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTP6	Chromosome 12, whole genome shotgun sequence	0.982	1145-1157	IRKRKERAKRKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTP6	Chromosome 12, whole genome shotgun sequence	0.844	1426-1443	RKKRVKESIGKEFRAKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTP6	Chromosome 12, whole genome shotgun sequence	0.788	1483-1488	KSRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU01	Chromosome 21, whole genome shotgun sequence	0.808	334-349	RRHRKPEAAEKRQRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU01	Chromosome 21, whole genome shotgun sequence	0.762	465-476	RLKIRIKPRRAS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU01	Chromosome 21, whole genome shotgun sequence	0.638	523-526	RKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWR7	WD_REPEATS_REGION domain-containing protein	0.922	45-88	ASKSPNKPAQPQRTRPKDDPKPKTKHEFIQAKKAAALKHKEAAN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZK4	RF_PROK_I domain-containing protein	0.98	144-165	ARRKKHTKIKRADVKSGRKFKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0U2	Chromosome 9, whole genome shotgun sequence	0.993	109-135	KAKRQQEQREREEHQRKKRERRERKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E269	Chromosome 8, whole genome shotgun sequence	0.647	861-867	RPRRDPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2G3	Glutaminyl-tRNA synthetase	0.964	190-212	PKKPPPPKEKKKPSASTSAHPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2G3	Glutaminyl-tRNA synthetase	0.712	367-376	PERGPRKPSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E404	Uncharacterized protein	0.835	144-153	RTWRQKKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4K6	J domain-containing protein	0.95	453-464	GKNKKKGKKDKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5R9	Protein SQS1	0.994	7-32	GGRGGPPNRGRGRGRGRGRGRARGGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5R9	Protein SQS1	0.939	1009-1033	QGSGKTKSTKKQAKLARKAEKREMR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5R9	Protein SQS1	0.721	670-679	RRRGGQRAKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6T4	Uncharacterized protein	0.711	147-156	RRSRHRSEKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7G9	ELYS domain-containing protein	0.966	867-916	GSTKRRTRKTAAPQKEGVRRSSRLGGDAEDAASPAKRRAARGSKKGSKMP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYK2	Chromosome 16, whole genome shotgun sequence	0.998	626-641	KDKGKKKKSKKNKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYK2	Chromosome 16, whole genome shotgun sequence	0.953	194-216	KGEAKRRKGGVFGRLKRLGRKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYK2	Chromosome 16, whole genome shotgun sequence	0.839	1165-1192	RSSPEGRGLRGGGRDGRRRYSSAKQNGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYK2	Chromosome 16, whole genome shotgun sequence	0.822	1260-1302	DKGKGSLRRLTGKDSQPNSRNSSLRRKDGSKGSQRRPYAGRVP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C217	Protein kinase domain-containing protein	0.813	93-108	RPKPASRLEREKKRHH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2S2	Uncharacterized protein	0.983	128-158	AKTDKNRAKREKKKLAAIKAQAAAKAKHTSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMA5	Uncharacterized protein	0.906	414-425	RKLKKGKKSARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ09	Chromosome 21, whole genome shotgun sequence	0.909	645-653	PGAKKKKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTP0	Chromosome 12, whole genome shotgun sequence	0.828	60-70	RKKRTARLKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWJ9	Chromosome 16, whole genome shotgun sequence	0.987	306-319	KKPKTKKRKKAAKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWJ9	Chromosome 16, whole genome shotgun sequence	0.903	663-678	GKKPGTKKMEKRLKKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWJ9	Chromosome 16, whole genome shotgun sequence	0.82	126-138	SKKRAKEHAARRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYG1	Chromosome 8, whole genome shotgun sequence	0.998	677-717	GLGRNKEKEKEKEKGKDKDKDKDKDKKKEKEKESKEKVKDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0F1	Zds_C domain-containing protein	0.99	660-685	LEKESQKKREKHEKRERKEREKEEKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0F1	Zds_C domain-containing protein	0.823	364-389	RRAARTKMRKASGDSGRGSLASRRRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1G5	Uncharacterized protein	0.66	157-161	RRRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8Y5	Chromosome 1, whole genome shotgun sequence	0.823	609-620	KAKPKKGAKGAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBS9	Chromosome 1, whole genome shotgun sequence	0.861	108-121	RGASKSTKKRPKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXI7	Mre11_DNA_bind domain-containing protein	0.686	729-745	ARKTVAAPRAPARAPAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C654	Serine/threonine-protein phosphatase	0.89	320-331	PPRKQKKKSDGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6T3	Uncharacterized protein	0.976	165-190	AKRRKTAKARGAAGPGRGWRKGLTKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIW9	2-oxoisovalerate dehydrogenase subunit alpha	0.91	402-421	GHRKKVIEAMARAEKKKRPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPW3	P-type phospholipid transporter	0.863	80-102	RRDDRRKAKRANSLSHRLFRGKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPW3	P-type phospholipid transporter	0.802	171-179	RKTKPKKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPW3	P-type phospholipid transporter	0.663	1519-1524	KKKARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CV49	Uncharacterized protein (Fragment)	0.854	229-237	KMKKKARRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D0Z1	Chromosome 1, whole genome shotgun sequence	0.985	472-490	AKSRRKARRARSARKGPAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVF2	Zn(2)-C6 fungal-type domain-containing protein	0.892	9-27	RAKTKAVKSKKEPKAQRER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVY1	Uncharacterized protein	0.956	109-131	PKPKPKPKRMRIPPLITRHGKRL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E109	Putative DNA-dependent ATPase	0.863	71-85	QREKDNPGGGRKRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E109	Putative DNA-dependent ATPase	0.806	119-130	ARKTVAKKKGKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1L6	Ribosomal 40S subunit protein S9	0.864	168-178	RAGRVKRKRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E257	KRR1 small subunit processome component	0.973	337-362	HKKKDKRKRDGGEEPVQGKKEKKSKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E257	KRR1 small subunit processome component	0.63	18-21	KKHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E257	KRR1 small subunit processome component	0.629	245-248	QKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E257	KRR1 small subunit processome component	0.601	242-242	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2W7	Uncharacterized protein	0.847	79-97	RRSKHHHKHSHKHKSPAHS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6C3	Uncharacterized protein	0.606	477-477	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAA9	ABC1 domain-containing protein	0.711	126-133	RKQRGRRW
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAI6	Chromosome 1, whole genome shotgun sequence	0.976	212-225	RREKGRRRGRKVRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDH8	Chromosome 1, whole genome shotgun sequence (Fragment)	0.971	326-352	PPRGRSKARGRSSHRRSPSPPRAAARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDH8	Chromosome 1, whole genome shotgun sequence (Fragment)	0.876	433-453	RGRGRGRSTRRGRGSQERGSA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BU96	Chromosome 23, whole genome shotgun sequence	0.798	3-10	KKRGKKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8Z9	Uncharacterized protein	0.796	32-69	NKDKKKETKLLKQQSKAEDEHRKAIQKEHKLQAKLEKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8Z9	Uncharacterized protein	0.622	83-87	KKMKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8Z9	Uncharacterized protein	0.613	90-92	AKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CB60	Uncharacterized protein	0.994	436-454	GRGGKKSSHKKKGKNGGRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLZ9	Chromosome 12, whole genome shotgun sequence	0.926	1420-1442	KDGKRPTRSKSTRRLEREKRHKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNY0	Chromosome 9, whole genome shotgun sequence	0.635	210-213	AKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNY0	Chromosome 9, whole genome shotgun sequence	0.6	206-206	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTB4	SLT domain-containing protein	0.965	47-70	NKRRSPSAKPRMVVKRHAKRSKRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWQ1	Chromosome 8, whole genome shotgun sequence	0.983	745-802	RRRRTTGASHRSESHRERERSERERDRERDRDRDREREKEKERERQARSQARSERRAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWQ1	Chromosome 8, whole genome shotgun sequence	0.924	846-860	KSSASSRKSASRKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXK7	XPGN domain-containing protein	0.95	93-120	KDREQVKRRHKRELDRIRSKLERERRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1B7	Uncharacterized protein	0.609	322-323	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E378	Brr6_like_C_C domain-containing protein	0.935	95-114	APPSKHVRRKRSVLSRKGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5M0	SCP domain-containing protein	0.969	56-95	RNHQHRIKSKKKDTAKKVVVKPNTKSHRKTSSKWPTRTRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9N0	Uncharacterized protein	0.959	893-911	HPARSKDPRSRRKERKHAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9N0	Uncharacterized protein	0.947	404-420	IKRRKKLVHREIRRRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9N0	Uncharacterized protein	0.929	781-794	VRRRRWIRLRRRKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9N0	Uncharacterized protein	0.893	740-771	EKEKKRKQKESTKEDGGFEAIKRSARARSSKW
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9N0	Uncharacterized protein	0.75	116-124	NQRRQRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBY5	Ribosome production factor 2 homolog	0.742	6-19	KPKNARSKRALEKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXY2	FAM192A_Fyv6_N domain-containing protein	0.755	154-159	KKKRKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1T1	Chromosome 12, whole genome shotgun sequence	0.739	72-80	KSRHRKNKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAA1	Protein kinase domain-containing protein	0.841	381-393	ERRREKEREKARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAF4	60S ribosomal protein L29	0.793	15-28	KAHRNGIKKPKTNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIH0	Uncharacterized protein	0.918	413-433	KELKDAEKKRIRERQKADRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIH0	Uncharacterized protein	0.899	521-530	RGGGRRKKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIH0	Uncharacterized protein	0.867	559-575	RARKKAAAGESKSKPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJ43	Chromosome 16, whole genome shotgun sequence	0.999	51-63	AKKKKKKKKKKGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXX4	Uncharacterized protein	0.957	1335-1356	GSRKKQAKLNKKQQRAKAGGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUJ3	DNA polymerase	0.985	103-118	GKRKPKKGSKARSKLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUJ3	DNA polymerase	0.671	798-805	FRRPKWPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXD6	Chromosome 7, whole genome shotgun sequence	0.811	845-857	RKRKMRRGGSGGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2K8	DNA polymerase kappa	0.865	663-682	RSNLPPKRKRGPLDSFVRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5Z9	C2H2-type domain-containing protein	0.797	332-348	RKKRKANPSLERSTGPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7K5	Chromosome 1, whole genome shotgun sequence	0.822	285-292	KKKRKQSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7W7	Uncharacterized protein	0.917	633-646	VRLKEKRKRERAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P2W8	Histone-lysine N-methyltransferase, H3 lysine-79 specific	0.91	145-155	SKPKTKKPRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZQ0	Chromosome 15, whole genome shotgun sequence	0.675	505-510	KRPKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF16	Chromosome 1, whole genome shotgun sequence	0.79	292-299	KGNKKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF16	Chromosome 1, whole genome shotgun sequence	0.776	8-24	PPGPPPGPPPRPPPRPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D079	Chromosome 1, whole genome shotgun sequence	0.944	809-832	HHLKKKRPGGSRTSAGKQRRAEAP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D079	Chromosome 1, whole genome shotgun sequence	0.732	221-230	KQKRGTRRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQJ5	MI domain-containing protein	0.683	31-46	RKRHDRANRFNPRNGP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQJ5	MI domain-containing protein	0.634	145-150	AIKRTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSB2	Chromosome 15, whole genome shotgun sequence	0.839	417-426	GKRKGKGKGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSB2	Chromosome 15, whole genome shotgun sequence	0.807	463-508	AKRPANGNGTSAPPAQKKKTHERQPDPHHSRRTGSHPAASSIRRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTF5	Zn(2)-C6 fungal-type domain-containing protein	0.888	54-73	KKRGPPKGCDARGGRRKKFK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVT1	HECT-type E3 ubiquitin transferase	0.927	3381-3395	RPPKRGKGKEREKEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY95	Uncharacterized protein	0.744	129-143	GEKHHEHKHKQRSKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3F2	Uncharacterized protein	0.728	222-230	PKKSKGLKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3F2	Uncharacterized protein	0.638	364-368	KKPIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3M3	Uncharacterized protein	0.767	381-400	VRKRTIQVPRIQRIRKQKRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E416	Uncharacterized protein	0.69	253-274	KRRLFRWDRKGIHHSGASGKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6F1	Zn(2)-C6 fungal-type domain-containing protein	0.957	716-737	GKRKRGRSRATRGGGFSARRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6F1	Zn(2)-C6 fungal-type domain-containing protein	0.823	74-84	KHKRGRKPNKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBB2	E3 ubiquitin-protein ligase	0.742	1338-1352	PKKKSAEEARRAAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P0G6	Pre-mRNA-splicing factor CWC21	0.992	261-347	SRSRSRSRSPLSHSRSSRSRSRSRSRSRSRSRSPLSHSRSSRSRSPSRSRSPSRCASSRSRSPAHRPRRHSSSRVNPPGPPPRRPAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P149	5'-3' exoribonuclease 2	0.769	952-966	GSPDNRGRGRGRGAH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P149	5'-3' exoribonuclease 2	0.724	1199-1212	RGGGRGGRGAGSRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PA27	WD repeat-containing protein JIP5	0.991	189-223	KPKSIKEAKKSKTQLKKQRRRARQAERLKEHDKEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUU2	MINDY_DUB domain-containing protein	0.94	931-942	KFKGKKAKKGKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CC30	Ysc84 domain-containing protein	0.938	120-138	KKKRKVLRKIPPAVIKRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CC30	Ysc84 domain-containing protein	0.835	382-420	RRAEEEKRQIMALPPPPKHKKVIGYWESRGTKPGGKRRV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CE22	Uncharacterized protein	0.874	559-578	KKRESPAAKEAKRAEKLGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF55	Chromosome 1, whole genome shotgun sequence	0.917	328-337	KRKKRRAARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CX99	ATP-dependent DNA helicase	0.915	856-873	KAPRATKVAKPKKDPKRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CX99	ATP-dependent DNA helicase	0.875	1313-1332	SKKRNEMAARQRGGGIKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D0C9	Chromosome 1, whole genome shotgun sequence	0.805	543-558	RNGKRSRPSREEERRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPA1	Chromosome 19, whole genome shotgun sequence	0.693	141-151	KTKHPLRHPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSH3	Uncharacterized protein	0.967	1475-1492	EREREARRKRRQTRGRRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSH3	Uncharacterized protein	0.929	438-450	KPKPPRKKAEKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX63	Splicing factor YJU2	0.872	275-292	VKKKKNAPNAFGLVRKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX64	Chromosome 8, whole genome shotgun sequence	0.787	107-116	NKRRSPRSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY53	Chromosome 9, whole genome shotgun sequence	0.673	181-192	RGPPKGFRSGPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E164	Uncharacterized protein	0.918	164-184	EKHHRKVQKREKQRRMDRLRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E164	Uncharacterized protein	0.668	602-606	KSKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E254	DNA-directed RNA polymerase	0.678	1514-1520	KRKSARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2M2	Chromosome 7, whole genome shotgun sequence	0.888	281-295	AKGGKFKGKREKGGV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5E1	BHLH domain-containing protein	0.819	35-57	RRKSRVLRRKTDHSIIERRRREK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5E1	BHLH domain-containing protein	0.655	113-117	AKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7G1	Uncharacterized protein	0.998	34-58	AKKERKREKKERKERQRNERKERER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7G1	Uncharacterized protein	0.981	152-183	RRPRKDPNAPPSAKKAKREAGQDGERRGRRPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7M0	ArAE_2 domain-containing protein	0.63	963-970	SKASKASR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7M0	ArAE_2 domain-containing protein	0.606	960-961	RG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAV9	DUF2013 domain-containing protein	0.811	794-804	GRRQRRKPPSP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAV9	DUF2013 domain-containing protein	0.615	852-854	RRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	E3CTN3	Effector family protein Eff1-10	0.715	181-195	LARKRSSTQKNRTRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P8U8	Pheromone-processing carboxypeptidase KEX1	0.66	563-572	RKQRRLNRNR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PCY0	Pre-mRNA-splicing factor CWC22	0.996	730-771	RSRSRSRSRSRSRSRSRSRSRSRSRSRSPSEHQRHGRRRARS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PCY0	Pre-mRNA-splicing factor CWC22	0.991	31-69	HKRKRSPTRSVSSRSTSSRSPSRSRSPPPRSRRRRRSSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PCY0	Pre-mRNA-splicing factor CWC22	0.979	818-843	RSPVPRRRAPRSRSRSADPRKRSSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PCY0	Pre-mRNA-splicing factor CWC22	0.693	790-800	RSRSRSRSRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PHW2	tRNA (guanine(37)-N1)-methyltransferase	0.647	384-391	KMRKEQAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI89	Transcription elongation factor SPT6	0.997	78-90	RRDRRRRRKKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI89	Transcription elongation factor SPT6	0.833	114-127	RRKEAGRLKRFRRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI89	Transcription elongation factor SPT6	0.792	225-237	RRQQRREEKRKAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C522	Ubiquitinyl hydrolase 1	0.71	369-374	GRRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5T3	Chromosome 7, whole genome shotgun sequence	0.99	97-129	KKTHHRSDKQAGRRRKSHNRHKHHDNRKRPSKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C735	C2H2-type domain-containing protein	0.902	445-471	GPKRSPSEFKDMRKAWRKQKKEEEHRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C735	C2H2-type domain-containing protein	0.668	404-409	KKRPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPZ7	Chromosome 8, whole genome shotgun sequence	0.874	497-509	KGFTKEKNKKKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CUJ8	DUF2431 domain-containing protein	0.691	41-54	KSGAPHFKNQKRKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CUJ8	DUF2431 domain-containing protein	0.639	33-36	RRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXU5	Fcf2 domain-containing protein	0.849	464-474	RSKPPTKKKRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXU5	Fcf2 domain-containing protein	0.716	67-76	KSPRVSPRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQY8	Chromosome 19, whole genome shotgun sequence	0.836	342-356	SGKRASPPRKKTSPQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0L4	Non-specific serine/threonine protein kinase	0.996	808-832	KKKQNKRRRRGKRAGAAVAAKAAKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E179	Chromosome 9, whole genome shotgun sequence	0.986	204-225	PKPKKERAKPKPRSKSATKITR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4J7	Drf_GBD domain-containing protein	0.753	83-95	PKKGLRSRSRSRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6Q9	Chromosome 1, whole genome shotgun sequence	0.631	61-63	RKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P4C2	40S ribosomal protein S1	0.88	5-18	KNKKLSKGKGQKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P6G5	AdoMet-dependent rRNA methyltransferase SPB1	0.999	848-920	KGAQKKKEVQLVVAKGVNRGLKGRPKGTKGRYKMVDPRMKKELRAFKRKAKRDGKKLGSSNSKPRVPKGYGPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P6G5	AdoMet-dependent rRNA methyltransferase SPB1	0.982	792-820	DARPIKKVAEAKARKKMRTLRRLEKAQKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P6G5	AdoMet-dependent rRNA methyltransferase SPB1	0.981	388-405	ARKARKERRRKNELRQKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWX5	Putative Splicing factor 3b, subunit 2	0.839	32-41	KNAKRRLKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZU8	Putative Arf family guanine nucleotide exchange factor	0.825	2010-2022	RKRKVRDGKEKEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C943	Uncharacterized protein	0.983	843-855	PKRKKKRRKTDPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFQ4	Chromosome 1, whole genome shotgun sequence	0.88	270-290	KETKRKVKSEDDNKSKKSKKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFT8	Chromosome 21, whole genome shotgun sequence	0.72	495-501	RKKKAKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNL4	Chromosome 10, whole genome shotgun sequence	0.854	527-540	PKFAAASQRKKSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNL4	Chromosome 10, whole genome shotgun sequence	0.678	357-370	RKKHDKAELRKASR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CYE8	PKS_ER domain-containing protein	0.997	1098-1122	SPAKEKKEKKNKDKKKDKKDKTKHG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMD5	Chromosome 23, whole genome shotgun sequence	0.792	138-146	RRRRSKVKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMD5	Chromosome 23, whole genome shotgun sequence	0.689	566-572	WKRKWGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW92	Uncharacterized protein	0.804	126-139	RGGRGRGRGGARPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW92	Uncharacterized protein	0.763	243-259	KESKKDKQKAADARQKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW92	Uncharacterized protein	0.664	530-534	RRRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E150	Chromosome 9, whole genome shotgun sequence	0.699	748-754	GRRRSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4N3	Abhydrolase_3 domain-containing protein	0.97	167-204	SPATTSRQRRRRNKRHERALSEIRAMRQKTESALKRRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E925	Chromosome 1, whole genome shotgun sequence	0.656	320-327	KPNRNRRH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P042	CBFD_NFYB_HMF domain-containing protein	0.863	216-230	TSSKKSAPKKSKSRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEJ1	GN3L_Grn1 domain-containing protein	0.999	4-47	VKKRASKRVKIAQREKIKKKVKEHRRKTRRDERRSTQWKSKARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEJ1	GN3L_Grn1 domain-containing protein	0.902	599-629	KERRLQKKARVVVPSKSKPAASKRSNAKASK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHB7	Chromosome 1, whole genome shotgun sequence	0.916	10-28	AAKAARARAKLKKHQAQKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CUS5	Uncharacterized protein	0.877	414-429	RKRAEAKRSRSKDRPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CYX8	Uncharacterized protein	0.808	60-69	RQREKPKRKW
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZE2	Chromosome 1, whole genome shotgun sequence	0.984	552-582	PPPRKSLRGGSRGKRGQQRRENSSRKKAGHG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZE2	Chromosome 1, whole genome shotgun sequence	0.975	488-498	RRRLRRRRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZE2	Chromosome 1, whole genome shotgun sequence	0.883	617-637	KRPNLSRQPSESRRHKRPRPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1I7	RNA polymerase II transcription factor B 38 kDa subunit	0.694	209-218	KKARAERLRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS30	Chromosome 15, whole genome shotgun sequence	0.997	526-540	RRRGNARRKRRRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS30	Chromosome 15, whole genome shotgun sequence	0.881	384-399	RARAATRRRRRSPLDR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSP2	Chromosome 16, whole genome shotgun sequence	0.73	1146-1157	QPPPRPAKPAKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSR3	Chromosome 16, whole genome shotgun sequence	0.872	196-220	RPSRDDRERSPPPRRRDDSPPPRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT54	40S ribosomal protein S25	0.974	8-28	IAAAASKSAKKKKWSKGKVKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY82	Chromosome 7, whole genome shotgun sequence	0.888	192-213	PARPTKPKHRNAHSLRGRLRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYI6	Chromosome 7, whole genome shotgun sequence	0.697	186-192	NPRKRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0T0	Chromosome 9, whole genome shotgun sequence	0.78	868-883	KSEKPAKGSAKPAKWK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8K5	Chromosome 1, whole genome shotgun sequence	0.694	338-344	KGKGKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8K5	Chromosome 1, whole genome shotgun sequence	0.604	382-383	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8R8	Chromosome 1, whole genome shotgun sequence	0.998	904-954	KKIKSDNAGKASAAATAGAPAKPPKPASAVSASTEKRKRKKKPRSQLKRKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8R8	Chromosome 1, whole genome shotgun sequence	0.984	547-564	KRRRKLKQFAKKRHSKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8R8	Chromosome 1, whole genome shotgun sequence	0.959	135-149	AEAKLKANKKRPKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAA7	Transcription factor BYE1	0.771	293-308	ASSKPAAASKKGASRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P7H2	Peptidyl-prolyl isomerase CWC27	0.954	181-212	KKQRIAEERRKKHEMETRVAEEQKRKRSKAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P7H2	Peptidyl-prolyl isomerase CWC27	0.642	467-471	RRHRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI84	rRNA biogenesis protein RRP36	0.997	415-476	GKRASGQEKKQLKKALERRRKKNAQKEKRDMPAGIGFAREGNGALPKRKRNTAGGDSNKRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI84	rRNA biogenesis protein RRP36	0.914	342-383	ERAKVEAALRRAEGLAGERERRARESAVKGKIKSQNKERVEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PI84	rRNA biogenesis protein RRP36	0.88	229-265	RKQREQRRKDANQRKELAKRSNKNAPTEISSKRPVSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CEN3	SWIB domain-containing protein	0.997	95-138	RRKLARNAVPPNAKAANTKSTPASNGTKSKPEPKPKKKPAKKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH61	Chromosome 1, whole genome shotgun sequence	0.92	66-76	KEEKRNKKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH61	Chromosome 1, whole genome shotgun sequence	0.808	273-310	RQEKIKEKNAGLEKERQKLHGKYVAPKNEARKQQTRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH61	Chromosome 1, whole genome shotgun sequence	0.767	108-120	KPKKIKAAASSKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH61	Chromosome 1, whole genome shotgun sequence	0.689	12-22	KAAHFKAGKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH61	Chromosome 1, whole genome shotgun sequence	0.662	321-327	RASKKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHL0	Chitin-binding type-4 domain-containing protein	0.75	296-302	KKRRRSP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHL0	Chitin-binding type-4 domain-containing protein	0.607	315-316	RH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQ38	Chromosome 8, whole genome shotgun sequence	0.679	109-115	KREGRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQ38	Chromosome 8, whole genome shotgun sequence	0.65	407-411	HRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTA3	J domain-containing protein	0.69	72-83	RKSGGKDVARKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CTA3	J domain-containing protein	0.625	250-254	KERKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CV91	Uncharacterized protein	0.79	1375-1388	LERKKRLAEKEAKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1C0	Chromosome 1, whole genome shotgun sequence	0.696	110-123	RARRIQRGEQRPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRZ7	RRM domain-containing protein	0.98	216-239	EKRRRKQERARIRAERDERRRKHA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRZ7	RRM domain-containing protein	0.878	338-371	RSRSRSRSPPRSSRHPNERSSRHDQHGHRRRHHH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVM4	Uncharacterized protein	0.675	223-229	PRRGRPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2D9	SWIM-type domain-containing protein	0.953	101-141	RRSKKPSTQDSKTSPAKGNSKSKGKDVDKQEKKPKKMTKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E480	Transcription initiation factor TFIID subunit 2	0.955	1213-1226	ASDKKKLKPKKAKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E480	Transcription initiation factor TFIID subunit 2	0.605	1462-1462	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E730	Chromosome 1, whole genome shotgun sequence	0.859	75-86	KKGEKRKTWKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9P0	Chromosome 1, whole genome shotgun sequence	0.989	618-640	RQRKKKRRADGKNARASHKSKKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9P0	Chromosome 1, whole genome shotgun sequence	0.973	654-720	GNSGKKESKRARFSNKRQEDRGGNPGERRGGGSGSGGRGKTTRRGGSARAQANSSTGARGGGKVRGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CBS7	Zn(2)-C6 fungal-type domain-containing protein	0.859	192-204	PPAKRPRRGRNGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CBS7	Zn(2)-C6 fungal-type domain-containing protein	0.702	303-313	RTKSPHRLKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CBS7	Zn(2)-C6 fungal-type domain-containing protein	0.654	1159-1163	RRAKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCY4	GATA-type domain-containing protein	0.918	765-773	TRRKKKKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCY4	GATA-type domain-containing protein	0.896	797-814	GGSLPGVHRKNSKKRKEE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CG27	Chromosome 1, whole genome shotgun sequence	0.998	422-448	KVLPIPKEGGGKKKRGGRKARKAKERN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLQ4	Chromosome 12, whole genome shotgun sequence	0.996	1027-1054	HKKEKKAKKESASDRRKAKKDRMARKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVI7	Uncharacterized protein	0.675	239-242	RKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMS6	Uncharacterized protein	0.946	540-559	KRKHAVQRRVDRTKRRRARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMS6	Uncharacterized protein	0.937	187-222	LRADRAQEAARRKEEKRQAKLQAREAAKVPKVPKQP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMS6	Uncharacterized protein	0.736	165-176	KRRARSSRAKPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DNA8	Chromosome 21, whole genome shotgun sequence	0.723	116-121	KRRRRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQD6	Uncharacterized protein	0.986	70-109	ARDPKGELKRLGQKSKWTPKPPPAGKKAGQKPLKAALPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSG1	Uncharacterized protein	0.958	19-32	GARKRTRKRTRKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTL2	Chromosome 12, whole genome shotgun sequence	0.751	153-167	PKKKVSRQQQRKERK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVK2	Chromosome 12, whole genome shotgun sequence	0.977	169-190	NEERRRKKSERHRRRFADMVRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXR8	SLD3 domain-containing protein	0.89	239-253	QKRSRKLEKAKRWRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1T0	Uncharacterized protein	0.712	548-569	GPRHDRERSPGRGGDGGYRRER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4G5	Uncharacterized protein	0.671	112-116	KKKKM
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4K9	Uncharacterized protein	0.952	531-565	TKGKPQKKTLEANSEAADRTKAKHKRGTRSGKKVN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4K9	Uncharacterized protein	0.884	700-724	SQKDGDKVKKRKAYEPERENGERKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4K9	Uncharacterized protein	0.731	469-484	RRGKPSIRISASKGRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4K9	Uncharacterized protein	0.717	665-674	KGQGKKQKQK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E532	alpha-1,2-Mannosidase	0.824	578-587	VRKHAKGKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8G7	Chromosome 1, whole genome shotgun sequence	0.998	1038-1077	EKRRQAQAARKIEAEKNKPKGFAHGHVIGKKRKERKARRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8G7	Chromosome 1, whole genome shotgun sequence	0.769	1005-1024	KKRADKLKAMKESGERRKVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED31	Chromosome 1, whole genome shotgun sequence	0.911	546-555	PAKKGKKGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1B5	Chromosome 12, whole genome shotgun sequence	0.777	654-663	RSAKRRAHKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1B5	Chromosome 12, whole genome shotgun sequence	0.657	40-45	RDKKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1U2	Chromosome 12, whole genome shotgun sequence	0.828	4-25	ASKRQKEKKADFQKTKLKLGKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGT6	Uncharacterized protein	0.984	91-125	RIRKRRHGFLSRIKTRNGRKTIMRRRFRGKAKLSH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSE4	Uncharacterized protein	0.87	118-138	ARKLKQASGRRDEPPKLKRKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSE4	Uncharacterized protein	0.822	567-578	KRGRRKAVARGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSE4	Uncharacterized protein	0.811	308-321	RPRDAAKRSKGKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSE4	Uncharacterized protein	0.623	479-483	KPRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWY6	Histone acetyltransferase	0.979	28-66	KRVRTRQIAGASVSPAKKRRLKTLPAVKKRPPTRPATRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWY6	Histone acetyltransferase	0.937	298-312	ARGGKRGRPRKSAGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWY6	Histone acetyltransferase	0.62	786-790	KRGRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXG9	Chromosome 7, whole genome shotgun sequence	0.952	114-127	AHKSKNNGKAKRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXG9	Chromosome 7, whole genome shotgun sequence	0.632	96-102	KSRGLKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2M9	U1-type domain-containing protein	0.879	195-207	AREEKREKRRLRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5C7	Uncharacterized protein	0.994	508-527	RRKKRKAKKRKQLGMLAKIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E607	Uncharacterized protein	0.815	148-158	PRRRTHKRRPD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EA93	Uncharacterized protein	0.93	34-57	VFRKSLRKESKKTSKADKKQAARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PII9	Nucleolar protein 16	0.888	5-32	RQRRKARSGSTLKPSLNAKKQMKKKLAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUW4	Poly(A) polymerase	0.747	563-573	GKRAKSGNKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1R2	Aspartate--tRNA ligase	0.969	41-65	KKKRAAKAEKERIKAEKAAKLAAEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C4V4	Chromosome 8, whole genome shotgun sequence	0.942	2008-2017	LPRRRRRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5I0	Chromosome 7, whole genome shotgun sequence	0.977	406-439	RRSRTTPSRKPAEGVSPARKGRRPRASAGDKRAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5I0	Chromosome 7, whole genome shotgun sequence	0.657	352-357	KPKTKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6C8	Uncharacterized protein	1	100-192	GLRRKRGRPKKEPVPKVPKKRGRPRKYAPGEKRPRASRRKFNEDGSPKKRGRPKKVIDPDAVMNKVPKRRGRPPKLREPGEEDKKSGKRRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C6C8	Uncharacterized protein	0.741	345-356	RPKGRPPGSKNR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPQ2	Chromosome 8, whole genome shotgun sequence	0.983	1321-1330	AKKKKRKGGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPY9	Chromosome 8, whole genome shotgun sequence	0.67	1427-1434	SKRRLLRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRN5	PHD domain-containing protein	0.982	525-553	TPSKRGRKPKQLPPAAATPVRRRGRKPKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DML9	HMG box domain-containing protein	0.98	151-177	GKAAKKMSKLQKRKEKRLRDPDAPKRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP65	Eukaryotic translation initiation factor 5B	0.998	347-386	KEEEERKEAAKKAKKEKEKAKKEQLKKEGKFLTPKQKAER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP65	Eukaryotic translation initiation factor 5B	0.996	217-241	KKEKEKLKKEKEKAKKKAQAAAKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP65	Eukaryotic translation initiation factor 5B	0.995	116-130	NASKKGKKDKKKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP65	Eukaryotic translation initiation factor 5B	0.987	281-305	KKKKKKGKGAEPPPPATPAPSAAPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP65	Eukaryotic translation initiation factor 5B	0.958	413-436	GGSKPTAKKRAVVENRKKKGPQKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP65	Eukaryotic translation initiation factor 5B	0.627	4-8	KKGAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUL7	RNase_PH domain-containing protein	0.682	106-111	RRRRRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWP0	Chromosome 8, whole genome shotgun sequence	0.836	90-103	KQAKEKKQKIRQRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6I5	Uncharacterized protein	0.964	307-316	KPKKKKKKLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6I5	Uncharacterized protein	0.719	240-250	RPPRKSARAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7Q8	Chromosome 1, whole genome shotgun sequence	0.978	1411-1428	SKRRKRGARKGRTLAKQL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7Z3	Uncharacterized protein	0.904	46-86	RKRQSKRDEAIRKKIEGELQRKSGKPSTPMSSRRTKRTARP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDB5	SANT domain-containing protein	0.996	1356-1375	AARNRERKRKARVKPKKAKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDB5	SANT domain-containing protein	0.99	1465-1498	KTSDKRKPGPKSKRAKSDNASGGDKSRKSRPAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDB5	SANT domain-containing protein	0.914	1598-1607	RKAGKKRRGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CV10	Ribosome assembly protein 3	0.885	5-23	KRKATGASANPRRRRQRKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWR4	Uncharacterized protein	0.661	555-561	SRRHQRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWR4	Uncharacterized protein	0.637	101-104	KRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPV0	Chromosome 21, whole genome shotgun sequence	0.811	1841-1853	PYIKKSKPEKKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSE0	Uncharacterized protein	1	985-1022	KKQSRSAKRAAKRLAKEKRKRKVARRIRRAKREEALKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSE0	Uncharacterized protein	0.836	1189-1224	AKEKAQREAAARQQREAKATAKKERGLFTIGRKSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTH1	Protein kinase domain-containing protein	0.703	1135-1144	RARSRRSSRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUB1	Cryptochrome DASH	0.818	603-614	NANRRGARRRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1Y0	ERCC4 domain-containing protein	0.798	435-462	AAKEAREAKAREREAVKLAKAQAAAEKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5J9	USP domain-containing protein	0.89	1037-1055	RHGRIHRKGQHGDKKGKKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5J9	USP domain-containing protein	0.86	711-717	RRRRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5J9	USP domain-containing protein	0.634	389-392	RKRD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E694	RPA43_OB domain-containing protein	0.932	354-364	PKRDKKRRKQA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E694	RPA43_OB domain-containing protein	0.797	6-28	KSKDKSKRAESKSASSESTKRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E787	DNA-(apurinic or apyrimidinic site) lyase	0.684	558-562	RPKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8B4	Glyco_hydro_cc domain-containing protein	0.689	285-290	RRRRGL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EA57	Putative casein kinase 2 catalytic subunit CKA2	0.902	74-84	KPVKKKKIKRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PB75	Mitochondrial Rho GTPase 1	0.849	467-477	RPRKTDKKKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3T7	Chromosome 9, whole genome shotgun sequence	0.957	306-316	KKKKRSKRSKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C704	Uncharacterized protein	0.981	378-402	AKRSKDGKAAKNKKGNKKTDEKPRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C704	Uncharacterized protein	0.879	279-298	PPRRSPKPHPPRESPRPAPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGN2	Uncharacterized protein	0.69	212-218	LRMRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHB4	Chromosome 19, whole genome shotgun sequence	0.679	36-45	DRERDRKDRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CK83	Kri1_C domain-containing protein	0.992	554-573	LADNKLSKKERKKLKKKLKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CK83	Kri1_C domain-containing protein	0.985	717-742	KPGKKRLGKKERNRLKAAAEAEEKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CK83	Kri1_C domain-containing protein	0.974	390-423	RREDNTRKRKREERTARKEEEKRLKMQELSRLKN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CP14	Histone H1	0.999	116-182	AVAKKPAAKKVAAKKPAAAKKPAAKKTAAKKPAAKKVASSTTTKAKKPAAKKVAKPAAKKAAPAKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CP14	Histone H1	0.88	87-107	PKGPSGKVKLAPKAKVEKKPA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPN0	Chromosome 19, whole genome shotgun sequence	0.983	259-270	KKKKKKGKAKER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPN0	Chromosome 19, whole genome shotgun sequence	0.974	688-765	ADRVNRRMAKKNKKLGATQPSFGKLDKSLAAEGAKAKSKERVKLKQPGGAGVHAAKRFRSGAGPSSSSAAKPRPKPKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPN0	Chromosome 19, whole genome shotgun sequence	0.826	562-574	KEFKRRLKLKGRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRJ3	Uncharacterized protein	0.944	724-746	LRRQHRAAERAARRERKQRQRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXZ8	Chromosome 7, whole genome shotgun sequence	0.972	436-486	AAKRTRRKERSSSWKKKKMAALQQVKSLKADLARCKARQPKANKAKLREKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZW9	UDP-glucose:sterol glucosyltransferase Ugt53A1	0.951	1124-1138	SGRGGSKTKKKKKQQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2Y6	C2H2-type domain-containing protein	0.977	607-640	AQRARARAQAAKQKADERVRSKREKQAARRKPSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6A2	Uncharacterized protein	0.985	198-219	KKKGRARMSQEKRKRLARRRER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8H2	Chromosome 1, whole genome shotgun sequence	0.998	524-571	KRAAERRQNKKAKQAAKRAKKREAQLIRQGRLPPKPSRSARAKALRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8H2	Chromosome 1, whole genome shotgun sequence	0.994	342-371	RQRRRTQRQRPGAKARRSRSRRGSRSSRGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8H2	Chromosome 1, whole genome shotgun sequence	0.979	223-244	KDARRAARREARKAERLARRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8H2	Chromosome 1, whole genome shotgun sequence	0.965	462-489	RSRRSSVRRLSLPSKRAKSRRSARSRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8H2	Chromosome 1, whole genome shotgun sequence	0.907	662-688	HRHAAKAAADKAQRHPHKKSHAKDLKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8H2	Chromosome 1, whole genome shotgun sequence	0.749	301-306	RKPKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P4Y2	Mitochondrial genome maintenance protein MGM101	0.753	308-316	KKKKLWRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PCM6	Effector family protein Eff1-7	0.952	285-295	VGKKRRRKGKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PGL2	Chromatin-remodeling ATPase INO80	0.967	631-652	IIKLKRSKGKPAAADPRNKKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PGL2	Chromatin-remodeling ATPase INO80	0.947	794-829	KRNEKEERELRKKAEREALEKAKKEEEMREAKRQAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PGL2	Chromatin-remodeling ATPase INO80	0.922	1885-1899	KGAAAKRKSKSHRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BX09	RING-type E3 ubiquitin transferase	0.7	13-24	SRGARGARGGGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BX09	RING-type E3 ubiquitin transferase	0.671	384-388	GKKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BZK6	Chromosome 15, whole genome shotgun sequence	0.635	362-364	RKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2K1	Uncharacterized protein	0.745	153-162	KKPRTRKAVK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C515	Chromosome 8, whole genome shotgun sequence	0.902	77-108	RVAKPKSKAQIKAALKAQLRQKARCRKDRRKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CBT8	VHS domain-containing protein	0.888	195-209	EDKKNKLRSKKGVKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGM9	Chromosome 1, whole genome shotgun sequence	0.766	612-621	PPPRRRGKLP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPN1	Chromosome 9, whole genome shotgun sequence	0.972	397-421	PKRRGRPPKARTAEQQPKRRGRPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPN1	Chromosome 9, whole genome shotgun sequence	0.68	369-374	KRKRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CYG4	Ubiquitin carboxyl-terminal hydrolase	0.985	728-755	KEQKKKKSKRDRDRQKPMGGFAGRMKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CYG4	Ubiquitin carboxyl-terminal hydrolase	0.936	688-698	KKEKRKHKKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DN91	Histidine--tRNA ligase	0.846	438-445	KSKKPKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQR9	Uncharacterized protein	0.626	1408-1413	RRSRLH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQR9	Uncharacterized protein	0.612	1417-1418	KR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWF4	Chromosome 16, whole genome shotgun sequence	0.821	86-101	KPSRSQKAKQRKARIA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWM6	Glycerophosphocholine acyltransferase 1	0.912	102-120	RSRARRRREELVRKARSKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX30	Chromosome 8, whole genome shotgun sequence	0.928	352-383	RQRKRSQGEPEKAKPEAKAWTKASTPKSRKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYR8	Chromosome 12, whole genome shotgun sequence	0.622	165-167	RKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2F0	Uncharacterized protein	0.784	592-609	KRNRRASLAPKPLKLKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E566	Uncharacterized protein	0.895	838-860	NRKKLVERKSKVKSKAQAALHKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E566	Uncharacterized protein	0.78	488-503	VPSKRTSKAGKRAQAI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E566	Uncharacterized protein	0.777	430-441	SARKRIRARLAP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E566	Uncharacterized protein	0.694	318-322	KKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5K6	Uncharacterized protein	0.914	92-102	KKRRSERRKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5M2	Uncharacterized protein	0.875	417-428	GFGKPKKNRRRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N8	MADS-box-containing transcription factor	0.996	77-104	KGKGKKGKRARSEAKGERDLKTGRRKIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N8	MADS-box-containing transcription factor	0.681	265-272	RGRGRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5Q5	ARID domain-containing protein	0.92	675-685	EPKQPKRKRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6M7	POP4 domain-containing protein	0.976	71-109	AERKLIKRKRRVKSELSELKRLRIATARSAKTRALANKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6M7	POP4 domain-containing protein	0.698	163-179	KKIDAASKKPLSRSQRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P2U5	FACT complex subunit SPT16	0.84	1026-1032	GKKGKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P2U5	FACT complex subunit SPT16	0.62	1011-1013	KKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PF83	Lysophospholipase NTE1	0.998	1860-1880	VRKIRKKRRRTRRKAGISARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BW54	Chromosome 19, whole genome shotgun sequence	0.934	186-200	FSRRSRRSKRKHANK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3L5	Chromosome 9, whole genome shotgun sequence	0.973	713-755	RRAAMKAREAKKSGKGGGKASTSKDVRKGLATHVSKKQLKKQK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3L5	Chromosome 9, whole genome shotgun sequence	0.701	140-151	KHKAKLLKRSDR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVL6	Ribosomal protein L19	0.95	52-111	RKPVVGGSRSRARATAAAKRAGRGTGQGHRKGSSEARMPTKVMWMRRQRVLRRLLRKYRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVL6	Ribosomal protein L19	0.797	161-176	ARRMRNKAMRERRAQR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1N3	Chromosome 1, whole genome shotgun sequence	0.993	820-858	GKKSKKSKVDEAAKASKKQAKIEEREAKKKAKAEAKAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1N3	Chromosome 1, whole genome shotgun sequence	0.964	149-173	APKKAAKPKTTKAPGATKPKQKRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1N3	Chromosome 1, whole genome shotgun sequence	0.814	1253-1260	PKPPKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1N3	Chromosome 1, whole genome shotgun sequence	0.705	286-291	ARRRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1N3	Chromosome 1, whole genome shotgun sequence	0.701	1056-1062	KKKKGGP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPX6	Retrotransposon HobS hobase	0.774	281-296	KHKDRTEKQKQKKTKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRF7	Chromosome 16, whole genome shotgun sequence	0.792	620-626	RRRRRRI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW67	Chromosome 9, whole genome shotgun sequence	0.742	494-501	RKKSGPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZM8	HTH APSES-type domain-containing protein	0.773	186-193	KKRGRTRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E078	Uncharacterized protein	0.895	1614-1635	KRMQKEKKANNAGAKGKAHKKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4W6	Translation factor GUF1, mitochondrial	0.859	688-703	KLKHLNKQKEGKKRLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6D4	Uncharacterized protein	0.978	70-94	SKRQGQQHRGRRRDKNRGEKRIKWR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7V0	Uncharacterized protein	0.774	122-131	TRRKRFVRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Q2	Uncharacterized protein	0.853	471-485	KRREAERERERPKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Q2	Uncharacterized protein	0.824	160-180	RSKRSPRKASRVSIVGRRDVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ECE5	Chromosome 1, whole genome shotgun sequence	0.994	901-919	TRKKTGKGRGKRKSKGKVS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ECE5	Chromosome 1, whole genome shotgun sequence	0.965	1181-1223	KVPGKKRRGRHKLQLSAEEMARRAVERRARNAFLARKRRASKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ECE5	Chromosome 1, whole genome shotgun sequence	0.841	258-279	RRKPDSPEAPPPPRRAVGRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ECE5	Chromosome 1, whole genome shotgun sequence	0.722	1278-1289	RVRRAIKRGFPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBP5	Potential protein lysine methyltransferase SET5	0.799	83-89	GKKKKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXU3	Uncharacterized protein	0.717	764-770	KRKIRKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5H5	Chromosome 7, whole genome shotgun sequence	0.701	186-199	KIRAGVGKLRNRRH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CD17	TAFII55_N domain-containing protein	0.951	237-249	RKRRFRKRAARRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CD17	TAFII55_N domain-containing protein	0.695	25-32	RPKRAIRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CD62	Deacetylase sirtuin-type domain-containing protein	0.937	349-362	AKPSKKKRKVGNGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDD1	Uncharacterized protein	0.703	218-224	RRRRSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGW6	Uncharacterized protein	0.886	35-56	AHRRRSMPHDRGARTGAPKKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CP62	Valyl-tRNA synthetase	0.928	59-101	MKKLAKLKEKEAKQAAKDALKSDKPAQNAAGSGAAKKEKPKKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQD3	Uncharacterized protein	0.719	782-788	HRRKRHL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTC2	YL1_C domain-containing protein	0.89	29-47	AAGAKFKERKRRDAQPAKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTH6	BRCT domain-containing protein	0.683	1146-1155	RRRESLKRVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTJ9	Actin cytoskeleton-regulatory complex protein PAN1	0.998	1557-1614	RKTAKPARRPPPPPGQKRHKNLDELVKLSRSRTSKRPAKPEEPQRRKPPHRPRKKPSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTJ9	Actin cytoskeleton-regulatory complex protein PAN1	0.797	784-805	PSRKSGKSAAPPPPPPSRSRAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DV87	Chromosome 10, whole genome shotgun sequence	0.792	119-128	KKKKTRERSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0Z9	Non-specific serine/threonine protein kinase	0.618	120-122	RKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E348	Zn(2)-C6 fungal-type domain-containing protein	0.845	55-64	RIPRGRKRPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6N2	Uncharacterized protein	0.966	1791-1808	ARRDHRSGRARRARRGRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6N2	Uncharacterized protein	0.764	503-513	AKRKPPLKERA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6N2	Uncharacterized protein	0.638	1634-1644	EKAEAKLAKHG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9X6	Chromosome 1, whole genome shotgun sequence	0.745	410-426	KKRRLTYLRRKGYKLRM
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P41511	DNA topoisomerase 1	0.991	846-880	KAAPKKKVKKEEEENDIKPKKKDAKGAASKKRAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P41511	DNA topoisomerase 1	0.7	728-734	KKGKKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P41511	DNA topoisomerase 1	0.67	321-328	PKAGKVKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P41511	DNA topoisomerase 1	0.657	269-279	KKALAPSARKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUQ0	Ribosomal 60S subunit protein L2	0.805	176-194	KPLLKAGRAHHKFKVKRNS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUY3	Chromosome 21, whole genome shotgun sequence	0.773	157-165	PRRTKRKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3I0	DNA-directed RNA polymerase subunit	0.81	336-351	IKSIRARLKGKEGRLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C496	Chromosome 9, whole genome shotgun sequence	0.943	251-271	RKKSKRKGWPSEIERLRKGRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C572	Chromosome 7, whole genome shotgun sequence	0.834	533-551	PKVAGLGARGKKQQRKGFK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C572	Chromosome 7, whole genome shotgun sequence	0.637	285-289	RKRMK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRR6	Uncharacterized protein	0.786	234-246	RGRGCRKRTRGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRR6	Uncharacterized protein	0.618	285-288	KHKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU04	Chromosome 12, whole genome shotgun sequence	0.991	52-69	LRKKRAKNKRPFPKRKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUX2	Uncharacterized protein	0.972	175-199	KPSKRRTSKRRRTNPATRSRARHFK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWN3	AP-3 complex subunit delta	0.763	890-897	TKKKKPSN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWN3	AP-3 complex subunit delta	0.646	863-867	KSKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYR2	B-induced zinc finger protein	0.802	145-153	RKKRRRYGP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E464	Putative chromatin remodeling complex ATPase subunit	0.94	1100-1108	GGPSKKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E464	Putative chromatin remodeling complex ATPase subunit	0.908	175-189	AKKAKKGGDNRRRKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6C6	N-acetyltransferase domain-containing protein	0.767	152-163	KPKKDKNGKETK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6V8	Uncharacterized protein	0.752	179-190	KRTDRRRSKGSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7H2	Chromosome 1, whole genome shotgun sequence	0.634	467-470	KRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7W2	Chromosome 1, whole genome shotgun sequence	0.845	22-34	RPPTSKRKGKARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBP6	Stress response protein NST1	0.998	364-378	ASKNKKKKKKKKGGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBP6	Stress response protein NST1	0.995	855-886	AREARRMKESQKKKDKKKAQREAKEAERLKKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBP6	Stress response protein NST1	0.991	910-1016	KQEEIRLKKEAERKAREDEKAKKDEERRRRQAEERERQLEVERKRREKEEKIRLERELQEKAKRDREEAQRKAKEEQQRVQRAKELKAKEEQERKAEAAQKEKEARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBP6	Stress response protein NST1	0.983	77-89	AKKKKKKSKSKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PEX7	ATP-dependent RNA helicase DBP8	0.947	289-321	KPSSERVRKLNAKHQADRERKEENQRKSGKRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PEX7	ATP-dependent RNA helicase DBP8	0.85	511-524	ARLKAEKRASKKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C062	Uncharacterized protein	0.885	675-726	PRGRIKASNGKAKATRSSNKSKASTATTSKGRAGSARSKIATTGSRGRGKPA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C062	Uncharacterized protein	0.651	600-616	ARGARASKTVRDMRLKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAG9	Type 1 phosphatases regulator	0.752	156-165	SKQKSKRKVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFN7	RRM domain-containing protein	0.879	745-759	SHKSARHRRDKKPEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFN7	RRM domain-containing protein	0.878	776-791	RNKKKNATKDRKPRDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFN7	RRM domain-containing protein	0.758	570-581	KEKKERGARGER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CHE5	Chromosome 1, whole genome shotgun sequence	0.768	953-966	EKRVKETRSSRKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CSH0	Phosphatidylserine decarboxylase proenzyme 2	0.974	551-573	SRRSKRQGGARRRGQGNSRRKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CSH0	Phosphatidylserine decarboxylase proenzyme 2	0.94	523-541	KPRTKRRLPRVRRLKPNAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CV54	Putative ATP-dependent RNA helicase MTR4	0.848	420-436	GKRRGQVKKGGNAGKKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CV54	Putative ATP-dependent RNA helicase MTR4	0.754	29-36	KKQRKRSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVA5	Bromo domain-containing protein	0.813	842-852	ANRRSNKKKAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYY0	Chromosome 7, whole genome shotgun sequence	0.715	132-143	KRQRRASRAKMS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1H8	Chromosome 9, whole genome shotgun sequence	0.762	569-577	LERKRQKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1V4	Ribosomal 40S subunit protein S2	0.992	7-31	RGRGGFGRDRGGRGRRGPRRGGRRD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E245	Uncharacterized protein	0.682	443-448	RKPKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6E9	HTH myb-type domain-containing protein	0.779	529-538	SRRDKNRKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E922	Chromosome 1, whole genome shotgun sequence	0.995	541-570	RKKPPKKTKKAGPDGVRQRGKGRGRGGSAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EE08	Chromosome 1, whole genome shotgun sequence	0.983	157-186	QRLQHKKKARRDNVLRRKELEKKIRAKKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P333	Chitin synthase 7	0.988	952-967	RSRLRKKKREEKRRRE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P652	Pre-mRNA-splicing factor CEF1	0.981	178-218	GKKAKRKARERALEQSRRLAMLQKRRELKAAGITIKQKPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PIC4	Transcription elongation factor SPT5	0.874	89-100	GQRRRAKKQRRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PIC4	Transcription elongation factor SPT5	0.626	354-356	KRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF71	Chromosome 23, whole genome shotgun sequence	0.932	236-258	IKQQRLHEEKKAHEMAKRRGSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF71	Chromosome 23, whole genome shotgun sequence	0.889	204-231	KNDKSGKLRRTRRAKLYYLRKDDRRLAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CV05	MFS domain-containing protein	0.925	1045-1078	RSRSASRNRGSERESRDVSSAGRKKRITRKAVLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CV05	MFS domain-containing protein	0.71	986-996	RRGDRRNLRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVA8	G-patch domain-containing protein	0.735	194-206	HHAHRHRHKSGAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVA8	G-patch domain-containing protein	0.613	345-349	RNAPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT59	Chromosome 15, whole genome shotgun sequence	0.785	235-242	YKRKLKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWB1	Chromosome 16, whole genome shotgun sequence	0.992	247-276	PRTANAKKRKFKKPPNKETARQKQHRRGIR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWL0	Chromosome 16, whole genome shotgun sequence	0.677	164-178	KSRRREQNRNAQRRL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXI2	Uncharacterized protein	0.977	265-286	RRRMKARQREKALRKKAEKERS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXI2	Uncharacterized protein	0.732	209-226	PRRPSAHNRDSSKPRRHS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY16	Uncharacterized protein	0.815	40-49	SSKKNKKTKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ82	RED_N domain-containing protein	0.991	475-484	RTKKKKKKKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ82	RED_N domain-containing protein	0.914	216-225	GKRMRKKRKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ82	RED_N domain-containing protein	0.602	174-174	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4C4	Uncharacterized protein	0.684	307-313	KRQRKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7X9	Chromosome 1, whole genome shotgun sequence	0.902	528-537	KKGGKKRKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7X9	Chromosome 1, whole genome shotgun sequence	0.894	94-115	SKKVNGRFKKGSKNSRGKLASS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8G9	Chromosome 1, whole genome shotgun sequence	0.891	359-384	GAGRGRGGRGGGGGRGGGSGSRGGSV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C019	VWFA domain-containing protein	0.999	276-300	SRTAMKRRQKKESKKRKKEKRFRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5J2	Chromosome 7, whole genome shotgun sequence	0.772	303-310	KKSSKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CL71	Dual-specificity kinase (Fragment)	0.726	2004-2010	KGKRRRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLS2	ATM homolog	0.618	898-901	KKGH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPK4	Chromosome 19, whole genome shotgun sequence	0.617	408-410	RRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSM4	Chromosome 16, whole genome shotgun sequence	0.99	219-237	KKQRRSKPSSKKSKRKNKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSM4	Chromosome 16, whole genome shotgun sequence	0.714	267-273	RRKRSLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVM2	Chromosome 9, whole genome shotgun sequence	0.997	261-412	NERRKRELKDKLEDAARRDRRKEKRTRHDHDDGKSEKRSSRHSHSDDRDRRKRHRSRSSSPAARDKPKDRHERTHGRRSCRHDDSHRSHKSSRHRRSDDEQLGSRRKESYRSRSRSRSRSRDRDKDKDKDKDRHTHGGRDRERQSTKSRKQR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2C7	rRNA adenine N(6)-methyltransferase	0.973	70-103	KKPKRKRRTREEIEAAKLAKAAFGVPIRSHRRTR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E742	Protein kinase domain-containing protein	0.881	897-921	EKKAELERKRLERRSRLEQLKRDKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E742	Protein kinase domain-containing protein	0.853	766-787	RPKKTSVGKTKMGKAKLGPRRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E772	Chromosome 1, whole genome shotgun sequence	0.967	237-257	SRKKTKGKQKEQARKSKSKSS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E772	Chromosome 1, whole genome shotgun sequence	0.922	632-644	RKQKEKKERKKAQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E772	Chromosome 1, whole genome shotgun sequence	0.834	889-895	KRRKRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E772	Chromosome 1, whole genome shotgun sequence	0.747	760-772	AKRAKLLKRLSKN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E772	Chromosome 1, whole genome shotgun sequence	0.65	62-72	KKNKSDKYGRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E874	HORMA domain-containing protein	0.691	386-390	AKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EA53	Polynucleotide adenylyltransferase	0.933	47-74	KDGSVSQKGKKRKADEREDDGRSKKERE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDR7	Chromosome 1, whole genome shotgun sequence	0.815	85-101	RAKKTRAIRRKLNQHER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDY2	Chromosome 1, whole genome shotgun sequence	0.989	577-622	AKKQQKASDVSARKRKLMSKGIAVGATRKSSKRPRSGTANGKSRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P5V5	Protein BFR2	0.78	491-507	GKKKKHNVDTKASKGRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P5W8	Ubiquinone biosynthesis protein COQ4, mitochondrial	0.929	331-344	SGRAKKGGKRRGWP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXS6	5'-3' exoribonuclease 1	0.873	1436-1474	GRGGRGGGTSRGRGAPVSRGAPVSRGAPASRGARGGRGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXS6	5'-3' exoribonuclease 1	0.798	362-372	AKVSKKKKSIS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXS6	5'-3' exoribonuclease 1	0.606	103-103	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXS6	5'-3' exoribonuclease 1	0.606	105-106	AK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXS6	5'-3' exoribonuclease 1	0.604	101-101	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DNV3	Structural maintenance of chromosomes protein	0.627	808-810	RKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DS46	Uncharacterized protein	0.86	173-189	AQRKHRNEKKLARREHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTU6	Chromosome 12, whole genome shotgun sequence	0.999	436-464	RRKRRKKIRKHKYKKLRKAQRAERQRMKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZB4	Putative ATP dependent RNA helicase	0.746	81-93	PKHKKPSASKAST
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZB4	Putative ATP dependent RNA helicase	0.641	96-107	KPGSASPSAKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZS4	SCD domain-containing protein	0.973	1042-1063	KASRSRGASKSKKSKKPSSKGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZS4	SCD domain-containing protein	0.961	74-115	RQKKKAPRGSVASTSKAKKPTATPRARKAAGASRNLATKTPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZS4	SCD domain-containing protein	0.727	331-340	KKKARTDKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0F9	Uncharacterized protein	0.963	48-128	HGSHSSHRDRKPDEKDRHRDRDDGRHGHRDDRHRSSHHRSSRTQHRHREEERGERKRRHSDEDLDDRQRHGNKKKHGRHHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0F9	Uncharacterized protein	0.608	35-36	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1Z4	SAP domain-containing protein	0.744	242-247	KKRKRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1Z4	SAP domain-containing protein	0.651	222-225	AKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5U7	CUE domain-containing protein	0.769	124-143	RGRGGASVRGARGGRGGFRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6Q4	Uncharacterized protein	0.648	194-202	HKNRHNKGE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9F1	Uncharacterized protein	0.951	1014-1030	KRQRLKAKVKRRLAKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P1V1	Flap endonuclease 1	0.992	354-374	SAPPKRKAEDDKKNVKKKGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3S7	Ribosome biogenesis protein NSA2	0.944	12-64	RRHGRRLDHEERQRKRAAREVHKASAVAQKVTGLKAKMLNKKRRNEKIQMKKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P3S7	Ribosome biogenesis protein NSA2	0.823	137-148	KTGKRKQKGWKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q99078	Dual specificity protein kinase FUZ7	0.652	346-350	RRRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF94	Chromosome 23, whole genome shotgun sequence	0.801	52-59	KRQKRKKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGI8	Uncharacterized protein	0.943	541-557	KTKSSKKHDRKKKDKTT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGI8	Uncharacterized protein	0.666	332-337	KRNKHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLR6	Chromosome 12, whole genome shotgun sequence	0.728	528-536	PRRRSREPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CUT0	Uncharacterized protein	0.758	326-334	KKRGRPRLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVD3	ER membrane protein complex subunit 10	0.881	170-187	KEERRKQRQRQLSRRRKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY14	Uncharacterized protein	0.99	356-374	KKLERRRKRNKEKADKRRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY14	Uncharacterized protein	0.792	1057-1066	ANAARKRKIR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQX3	Uncharacterized protein	0.994	774-794	GRGKKKAKGKKAATVAKKKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQX3	Uncharacterized protein	0.907	629-643	KGAKKKKAAGTGRKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRQ5	Uncharacterized protein	0.962	661-684	KDGAASPSKKGGRGHRGKGNRHSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSQ2	ERF-3	0.829	670-684	KTGKKSRRGPQFAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0M2	Chromosome 10, whole genome shotgun sequence	0.954	18-39	PRKRAARHRGKVKAFPKDDPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0M2	Chromosome 10, whole genome shotgun sequence	0.66	238-245	KLPRKTHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBP3	Chromosome 1, whole genome shotgun sequence	0.619	824-830	KQRAERR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EC00	Chromosome 1, whole genome shotgun sequence	0.943	525-545	KKGAKSCNKLPKSKTKKKKDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EC00	Chromosome 1, whole genome shotgun sequence	0.911	113-123	PSPRKRRRTKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P22015	Mating-type locus allele B1 protein	0.977	277-309	KTPKPGMPRPVTTVAKRHPARKTKPAAKPKSRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P22015	Mating-type locus allele B1 protein	0.781	374-388	ARGNRKVKALPKRAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PAB2	Topoisomerase 1-associated factor 1	0.944	1064-1086	RRSGPKKKLSHPTKGDGSRKKKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PAB2	Topoisomerase 1-associated factor 1	0.932	416-437	KGRRRAQRRKDAQEKGAPKLKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PAB2	Topoisomerase 1-associated factor 1	0.75	77-86	KRWKHRPRAL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BX38	Uncharacterized protein	0.969	632-659	REAGENRQKMIEKEKERLKSKRGWRKKF
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BX38	Uncharacterized protein	0.761	563-571	SKKPPKSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAQ9	Sec39 domain-containing protein	0.784	13-20	PKPRKPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CL55	BHLH domain-containing protein	0.678	51-55	KRRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPI8	Chromosome 19, whole genome shotgun sequence	0.782	264-280	SGKVKKVGTKANVKKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQZ3	Uncharacterized protein (Fragment)	0.637	271-275	GKSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXJ9	Chromosome 9, whole genome shotgun sequence	0.987	516-578	SKKSKNKAAGTKRKASESSGASKKKSKAKSTGSPSAAAAEYVPAKKAKPAAAKKKPTPSSKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXJ9	Chromosome 9, whole genome shotgun sequence	0.926	303-315	RKAARRKAAKKAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXJ9	Chromosome 9, whole genome shotgun sequence	0.879	657-686	PKKPAPVANKNSKSAPLDGRKRGTGGIKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZI6	Uncharacterized protein	0.624	369-371	GRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0J9	CBF domain-containing protein	0.996	587-616	PKKKDKKRWKDQPRTGKRKGKGKQAASAKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0J9	CBF domain-containing protein	0.965	1144-1157	KSRQKTKDKKKRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0J9	CBF domain-containing protein	0.711	159-178	KSKEKPTQKEKANKQGEQKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E0M8	Uncharacterized protein	0.828	40-49	SGSKRARRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P2E8	Actin-related protein 4	0.673	127-131	EKKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P7M1	ATP-dependent RNA helicase DBP9	0.982	641-686	KNKIKDGANDRKNKGGKRRSSTGKNTTGAAGKSRKKVDPLRKFSNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P7M1	ATP-dependent RNA helicase DBP9	0.77	413-439	GKKRKSSEHAGAETKSNKSKVSQHRKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVV8	Uncharacterized protein	0.609	1547-1548	RK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJT4	Chromosome 15, whole genome shotgun sequence	0.992	66-91	GKGKGKGKGKGKGKGEDRITRHTRKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CW60	Glyco_hydro_85 domain-containing protein	0.765	490-497	RRRRRRAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP85	Uncharacterized protein	0.999	1242-1262	KGKKRKRGGAGGKKKKGAKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP85	Uncharacterized protein	0.999	1325-1360	KLSKLSKLAKSKTKSRKSSSKSEAKKKRKSLKRAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP85	Uncharacterized protein	0.721	1412-1421	RKSSAKRTKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP85	Uncharacterized protein	0.652	1219-1224	PRRRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVK1	MFAP1 domain-containing protein	0.949	533-611	NRQDRKDDGLRHHRERRPDRDRDHDDRHRSRDQDRDRNRDRDRDRDAGRHRDRGHRSRSDWPRSNDKHRDRDHHHDKKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXS9	Chromosome 7, whole genome shotgun sequence	0.941	30-46	GAKKRRRTAREAKAAKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXS9	Chromosome 7, whole genome shotgun sequence	0.941	181-209	RKARGTHRAAGKVKARIAKKEEEAANAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E172	RNase III domain-containing protein	0.874	66-79	LGKRARKALKARER
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E172	RNase III domain-containing protein	0.625	684-690	KNRQRLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1P6	Uncharacterized protein	0.668	59-65	RNQKRKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1P6	Uncharacterized protein	0.617	70-77	RHTRQARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E316	MRC1 domain-containing protein	0.992	415-429	KTKSKKKKKKKLAQK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E316	MRC1 domain-containing protein	0.633	1517-1520	RKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3H2	Uncharacterized protein	0.814	884-893	KKPKKNRPWK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3H2	Uncharacterized protein	0.686	418-422	RRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E570	DNA-directed RNA polymerase III subunit	0.922	134-145	EEQKAKKKARRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5Y8	Uncharacterized protein	0.985	37-64	KQKRRKRALPPGLTRKQAKLLKKIKKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E855	Chromosome 1, whole genome shotgun sequence	0.679	357-365	RGRSRSPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E855	Chromosome 1, whole genome shotgun sequence	0.663	70-79	RAEAARRARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P5U4	ATP-dependent RNA helicase DBP4	0.993	782-802	KELAKEKRREKRRRQKEREKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P5U4	ATP-dependent RNA helicase DBP4	0.971	12-34	KRKKGGAAPHLKSRSKNARKLKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P999	Chromosome 8, whole genome shotgun sequence	0.881	268-280	RPKRRRNRGGVGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BUZ6	Chromosome 21, whole genome shotgun sequence (Fragment)	0.858	244-252	RPKKKAKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1Y7	RING-type domain-containing protein	0.699	842-850	RRRGRTPRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2R0	PH domain-containing protein	0.73	1207-1216	KLNKAKRIRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CED6	RRM domain-containing protein	0.998	268-305	DNWRRRPSPPRRPRRSPSPRRGGGSRHSRSPSPRRGGD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CED6	RRM domain-containing protein	0.997	53-119	GHRERSPIRSVSRSRSPPPRRREDRSRSPVSRRPDRDGRRDRARSRSRSPPPARSDRRRTPPPKPRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CK95	Eukaryotic translation initiation factor 2A	0.631	544-546	KKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CKM2	Bromo domain-containing protein	0.918	351-373	RGKRRRKPFHLVPATRRKGLQGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CKM2	Bromo domain-containing protein	0.746	182-196	KKSGEGKQQARKRTR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXC6	Ribosomal 60S subunit protein L32	0.857	10-50	KKRTKAFKRHHSDRYHRVGESWRKPKGIDSAVRRRFRSTVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXQ2	VWFA domain-containing protein	0.868	401-416	AMKRRQKKELEKREKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY88	RNA cytidine acetyltransferase	0.993	1162-1183	EASPKKAKASNKSGERKKQKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY88	RNA cytidine acetyltransferase	0.814	68-84	RKKREQKIKNDIKRGIR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1M7	Chromosome 1, whole genome shotgun sequence	0.803	516-523	RRIRRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT25	Chromosome 23, whole genome shotgun sequence	0.719	742-748	APRKRRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUB2	Uncharacterized protein	0.994	749-788	HKHSKKYSERKDKDKTGRKEERRKPAKASDSRNSKKGVGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWR8	Chromosome 8, whole genome shotgun sequence	0.779	1090-1096	KKKKKGW
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2C4	Uncharacterized protein	0.905	889-905	GRRSKIERREEKRRLRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3B7	Chromosome 7, whole genome shotgun sequence	0.981	294-316	RVERNVRRAEKRKGPKAHARSNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3B7	Chromosome 7, whole genome shotgun sequence	0.668	74-82	GRKSAGRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E481	Ras modification protein ERF4	0.799	305-315	AKKNARRIKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4E5	Putative zuotin	0.994	295-381	DPRIKQFKAEDKAAREAKKNKGRPGANGASAGVDPRKAAEDKKKAEEEAKRKAESEAKAAEQEKAAKADAKKLKEAAKKAIKKEKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4E5	Putative zuotin	0.944	266-286	EKKNRNERARRKKEDNARLRN
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4E5	Putative zuotin	0.638	129-134	RKKVLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.943	471-500	SGKKRGRPPKEKVDEQLPVPVKRPRGRPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.821	427-435	AKKRGRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.804	283-291	PKKRGRPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.785	534-542	KRSRGRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.781	381-388	KKRGRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.764	320-328	SGRKRGRPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.751	211-219	TKKRGRPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.727	135-142	AKKRGRPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5N3	PARP-type domain-containing protein	0.664	245-250	KKRGRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8X7	Chromosome 1, whole genome shotgun sequence	0.982	1877-1889	KRKAGRGRKKRKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8X7	Chromosome 1, whole genome shotgun sequence	0.962	1751-1763	SKKKRGRPRKSAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8X7	Chromosome 1, whole genome shotgun sequence	0.81	1790-1798	KLKKRRGHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8X7	Chromosome 1, whole genome shotgun sequence	0.806	1936-1952	PSATKTSPRKSLKRKVL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8X7	Chromosome 1, whole genome shotgun sequence	0.65	1925-1931	RRSRGGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED76	Chromosome 1, whole genome shotgun sequence	0.713	1196-1210	KQKRKAEQRAATARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYE5	Chromosome 16, whole genome shotgun sequence	0.955	1263-1294	RAHQPRHHHRRQHPGTAHISHPAGRHAKRKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C4X7	Chromosome 8, whole genome shotgun sequence	0.637	135-140	SRSRRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C4X7	Chromosome 8, whole genome shotgun sequence	0.631	291-293	KRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFK0	Uncharacterized protein	0.979	397-450	AGGRGGGRGGGFGGGRGGGRGGGFGGGRGGGRGGGRGGRGGSDGSFRGMPRGGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CFK0	Uncharacterized protein	0.97	5-59	DKSTKAAAPAVNAKKASKKDKKAAPAANVVEPKANGVDKKAKYNNKKGKKEATKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLD5	Uncharacterized protein	0.943	335-349	HRKRRHRRTRWREPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CN68	Chromosome 10, whole genome shotgun sequence	0.934	5-25	RTRPSRKTRSSSGSKKKRDKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CN68	Chromosome 10, whole genome shotgun sequence	0.872	607-623	RTSAKDASRKKRAHARP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CN68	Chromosome 10, whole genome shotgun sequence	0.815	139-146	RRARRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CN68	Chromosome 10, whole genome shotgun sequence	0.811	806-819	KRQAKKEAKREQRH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CSC9	Zn(2)-C6 fungal-type domain-containing protein	0.664	146-152	KRIRRSP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWY0	Zn(2)-C6 fungal-type domain-containing protein	0.654	121-125	RSRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CXZ5	Diaphanous related Formin	0.883	1588-1604	TAPKPPALPLIPKKKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1A2	Chromosome 1, whole genome shotgun sequence	0.984	598-623	SKGKGKSKSKSESESKRKSRGKSKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1A2	Chromosome 1, whole genome shotgun sequence	0.962	934-948	GAQKKGKKLKRKQAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1A2	Chromosome 1, whole genome shotgun sequence	0.779	729-743	RRNGVRKVKSRFKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ53	TAFII28 domain-containing protein	0.993	137-162	LKAKKPSKQKADGTETKPKPKKPKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ53	TAFII28 domain-containing protein	0.964	233-265	KESKPKAKKAGGSKVGTKAGSKARSSTARSASR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ53	TAFII28 domain-containing protein	0.686	192-201	KPKKTSKNKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTB6	Uncharacterized protein	0.761	295-302	RRVKRKRT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTJ5	Chromosome 15, whole genome shotgun sequence	0.679	711-720	RRSHRPPHHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU59	Uncharacterized protein	0.924	1415-1425	SKRKKKRTKQA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU59	Uncharacterized protein	0.883	84-100	KRKTLSGRKARKQGAKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU59	Uncharacterized protein	0.813	1304-1320	NKARKGGGGEAERRRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU59	Uncharacterized protein	0.766	1461-1479	RGRRGRSTAARARSMTGRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWG5	Sister chromatid cohesion protein	0.969	253-266	SADKPKRKRSKKFK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWG5	Sister chromatid cohesion protein	0.939	359-367	KKKKKRSRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWG5	Sister chromatid cohesion protein	0.739	570-576	KPKKGRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWG5	Sister chromatid cohesion protein	0.606	720-721	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E060	Photolyase/cryptochrome alpha/beta domain-containing protein	0.918	666-684	TSKKRKAAAKVEGTSKKKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4D3	BUD22 domain-containing protein	0.927	457-493	TKKERKNRMGQRARKALYEKKYGSNANHIKMREKKKV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4D3	BUD22 domain-containing protein	0.886	397-414	PRRKRKATSSASKPSKKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9U8	Uncharacterized protein	0.907	544-575	PPRGKTRAKPRHEAFPQAPPHPWRSPPKKERG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9U8	Uncharacterized protein	0.84	615-636	RSPKAKRAQAMRAARSDKGKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5S6	Chromosome 7, whole genome shotgun sequence	0.704	209-219	HRRMLKARRGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CBP5	Uncharacterized protein	0.605	389-390	KR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CX14	60S ribosomal protein L41	0.659	41-49	RRYDRKQKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CX14	60S ribosomal protein L41	0.649	58-63	FHKKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CX14	60S ribosomal protein L41	0.604	55-56	KP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSZ8	Chromosome 16, whole genome shotgun sequence	0.79	87-95	KRGRKPGKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTR0	Chromosome 12, whole genome shotgun sequence	0.713	66-75	KRRADAKRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW34	18S rRNA factor 2	0.999	133-160	TKKEKKEKNEKKEKKEKKEKKEKKEKKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW34	18S rRNA factor 2	0.927	376-395	VERARVQKDKMERRKRKAEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DW34	18S rRNA factor 2	0.61	112-113	RK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1Q8	Uncharacterized protein	0.947	697-737	QTKKPTRGRGTGNSGTDRSAKQKEKAGNKARQRGHDKKMAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E1Q8	Uncharacterized protein	0.757	659-676	PDRGRGGRILRGGSRGGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2Q7	DDB1- and CUL4-associated factor 13	0.996	450-496	KQRHVPKAIKQAQKLKRTMIDARKNKEENRRKHSKAGDKKPKAARKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5D9	cAMP-dependent protein kinase catalytic subunit	0.829	216-227	AVKRAKIRRKQH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8G4	Uncharacterized protein	0.896	437-448	PKRKGRRAQKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A1A652	High-affinity iron permease fer2	0.705	140-146	KRKWKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBF2	Nucleolar protein 58	0.994	526-561	SKEERKALKKAKKDANGVETPKKEKKDKKKRSADEA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBF2	Nucleolar protein 58	0.965	564-582	NGTPKSEPGSSKKKKSKKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PBF2	Nucleolar protein 58	0.895	489-504	KLSKEERKALKKARKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0T4	G-patch domain-containing protein	0.997	274-287	GKRAAKKKKKRKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C935	BHLH domain-containing protein	0.732	226-250	LKRARGPELDRQRKDNHKEVERRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C9Y8	Asparagine-linked glycosylation protein 11	0.828	312-325	LRKVRKTNRTRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CF00	Chromosome 1, whole genome shotgun sequence	0.944	218-231	RKAKRERRKEEKRQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CH67	Chromosome 1, whole genome shotgun sequence	0.724	39-51	RAKDHHKKRDMLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CMI3	FCP1 homology domain-containing protein	0.715	501-510	SKRKSLAKRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CNC9	Chromosome 10, whole genome shotgun sequence	0.829	652-660	AKKKPRKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CSU6	Uncharacterized protein	0.783	513-529	PKATARGRPGMRRGPNR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CYH1	LisH domain-containing protein	0.841	967-981	EKGKKGNARQRKNSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZR9	Chromosome 1, whole genome shotgun sequence	0.963	85-118	AKRKPGRPRKSEAPTPSAMPSKTPVKARTPRKKS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZR9	Chromosome 1, whole genome shotgun sequence	0.774	151-159	KRKPGRPRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMX3	PIPK domain-containing protein	0.751	1811-1816	KRKKRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMX3	PIPK domain-containing protein	0.744	1523-1537	RRRERKQKQVQAEKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRC6	Uncharacterized protein	0.771	1624-1633	QRPSKRPKHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRK3	Ribosomal_L16 domain-containing protein	0.606	76-76	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRK3	Ribosomal_L16 domain-containing protein	0.602	78-78	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSA2	Uncharacterized protein	0.612	69-70	HK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSA2	Uncharacterized protein	0.602	67-67	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVB6	Chromosome 12, whole genome shotgun sequence	0.843	392-412	PKRKRSAAQPSSSKRKTPATA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVL3	Chromosome 9, whole genome shotgun sequence	0.992	108-141	SRKEREKEKERAREREKERERERERAKSKDEEKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVL3	Chromosome 9, whole genome shotgun sequence	0.976	508-530	SASASKPKRKSSHSRRRSRSRSG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVL3	Chromosome 9, whole genome shotgun sequence	0.845	642-653	RRRRREREAKAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVL3	Chromosome 9, whole genome shotgun sequence	0.805	1231-1247	RSPAAPRKAPPKLVRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVL3	Chromosome 9, whole genome shotgun sequence	0.765	1318-1327	RAKAIKKRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVL3	Chromosome 9, whole genome shotgun sequence	0.635	1211-1218	RTGRPARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWU5	Chromosome 16, whole genome shotgun sequence	0.947	287-302	AKPAKHAKPKRGGARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3F9	Chromosome 7, whole genome shotgun sequence	0.994	877-948	KHKRFVHHRRQNAHKTPLPMPVPGAPLPKPGPGGPPAHGGPGGPKPGPGPAPKPGPGPAPKPGPGPAPKPKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3F9	Chromosome 7, whole genome shotgun sequence	0.648	174-177	RKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3V2	DNA polymerase	0.876	747-764	RQKEKVIERQRSKRRRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E805	Uncharacterized protein	0.606	45-46	KR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E822	Chromosome 1, whole genome shotgun sequence	0.915	129-140	ARKRERRKLRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E822	Chromosome 1, whole genome shotgun sequence	0.731	273-278	GKKRKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E822	Chromosome 1, whole genome shotgun sequence	0.683	248-261	KQAEKDRQKGRVPE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E822	Chromosome 1, whole genome shotgun sequence	0.627	322-325	HPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E914	Chromosome 1, whole genome shotgun sequence	0.95	205-220	RKERRRGIKRGPYKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVT0	Myp1 protein	0.697	977-985	RRSKKNNRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYI2	Chromosome 16, whole genome shotgun sequence	0.842	256-266	RSKKRDSRKKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYI2	Chromosome 16, whole genome shotgun sequence	0.704	176-186	KRKRQASVRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYI2	Chromosome 16, whole genome shotgun sequence	0.688	87-92	PRRRRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BYI2	Chromosome 16, whole genome shotgun sequence	0.634	98-103	RRGGNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCI7	Uncharacterized protein	0.826	154-163	RKRAKAKRTS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCI7	Uncharacterized protein	0.677	171-181	RSIRRFGGKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPW7	Serine/threonine-protein kinase	0.735	117-136	RRKAFKVIAKSAIAKSRKNR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMC3	Unplaced genomic scaffold um_scaf_contig_1.264, whole genome shotgun sequence	1	342-372	KTRKEKKQERRERKKKRREEKKQKRKDKKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DN11	Uncharacterized protein	0.996	107-121	KSSKKKNKKKKKKAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DN11	Uncharacterized protein	0.646	155-160	KKSSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ78	Endo/exonuclease/phosphatase domain-containing protein	0.95	15-45	AKQKNRPSPEEIEAKRRERAAKKDKEAAQKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTA3	Ribosomal 40S subunit protein S15	0.987	46-75	RARRRFQRGLKRKPMGLIKRLRKAKAEAPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUX6	C2H2-type domain-containing protein	0.889	5-27	RHGKKTHHARRDVKRGMRTRARK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DUX6	C2H2-type domain-containing protein	0.601	88-89	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVV6	Uncharacterized protein	0.902	209-227	ASRKSPKPSGKTSRKDKKD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVV6	Uncharacterized protein	0.879	647-656	KTNGKRARRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVV6	Uncharacterized protein	0.641	310-313	DKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVV6	Uncharacterized protein	0.639	453-460	RNKASGKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVV6	Uncharacterized protein	0.612	578-579	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXQ1	Chromosome 7, whole genome shotgun sequence	0.713	1677-1684	RKRGKRAE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3B1	Zn(2)-C6 fungal-type domain-containing protein	0.813	91-100	RKPRGPKGKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5A6	RRN7-type domain-containing protein	0.727	450-455	SKKRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5A6	RRN7-type domain-containing protein	0.659	143-148	HKRARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6I9	Transcription initiation factor IIE subunit beta	0.956	223-235	KNKKKKKGTGARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8L5	Chromosome 1, whole genome shotgun sequence (Fragment)	0.853	74-82	KSAKRKRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ECK2	Chromosome 1, whole genome shotgun sequence	0.629	102-106	RNKPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXF8	Uncharacterized protein	0.953	382-401	EKKRPTKKMAKSIAKPRKDP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXF8	Uncharacterized protein	0.803	446-459	KIRPKPPRKSTERS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BXF8	Uncharacterized protein	0.75	523-535	KAKYKESRKAKVK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CB85	Uncharacterized protein	0.638	20-25	RPRPAP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CD22	Uncharacterized protein	0.988	6-40	AKSLRLSFKGDKPKKRKRSSTKHDHGSLSSSRKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDU0	SMK-1 domain-containing protein	0.766	1054-1065	KRKPSRTSKSKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJX9	Chromosome 15, whole genome shotgun sequence	0.907	256-268	SKSKKSKKQKPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CJX9	Chromosome 15, whole genome shotgun sequence	0.796	107-115	RRRADKKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY49	Putative SWI/SNF catalytic subunit	0.918	1252-1284	GRRKKGVGRGRGLGGASETPEPSPGPSARKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY49	Putative SWI/SNF catalytic subunit	0.83	1480-1498	PRGIKIRLGKRSKVVKNGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CY49	Putative SWI/SNF catalytic subunit	0.733	1224-1233	KRERIEKRRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPG3	Replication termination factor 2	0.737	255-262	KRRKAERK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPG3	Replication termination factor 2	0.66	225-228	KKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DRQ8	Uncharacterized protein	0.636	205-210	KHRSRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSD8	Threonyl-tRNA synthetase	0.743	55-62	EKKPKAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTQ7	Chromosome 21, whole genome shotgun sequence	0.977	568-582	ANRKKKLQKRRKKQR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTQ7	Chromosome 21, whole genome shotgun sequence	0.83	79-97	SVKDKNKPGKQQGKKAAGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVA8	Chromosome 10, whole genome shotgun sequence	0.759	234-241	RRKRRHHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWH4	60S ribosomal export protein NMD3	0.892	407-421	PERKKRSKNRMWKLK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWH4	60S ribosomal export protein NMD3	0.603	488-488	R
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWN9	Chromosome 16, whole genome shotgun sequence	0.948	1109-1145	KEDKRKAKNKLRQAQKSKLADKDEQIRAVKRKAEMKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWN9	Chromosome 16, whole genome shotgun sequence	0.924	9-27	KAHRKAKTGGKAEKGKPKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWN9	Chromosome 16, whole genome shotgun sequence	0.793	183-196	KAKTLKATKKRLKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWN9	Chromosome 16, whole genome shotgun sequence	0.662	1157-1164	AAKRQKTA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZI4	Uncharacterized protein	0.999	981-1004	ARKRERKKRKKPPPPGARLWKKGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZI4	Uncharacterized protein	0.825	267-288	GFRTPLDRGPTRVKRAAPKSKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZI4	Uncharacterized protein	0.652	188-193	AKRQRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7W1	Uncharacterized protein	0.968	198-216	LQKERRLKRKKQRAGGVVK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7W1	Uncharacterized protein	0.889	93-119	KLKALEKAEKTKRHQAAERKRLEKQKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7W1	Uncharacterized protein	0.845	276-293	KARAFKKRTLAKKGVAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4P9X4	Pre-mRNA-splicing factor SPP2	0.978	347-402	RDDRHARHSRTSHRQRSRSPTRSGVHDRDRRHERRRDGRDPERRSHPSSRSDRDRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PFU7	rRNA-processing protein EFG1	0.688	291-304	KMAKKTDKTTKNKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWW9	Uncharacterized protein	0.963	744-760	KRRIRNERAKERRRLKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWW9	Uncharacterized protein	0.772	1138-1148	KSKRQRQPKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWW9	Uncharacterized protein	0.671	1050-1054	KRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWW9	Uncharacterized protein	0.613	1085-1087	PRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2F0	PAPA-1 domain-containing protein	0.799	211-226	RRAKDAFKVKWKPRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2F0	PAPA-1 domain-containing protein	0.687	329-333	ARKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C8A4	Uncharacterized protein	0.973	66-77	RRERKRRRRKLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLP3	Chromosome 12, whole genome shotgun sequence	0.629	434-438	KSSKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLP3	Chromosome 12, whole genome shotgun sequence	0.615	288-291	PKEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D0I7	Chromosome 1, whole genome shotgun sequence	0.898	545-603	KRKQEKEREANAAATGGGGGAARGGRGGGAAGSNSRGRGGMTPARGAAPRGRGGAAGGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DSU9	Chromosome 16, whole genome shotgun sequence	0.779	325-367	RRRLRALGLPPIPPKEIEDKAKREAEKLEKAQAQPPRHSNHAG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZ40	Uncharacterized protein	0.843	217-233	ARRAKYDKRASRQAKKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZV3	Uncharacterized protein	0.963	345-360	IAGIRPKGKRGRKSKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZV3	Uncharacterized protein	0.892	261-270	APKKRGRKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZV3	Uncharacterized protein	0.813	386-394	PAKRKRRTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E209	Diadenosine tetraphosphate synthetase	0.603	169-170	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E533	Transcription elongation factor 1 homolog	0.82	3-17	KRKSSSKKPSGAKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E671	RRM domain-containing protein	0.995	176-201	GLSARGRGRGRGRGRPFRGRGRGRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6B2	PNPLA domain-containing protein	0.716	189-197	ARKSRNKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E6B2	PNPLA domain-containing protein	0.673	614-619	AHRKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E815	60S ribosomal protein L36	0.968	73-97	RNSKDKRARKFIKRRVGTLRRAKNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E815	60S ribosomal protein L36	0.678	36-44	RPSNRKGRQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EA70	Chromosome 1, whole genome shotgun sequence	0.93	598-626	KKKVLKKQRQAEAKRLAKAEAEAAEKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ED03	Chromosome 1, whole genome shotgun sequence	0.618	20-22	SKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PFD9	Pre-mRNA-processing ATP-dependent RNA helicase PRP5	0.662	189-204	KKARLEAWRKEQAAKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CA16	Putative splicing factor 3b subunit 1	0.824	202-211	RTPKQKRKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAI6	Dihydrolipoyllysine-residue succinyltransferase	0.691	160-187	KKEEKKDEDNKKDESKEQKQPEKKSDDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIK4	Uncharacterized protein	0.735	204-212	PKKRAKQPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLP1	Chromosome 12, whole genome shotgun sequence	0.919	177-208	KSHRSPVKRSVSSSPKRRSVSPSKRPARSRTP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQU2	Nucleolar protein 9	0.951	629-652	GARGSKRGRDGKAKQSKTKYSKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQU2	Nucleolar protein 9	0.904	899-909	SAKSKRRKKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CQU2	Nucleolar protein 9	0.827	4-16	KIRQRGKKPSKVR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CWM4	Uncharacterized protein	0.781	55-65	RRKPQKKTKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT60	PAN2-PAN3 deadenylation complex catalytic subunit PAN2	0.997	427-486	KRNTVSGKGPGGIRASALHRPEDRKKIGIPLFRSEKEKEQSKKAAAAAADKKKKKAERKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXV5	Uncharacterized protein	0.747	199-214	ARAKERRNNPPPRVHG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY10	Chromosome 7, whole genome shotgun sequence	0.833	190-207	PPPSKKPLQKRPPPPHPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DY39	Protein kinase domain-containing protein	0.761	212-218	PKRRKRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYV4	Regulator Ustilago maydis 1 protein (Rum1)	0.981	1640-1652	DRKRKAKRGKRAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYV4	Regulator Ustilago maydis 1 protein (Rum1)	0.963	1066-1088	RKLHKRRGEPAAAPAGRRRRSKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E351	Chromosome 7, whole genome shotgun sequence	0.977	528-551	DAKRLAEKRRKRRESHNAVERRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E351	Chromosome 7, whole genome shotgun sequence	0.663	261-272	GKAPSSRARAGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E708	Uncharacterized protein	0.839	388-406	RRQKARDRNRDRPNKVKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EB25	Chromosome 1, whole genome shotgun sequence	0.994	858-879	RRRLGKKQSRKPGKKRRNSTRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EB25	Chromosome 1, whole genome shotgun sequence	0.977	347-372	RRMEAAARLHKRRLKRKELSTGKPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EB25	Chromosome 1, whole genome shotgun sequence	0.759	469-474	RRKKRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EB25	Chromosome 1, whole genome shotgun sequence	0.649	131-140	FRKPSISKPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PB56	Glycylpeptide N-tetradecanoyltransferase	0.994	78-95	KQRKKKKSKAAAKLRKKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C4U4	Component of oligomeric Golgi complex 8	0.999	1110-1121	GKKNRKKKKKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIG1	Uncharacterized protein	0.923	702-720	ERRQKHVFLHRKKRTKKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIG1	Uncharacterized protein	0.922	179-192	RHHRQRKEERRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIG1	Uncharacterized protein	0.914	896-907	RKMRKKERRRIK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CIG1	Uncharacterized protein	0.621	132-136	RRRDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CKG8	Uncharacterized protein	0.952	189-205	RLEKNKQKSKAKRKPLR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CKG8	Uncharacterized protein	0.695	126-134	RRSAKVRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1D2	Chromosome 1, whole genome shotgun sequence	0.966	264-278	KKKKKLNKSKSKPKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DMF3	Chromosome 23, whole genome shotgun sequence	0.652	153-156	KKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPF4	Chromosome 19, whole genome shotgun sequence	0.938	231-245	KLKRHFRRGRKRSEK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQ94	Putative methylsterol monooxygenase	0.753	292-305	RARARQAEKKREAL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQQ8	Chromosome 19, whole genome shotgun sequence	0.99	150-180	KDKRNAKKARAADRAKRSGKHREERRESQGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT34	Chromosome 23, whole genome shotgun sequence	0.604	328-329	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWZ4	Eukaryotic translation initiation factor 3 subunit J	0.798	58-68	PRKKKSVKQKI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWZ4	Eukaryotic translation initiation factor 3 subunit J	0.778	204-223	KAEKEAKKAGGQKTKLAAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXN0	Chromosome 7, whole genome shotgun sequence	0.723	161-167	RRRKQRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E042	Cysteinyl-tRNA synthetase	0.722	794-798	KKRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7Z9	DNA helicase	0.964	1160-1176	KARASRGKKRLGIRRRV
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7Z9	DNA helicase	0.749	657-664	AGKRKPKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EAA3	DIS3-like exonuclease 2	0.886	621-632	KKEKEDKKKRKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PFA7	Mitochondrial distribution and morphology protein 34	0.736	252-261	RKSHSKAKKH
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q4PHZ2	Putative lipase ATG15	0.874	445-456	VRKKKAKLRSIG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVS5	Non-specific serine/threonine protein kinase	0.99	398-435	RQREKLKEREREKEREREREKERGERDRDRDRERRSRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVS5	Non-specific serine/threonine protein kinase	0.677	1523-1528	KRKPSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BVS5	Non-specific serine/threonine protein kinase	0.607	1535-1537	RSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3B6	Chromosome 10, whole genome shotgun sequence	0.955	169-184	GLKEDKKKPKRRPTDK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3B6	Chromosome 10, whole genome shotgun sequence	0.712	680-686	GMGKRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CL90	PseudoU_synth_1 domain-containing protein	0.838	63-78	RTRQKQAAGKKVKKHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D0H2	Chromosome 1, whole genome shotgun sequence	0.628	68-70	RKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP15	Uncharacterized protein	0.976	372-399	KSKERRRRIAERRAAQKEHKRQDRALRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP15	Uncharacterized protein	0.971	633-643	RARKRRLRKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP15	Uncharacterized protein	0.946	669-683	ARRRRRGRPGHPQRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP15	Uncharacterized protein	0.795	46-61	KHRRHSPFGHRKRSKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPH3	Chromosome 21, whole genome shotgun sequence	0.849	1365-1393	KRATRTRITRGAGAPAAKPVRAPRSRAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPH3	Chromosome 21, whole genome shotgun sequence	0.766	1322-1333	RRGKTAAAKKGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPH3	Chromosome 21, whole genome shotgun sequence	0.672	984-990	PVKGRRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPH3	Chromosome 21, whole genome shotgun sequence	0.65	973-976	KKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DPH3	Chromosome 21, whole genome shotgun sequence	0.603	476-476	K
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DQI9	Uncharacterized protein	0.965	323-340	RRPKRRHRRSAAGRSSKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT85	tRNA (guanine(9)-N1)-methyltransferase	0.987	34-68	KNAAKKLARKHKLEATKHERRAVERLKKKENKRAR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DT85	tRNA (guanine(9)-N1)-methyltransferase	0.851	396-411	ALPRRKLKQRGPAAKT
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTD5	Chromosome 15, whole genome shotgun sequence	0.686	250-261	RKSKTSGAARRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVI7	Chromosome 12, whole genome shotgun sequence	0.632	269-271	KRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWT1	Chromosome 8, whole genome shotgun sequence	0.627	249-254	KPSLRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXQ4	RRM domain-containing protein	0.992	363-379	KKKRKRELAKAKKARKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXQ4	RRM domain-containing protein	0.864	301-320	KKLREEEAKKKARDEARAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXQ4	RRM domain-containing protein	0.659	11-23	RGGRRNAPANARA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZF6	Uncharacterized protein	0.751	415-427	RTKRRNAMRRHKL
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E528	Uncharacterized protein	0.977	492-527	LRPPAKDIGVKTSGRKSKLGGERLPREPRKGKAKQD
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E528	Uncharacterized protein	0.959	142-156	RRDKNGRRLAKRKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E528	Uncharacterized protein	0.796	658-670	KPKKAGKKPDTTK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E528	Uncharacterized protein	0.784	723-728	KRRRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E528	Uncharacterized protein	0.655	102-110	AKRTRASKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5I3	Uncharacterized protein	0.983	235-261	SSHRRRSDKRGHDQRREKRHLRRRAPE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5I3	Uncharacterized protein	0.953	182-223	TKRRKNEKEARSHKCHHEREHRHRPESRRDKVAERGDKQRRP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E5I3	Uncharacterized protein	0.613	295-298	RPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9L2	Chromosome 1, whole genome shotgun sequence	0.971	496-510	KPKKKKKASSKSKSK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Q6	Uncharacterized protein	0.806	589-606	REREKLLRKQALKRGAGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Q6	Uncharacterized protein	0.754	26-53	RERREREVAAKLAEREAREREQKDRERK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Q6	Uncharacterized protein	0.658	138-141	RRKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Q6	Uncharacterized protein	0.655	475-479	KKKLA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9Q6	Uncharacterized protein	0.654	264-274	KVKEARGNGRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWV7	Uncharacterized protein	0.897	1041-1054	VKKRHREAARKHKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWV7	Uncharacterized protein	0.894	29-66	RKRKQERKQAGRDYLAKKAKEEQLATRKELREARKQKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BWV7	Uncharacterized protein	0.734	328-336	RKNPKKTKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1BX33	Uncharacterized protein	0.624	192-195	KKPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C3N8	Chromosome 9, whole genome shotgun sequence	0.605	393-394	KK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C9N3	Lysine--tRNA ligase	0.921	32-49	LKRRLKLREKEAKKAAKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGP8	Probable electron transfer flavoprotein subunit beta	0.63	219-221	KKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPA7	Chromosome 9, whole genome shotgun sequence	0.679	317-323	RYRLKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CPA7	Chromosome 9, whole genome shotgun sequence	0.616	267-268	KR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP16	PITH domain-containing protein	0.844	902-912	KRRIVKKRKSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXA8	Chromosome 10, whole genome shotgun sequence	0.733	557-564	RRRRRNSM
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXA8	Chromosome 10, whole genome shotgun sequence	0.666	571-576	PKRPPK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXS4	DNA topoisomerase 2	0.992	17-60	PKKKPSATKPKAAAKPKAAAGAKAGASKSNNAAARPKKQPLAKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXS4	DNA topoisomerase 2	0.98	1443-1468	AKNKKRAGAAKPAAGKKAAAGLGRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXS4	DNA topoisomerase 2	0.866	1255-1280	KVKKGKQSTKKTSAKSGAAARRVLKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXS4	DNA topoisomerase 2	0.769	1313-1329	KKKAAAPAMRASPARKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DYT1	Putative proteasome regulatory particle base subunit RPT2	0.975	10-41	PGRGGKDNKKDQQKKWEPPLPTRVGKKKKRGP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E113	Chromosome 9, whole genome shotgun sequence	0.635	1328-1340	RLRRMSAAERQKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3G9	Methionine aminopeptidase	0.895	339-349	KSREERKKRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9H1	5'-deoxynucleotidase	0.75	1088-1099	KEAKARRSGKHK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1ECM1	Chromosome 1, whole genome shotgun sequence	0.726	1037-1044	KRKRRISK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	Q99107	Protein TSD2	0.993	240-271	GSGGKRKRGSHSPLSRRRQRHKQGQRHKPRHR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1L8	Chromosome 12, whole genome shotgun sequence	0.994	150-201	AKQSGNKRKRDASPKPAKSKKSAGKDKTGGDKAINGKVAKDDLAAKKQKPTR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C1L8	Chromosome 12, whole genome shotgun sequence	0.976	795-823	KKKRKKALAAEKATAAAAKDRGKGKSAAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2A1	Uncharacterized protein	0.833	363-376	LGRRQRKKVVRIGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2A1	Uncharacterized protein	0.759	192-200	PRKKRVRPS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C2A1	Uncharacterized protein	0.661	230-235	RKNKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDE0	HTH La-type RNA-binding domain-containing protein	0.709	655-671	PKGAKGGNKQPQKQQPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDL1	Uncharacterized protein	0.979	271-286	KQQRKREKKQRKRDKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DTZ4	FHA domain-containing protein	0.743	721-731	SKRGNGRRSKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DV67	Chromosome 10, whole genome shotgun sequence	0.684	1217-1223	KRPAKKP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX25	Ribonucloprotein	0.961	89-121	SKKLFKLTKKASKSRGHVKRGVKEVVKALRKGE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX25	Ribonucloprotein	0.787	7-15	KKDKKSKRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DX25	Ribonucloprotein	0.704	36-43	KKDKKEKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXW5	Chromosome 9, whole genome shotgun sequence	0.894	537-546	ARKKRKHGRS
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DXW5	Chromosome 9, whole genome shotgun sequence	0.728	832-844	KRQRLRKLRIAKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZJ4	Chromosome 7, whole genome shotgun sequence	0.792	559-573	WLKEKKPTLTKKHKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E2Q5	Chromosome 7, whole genome shotgun sequence	0.937	148-174	PPKVSKPRRSSTAAKPGRPKGSTKAAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E4K3	Abhydrolase_3 domain-containing protein	0.688	223-229	SKRSKKQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7M5	TRP domain-containing protein	0.67	1120-1129	KKQKPKFWKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8W0	Chromosome 1, whole genome shotgun sequence	0.975	90-114	AKRNKIKQKHNREKRNDTKKKRTPA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8W0	Chromosome 1, whole genome shotgun sequence	0.958	1246-1266	AKKAAQRKEKAKAKAQAKSRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8W0	Chromosome 1, whole genome shotgun sequence	0.8	1045-1052	DAKKRPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8X1	Pescadillo homolog	0.964	655-673	AKLQQKKKALNKKAVKGRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8X1	Pescadillo homolog	0.748	600-617	AALKEPRRRQGVDGAPKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EDK0	Chromosome 1, whole genome shotgun sequence	0.999	674-724	RDRNESKEDRKARKEALKANKKERKERKMKTKQAFASEKKKQTKAERGRKE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C7L2	Uncharacterized protein	0.911	463-471	RTKKKRRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAC0	Putative nucleolar protein	0.866	663-674	LKKATAKGKARR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CAC0	Putative nucleolar protein	0.728	27-44	GKRKAHESSLPVKKAKIA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CCP2	Uncharacterized protein	0.881	368-385	NRPGKKRDERRPPEHIRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CDH4	Uncharacterized protein	0.975	9-20	PKRRRRRNKKVK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGX2	Chromosome 1, whole genome shotgun sequence	0.994	210-243	IAAAKAAAAAAPPKEKKKKSAKDGKSKSGAGAGG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGX2	Chromosome 1, whole genome shotgun sequence	0.964	121-142	KKQKKDKRPAEEKKTGGRKNKG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CRE5	Dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase	0.66	424-428	RRRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVM7	Uncharacterized protein	0.81	23-41	QKRPPATSKHTSPRKRQRA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CVM7	Uncharacterized protein	0.628	463-465	GKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZT4	Chromosome 1, whole genome shotgun sequence	0.914	33-53	QKEEEAAKKAAIAKMAGGKKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CZT4	Chromosome 1, whole genome shotgun sequence	0.765	7-17	GKAKPLKAPKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1M0	Chromosome 1, whole genome shotgun sequence	0.74	1693-1704	RRARLREKRALK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU17	Uncharacterized protein	0.997	616-668	ERERLRIEELERERQKERERELEREREREREREKEREKEKERERRERRREKQQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DU17	Uncharacterized protein	0.668	123-134	RERERERERERE
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3P6	Uncharacterized protein	0.825	836-845	RKRRRRHDSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3P7	Zn(2)-C6 fungal-type domain-containing protein	0.953	153-164	HHRGRKPKKRPR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E9B2	Uncharacterized protein	0.789	131-139	MRRRKQRRI
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	O13394	Chitin synthase 5	0.656	297-306	RRKQSKSGNK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C0Z7	Telomere replication protein EST3	0.775	513-522	KKPSKRRLRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5Q8	Chromosome 7, whole genome shotgun sequence	0.914	249-258	LKNKKRKRRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C5Q8	Chromosome 7, whole genome shotgun sequence	0.678	795-799	SKRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1C9T6	Ribosomal 60S subunit protein L39	0.605	41-42	RR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGC6	Chromosome 1, whole genome shotgun sequence	0.74	143-150	KRKPKSKR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGC6	Chromosome 1, whole genome shotgun sequence	0.67	1324-1330	KKSRLRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CGC6	Chromosome 1, whole genome shotgun sequence	0.622	1310-1312	RKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLR2	Chromosome 12, whole genome shotgun sequence	0.995	287-299	AKKKNKKKKKKGA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CLR2	Chromosome 12, whole genome shotgun sequence	0.907	213-232	KKVQAKKKEKAEAGDRQRKK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1CUJ1	Uncharacterized protein	0.97	151-188	RKPKKRRLVRGGGARSPSRDHSQEPADRPRHNRSRSPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1D1H2	Chromosome 1, whole genome shotgun sequence	0.731	238-248	KSTPKKRQIRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DP02	Uncharacterized protein	0.696	43-56	NRQKPESKMRMRRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVN6	Chromosome 12, whole genome shotgun sequence	0.99	621-659	GPTPHRGRGRPRKHPLPGTPGGPPVPVPRKKKEKPVKPP
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DVN6	Chromosome 12, whole genome shotgun sequence	0.804	387-413	RELERIKRQQERAAAKAAKLEKERENR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWJ5	Uncharacterized protein	0.999	232-345	QLAPSQKSKKSKEANKDRKDKKNKAGKKEKKKKKFKAENDLPPAPIEPPTKSNKRKRTNVADDAGDSKKLKENKAEKKDRDKAEKKKMKEKHENAKEIKSPSKAKREKKNRDEQ
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DWJ5	Uncharacterized protein	0.885	206-228	ARRLAKKALRKQLKASRASSSAA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZG0	Chromosome 7, whole genome shotgun sequence	0.987	73-100	DARAGRPRNGESRGRGGRGRGRGAPRGR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1DZG0	Chromosome 7, whole genome shotgun sequence	0.981	247-277	GGRGGARGGARGGARGERGAGRGRGGRGGRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E3K0	Zn(2)-C6 fungal-type domain-containing protein	0.917	67-106	QKKGKKARSGSTTSAASKSTKVKPDEAPSPSEPKAKKRRR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7P2	Transcriptional activator HAP2	0.856	203-227	RPRARKRTRAEEEPRSRLSSSSRSR
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E7P2	Transcriptional activator HAP2	0.766	438-451	SRHRHAVRRPRGPG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E8S6	Chromosome 1, whole genome shotgun sequence	0.738	312-321	RRRSKSKDRG
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E907	Chromosome 1, whole genome shotgun sequence	0.863	555-567	KKKKEGAGARKAK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E907	Chromosome 1, whole genome shotgun sequence	0.732	1207-1214	KLKLKKKA
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1E907	Chromosome 1, whole genome shotgun sequence	0.657	1061-1071	KKNQERRIQRK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	A0A0D1EBV4	Chromosome 1, whole genome shotgun sequence	0.731	811-821	HRKTHERKRGK
UP000000561	Mycosarcoma maydis (Corn smut fungus) (Ustilago maydis)	P14746	DNA repair exonuclease REC1	0.715	91-97	RPKKRSK